A0A023IPH2_HUMAN Loading...

Integrin a4 subunit

AlphaFold DB , UniProt , Accession A0A023IPH2, Species HUMAN (Homo sapiens, Human), Gene ITGA4, Length 34 aa.

						>A0A023IPH2_HUMAN|A0A023IPH2|ITGA4
SSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	62.3	Low	67.7	Low	138 Å²	138	118.3 Å²	118.3	97%	0.965	61%	0.608	S	S	*	*				0	116	0	-167	0	0	0	107.4
2	S	58.8	Low	68.5	Low	126 Å²	126	114.5 Å²	114.5	88%	0.881	59%	0.59	S	S	*	*			trans	-96.8	104.8	-176.4	-57.2	0	0	0	108.9	W4	S2-W4 PolarHBondContact O-N 3.24Å
3	Y	59.8	Low	69.4	Low	199 Å²	199	115.8 Å²	115.8	78%	0.78	60%	0.597	S	S	*	*			trans	-78.8	112.4	175.4	-56.2	-83.7	0	0	108.3
4	W	56.9	Low	70.6	Confident	217 Å²	217	117.4 Å²	117.4	82%	0.822	62%	0.615	S	S	*	*			trans	-93.3	113.9	176.5	179.6	65.4	0	0	109.8	S2 N26	S2-W4 PolarHBondContact O-N 3.24Å; W4-N26 PolarHBondContact O-ND2 2.99Å
5	T	63.1	Low	71.5	Confident	82 Å²	82	114.6 Å²	114.6	50%	0.503	60%	0.604	S	S	.	*			trans	-89	101.5	165.8	-66.6	0	0	0	108.2	N26 V28	T5-N26 WeakPolarHBondContact CA-ND2 3.38Å; T5-N26 PolarHBondContact OG1-ND2 3.22Å; T5-N26 VanDerWaalsContact CA-ND2 3.29Å; T5-V28 WeakPolarHBondContact OG1-CG2 3.42Å
6	G	68.4	Low	72.2	Confident	12 Å²	12	115.3 Å²	115.3	12%	0.124	61%	0.608	C	S	.	*			trans	-106.7	136.9	176.6	0	0	0	0	111.7	D23	G6-D23 WeakPolarHBondContact O-CB 3.4Å
7	S	69.3	Low	72.8	Confident	61 Å²	61	116.7 Å²	116.7	43%	0.427	61%	0.608	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-102.9	130.5	167.3	-64.8	0	0	0	108.8
8	L	74.8	Confident	73.1	Confident	113 Å²	113	121.2 Å²	121.2	59%	0.592	62%	0.618	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-97.4	116.2	179.1	-177.1	65.6	0	0	109.9	V10 F21	L8-V10 HydrophobicContact CD2-CG2 4.13Å; L8-V10 HydrophobicContact CG-CG2 4.04Å; L8-F21 PolarHBondContact N-O 3.39Å; L8-F21 PolarHBondContact O-N 3.4Å
9	F	75.4	Confident	73.3	Confident	155 Å²	155	122.1 Å²	122.1	68%	0.68	62%	0.617	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-96.9	120.8	174.1	-60.1	-88.3	0	0	109.1	A20	F9-A20 HydrophobicContact CD1-CB 3.77Å; F9-A20 HydrophobicContact CE1-CB 3.79Å
10	V	77.9	Confident	73.2	Confident	67 Å²	67	119.1 Å²	119.1	41%	0.406	61%	0.612	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.7	123	176.6	-176.5	0	0	0	108.6	L8 K19 F21	L8-V10 HydrophobicContact CD2-CG2 4.13Å; L8-V10 HydrophobicContact CG-CG2 4.04Å; V10-K19 PolarHBondContact N-O 2.99Å; V10-K19 PolarHBondContact O-N 2.95Å; V10-F21 HydrophobicContact CB-CD2 4.43Å; V10-F21 HydrophobicContact CG2-CE2 3.88Å; V10-F21 HydrophobicContact CG2-CD2 3.87Å; V10-F21 HydrophobicContact CB-CE2 4.13Å
11	Y	78.4	Confident	73	Confident	131 Å²	131	118.6 Å²	118.6	51%	0.514	61%	0.605	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-98.5	125.7	174.2	178	-120.2	0	0	110.1	I13 N16	Y11-I13 HydrophobicContact CD1-CG1 3.6Å; Y11-I13 HydrophobicContact CE1-CB 4.1Å; Y11-I13 HydrophobicContact CE1-CG1 3.45Å; Y11-I13 VanDerWaalsContact CE1-CG1 3.45Å; Y11-N16 PolarHBondContact OH-ND2 3.21Å
12	N	77.6	Confident	73.2	Confident	73 Å²	73	117.5 Å²	117.5	39%	0.39	59%	0.588	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.9	105.4	172.2	-174.1	-48.1	0	0	108.9	T14 T15 N16 K17	N12-T14 PolarHBondContact OD1-N 2.92Å; N12-T15 WeakPolarHBondContact CB-OG1 3.4Å; N12-T15 PolarHBondContact OD1-N 2.9Å; N12-T15 PolarHBondContact OD1-OG1 2.89Å; N12-N16 PolarHBondContact O-N 3.23Å; N12-N16 WeakPolarHBondContact O-CA 3.29Å; N12-K17 PolarHBondContact N-O 2.94Å; N12-K17 PolarHBondContact O-N 2.89Å
13	I	79.4	Confident	73.3	Confident	132 Å²	132	114.8 Å²	114.8	68%	0.677	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.6	-43.7	-177.6	-60.7	160.7	0	0	110.9	Y11 T15 N16	Y11-I13 HydrophobicContact CD1-CG1 3.6Å; Y11-I13 HydrophobicContact CE1-CB 4.1Å; Y11-I13 HydrophobicContact CE1-CG1 3.45Å; Y11-I13 VanDerWaalsContact CE1-CG1 3.45Å; I13-T15 VanDerWaalsContact C-N 3.34Å; I13-T15 PolarHBondContact O-N 2.84Å; I13-N16 PolarHBondContact O-N 3.39Å
14	T	86	Confident	73.3	Confident	138 Å²	138	113.6 Å²	113.6	85%	0.847	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.5	-34.6	-175.1	-46.1	0	0	0	113	N12	N12-T14 PolarHBondContact OD1-N 2.92Å
15	T	84.1	Confident	73.4	Confident	75 Å²	75	112.4 Å²	112.4	46%	0.46	57%	0.566	S	S	.	*	T	Hydrogen-bonded Turn	trans	-102.9	-0.9	-179	58.5	0	0	0	113.4	N12 I13 K17	N12-T15 WeakPolarHBondContact CB-OG1 3.4Å; N12-T15 PolarHBondContact OD1-N 2.9Å; N12-T15 PolarHBondContact OD1-OG1 2.89Å; I13-T15 VanDerWaalsContact C-N 3.34Å; I13-T15 PolarHBondContact O-N 2.84Å; T15-K17 WeakPolarHBondContact O-CG 3.46Å; T15-K17 PolarHBondContact O-N 3.02Å
16	N	83.9	Confident	72.9	Confident	125 Å²	125	110.9 Å²	110.9	67%	0.668	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	46.6	41.6	-172.6	-151.7	-72.3	0	0	112.8	Y11 N12 I13	Y11-N16 PolarHBondContact OH-ND2 3.21Å; N12-N16 PolarHBondContact O-N 3.23Å; N12-N16 WeakPolarHBondContact O-CA 3.29Å; I13-N16 PolarHBondContact O-N 3.39Å
17	K	81.3	Confident	72.5	Confident	140 Å²	140	115.9 Å²	115.9	61%	0.609	58%	0.575	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-120.6	136.9	-178.1	-76.4	176.4	-173	-174.3	109.9	N12 T15	N12-K17 PolarHBondContact N-O 2.94Å; N12-K17 PolarHBondContact O-N 2.89Å; T15-K17 WeakPolarHBondContact O-CG 3.46Å; T15-K17 PolarHBondContact O-N 3.02Å
18	Y	78.8	Confident	71.9	Confident	198 Å²	198	116.8 Å²	116.8	78%	0.776	58%	0.578	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-92	140.4	168.6	70	-89.1	0	0	109.2
19	K	76.6	Confident	71.1	Confident	138 Å²	138	120.4 Å²	120.4	60%	0.6	59%	0.589	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-125.8	117.5	166.6	-75.2	-169	175.8	-174.7	108.1	V10 F21	V10-K19 PolarHBondContact N-O 2.99Å; V10-K19 PolarHBondContact O-N 2.95Å; K19-F21 HydrophobicContact CB-CE2 3.85Å; K19-F21 HydrophobicContact CB-CZ 4.21Å; K19-F21 HydrophobicContact CD-CZ 4.22Å
20	A	71.2	Confident	70.3	Confident	62 Å²	62	122 Å²	122	51%	0.512	60%	0.595	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.5	121.5	170.6	0	0	0	0	108.3	F9	F9-A20 HydrophobicContact CD1-CB 3.77Å; F9-A20 HydrophobicContact CE1-CB 3.79Å
21	F	69.2	Low	69.3	Low	109 Å²	109	121.4 Å²	121.4	48%	0.478	60%	0.604	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.1	114.2	169.9	-64	-85.4	0	0	107.6	L8 V10 K19	L8-F21 PolarHBondContact N-O 3.39Å; L8-F21 PolarHBondContact O-N 3.4Å; V10-F21 HydrophobicContact CB-CD2 4.43Å; V10-F21 HydrophobicContact CG2-CE2 3.88Å; V10-F21 HydrophobicContact CG2-CD2 3.87Å; V10-F21 HydrophobicContact CB-CE2 4.13Å; K19-F21 HydrophobicContact CB-CE2 3.85Å; K19-F21 HydrophobicContact CB-CZ 4.21Å; K19-F21 HydrophobicContact CD-CZ 4.22Å
22	L	66.6	Low	68.1	Low	114 Å²	114	120.9 Å²	120.9	60%	0.597	62%	0.619	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-71.4	129.6	162.7	-160.9	80.6	0	0	106.7	K24 Q27	L22-K24 PolarHBondContact O-N 2.89Å; L22-Q27 HydrophobicContact CD2-CG 4.37Å
23	D	60.4	Low	67.1	Low	69 Å²	69	127.3 Å²	127.3	37%	0.369	64%	0.639	S	S	.	*			trans	-60.7	104.2	175.9	-172.4	-98.7	0	0	109	G6 Q25 N26 Q27	G6-D23 WeakPolarHBondContact O-CB 3.4Å; D23-Q25 PolarHBondContact OD1-N 3.22Å; D23-Q25 PolarHBondContact O-N 2.82Å; D23-N26 HydrophobicContact CB-CB 4.44Å; D23-N26 CarbonylContact O-C 3.24Å; D23-N26 VanDerWaalsContact O-C 3.24Å; D23-N26 PolarHBondContact O-N 2.7Å; D23-N26 WeakPolarHBondContact OD1-CA 3.2Å; D23-N26 WeakPolarHBondContact OD1-CB 3.49Å; D23-N26 PolarHBondContact OD1-N 3.2Å; D23-Q27 PolarHBondContact O-N 3.29Å
24	K	60.8	Low	65.7	Low	175 Å²	175	133 Å²	133	76%	0.761	67%	0.669	S	S	*	*	G	3₁₀ helix	trans	-66.9	-20.4	-178.8	-94.5	-171	174.5	-176.7	112.1	L22	L22-K24 PolarHBondContact O-N 2.89Å
25	Q	58.3	Low	64.6	Low	191 Å²	191	132.7 Å²	132.7	89%	0.893	66%	0.66	S	S	*	*	G	3₁₀ helix	trans	-81.6	-18.7	177.3	-72.6	-178.6	-7.8	0	112.6	D23	D23-Q25 PolarHBondContact OD1-N 3.22Å; D23-Q25 PolarHBondContact O-N 2.82Å
26	N	53.2	Low	63.6	Low	51 Å²	51	135.7 Å²	135.7	27%	0.273	67%	0.671	S	S	.	*	G	3₁₀ helix	trans	-124.9	47.3	173	-162.8	17	0	0	110.5	W4 T5 D23 V28	W4-N26 PolarHBondContact O-ND2 2.99Å; T5-N26 WeakPolarHBondContact CA-ND2 3.38Å; T5-N26 PolarHBondContact OG1-ND2 3.22Å; T5-N26 VanDerWaalsContact CA-ND2 3.29Å; D23-N26 HydrophobicContact CB-CB 4.44Å; D23-N26 CarbonylContact O-C 3.24Å; D23-N26 VanDerWaalsContact O-C 3.24Å; D23-N26 PolarHBondContact O-N 2.7Å; D23-N26 WeakPolarHBondContact OD1-CA 3.2Å; D23-N26 WeakPolarHBondContact OD1-CB 3.49Å; D23-N26 PolarHBondContact OD1-N 3.2Å; N26-V28 PolarHBondContact O-N 3.34Å
27	Q	59.1	Low	62.5	Low	117 Å²	117	136.3 Å²	136.3	55%	0.547	67%	0.671	S	S	.	*			trans	-65.2	87.4	156.8	-73.4	-175.3	-74.4	0	106.6	L22 D23 K29	L22-Q27 HydrophobicContact CD2-CG 4.37Å; D23-Q27 PolarHBondContact O-N 3.29Å; Q27-K29 VanDerWaalsContact C-N 3.27Å; Q27-K29 PolarHBondContact O-N 2.8Å
28	V	57.3	Low	61.4	Low	80 Å²	80	136.1 Å²	136.1	49%	0.485	68%	0.675	S	S	.	*			trans	-47.5	106.7	157.5	173.1	0	0	0	104.4	T5 N26 F30	T5-V28 WeakPolarHBondContact OG1-CG2 3.42Å; N26-V28 PolarHBondContact O-N 3.34Å; V28-F30 VanDerWaalsContact C-N 3.33Å; V28-F30 PolarHBondContact O-N 2.83Å
29	K	56.8	Low	60.3	Low	188 Å²	188	132.3 Å²	132.3	82%	0.817	67%	0.668	S	S	*	*			trans	-60.3	103.9	179.9	-70	-177.9	179.1	-179.3	105	Q27 G31	Q27-K29 VanDerWaalsContact C-N 3.27Å; Q27-K29 PolarHBondContact O-N 2.8Å; K29-G31 PolarHBondContact O-N 2.83Å
30	F	58.8	Low	59.2	Low	188 Å²	188	131.9 Å²	131.9	83%	0.825	67%	0.673	S	S	*	*	S	Bend	trans	-62.8	94.2	166.3	-82.8	-87.3	0	0	106.1	V28	V28-F30 VanDerWaalsContact C-N 3.33Å; V28-F30 PolarHBondContact O-N 2.83Å
31	G	56.6	Low	58.4	Low	56 Å²	56	136.9 Å²	136.9	58%	0.577	68%	0.684	S	S	*	*			trans	161.5	63.9	-170.3	0	0	0	0	112.7	K29	K29-G31 PolarHBondContact O-N 2.83Å
32	S	53.9	Low	57.5	Low	119 Å²	119	139 Å²	139	83%	0.832	70%	0.7	S	S	*	*			trans	167.6	71	147.9	-93.1	0	0	0	107.4
33	Y	56	Low	56.8	Low	209 Å²	209	141.1 Å²	141.1	82%	0.82	71%	0.709	S	S	*	*			trans	-71.7	129.8	144.4	-64.5	-75.1	0	0	105.1
34	L	50	Low	56.4	Low	250 Å²	250	147.6 Å²	147.6	100%	1.309	74%	0.74	S	S	*	*			trans	-41	0	178.1	-88.7	110.1	0	0	112.9

Retrieved 34 of 34 residues in 25.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).