A0A023IQK0_HUMAN Loading...

Integrin a4 subunit

AlphaFold DB , UniProt , Accession A0A023IQK0, Species HUMAN (Homo sapiens, Human), Gene ITGA4, Length 66 aa.

						>A0A023IQK0_HUMAN|A0A023IQK0|ITGA4
DYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	D	61.8	Low	76.7	Confident	157 Å²	157	101.7 Å²	101.7	84%	0.84	50%	0.504	S	S	*	.				0	57.1	0	-135.3	-0.5	0	0	111.5	K4	D1-K4 WeakPolarHBondContact OD2-CD 3.26Å
2	Y	62.7	Low	77.6	Confident	184 Å²	184	94 Å²	94	72%	0.722	47%	0.467	S	S	*	.	H	α-helix	trans	-74.2	-41.4	-174.5	172.2	-95.6	0	0	112.2	K4 K5 F6	Y2-K4 PolarHBondContact O-N 2.83Å; Y2-K5 PolarHBondContact O-N 2.85Å; Y2-F6 PolarHBondContact O-N 2.91Å; Y2-F6 VanDerWaalsContact O-N 3.08Å
3	V	68.1	Low	78.5	Confident	98 Å²	98	88.7 Å²	88.7	59%	0.594	45%	0.445	S	S	*	.	H	α-helix	trans	-59.7	-34.3	-179.9	-177.5	0	0	0	111.6	F6	V3-F6 WeakPolarHBondContact O-CB 3.4Å; V3-F6 PolarHBondContact O-N 2.89Å
4	K	68.6	Low	79.5	Confident	94 Å²	94	89.5 Å²	89.5	41%	0.409	45%	0.446	S	S	.	.	H	α-helix	trans	-65.6	-52.9	178.2	-150.2	170.5	-174.1	177.6	111	D1 Y2 F6 G7 Y35 F62	D1-K4 WeakPolarHBondContact OD2-CD 3.26Å; Y2-K4 PolarHBondContact O-N 2.83Å; K4-F6 PolarHBondContact O-N 3.1Å; K4-G7 PolarHBondContact O-N 2.8Å; K4-Y35 VanDerWaalsContact O-CE1 3.29Å; K4-Y35 WeakPolarHBondContact O-CE1 3.27Å; K4-Y35 PolarHBondContact O-OH 3.2Å; K4-F62 HydrophobicContact CD-CE1 4.17Å; K4-F62 VanDerWaalsContact CE-CE1 3.44Å; K4-F62 HydrophobicContact CG-CD1 4.17Å; K4-F62 HydrophobicContact CG-CE1 3.62Å
5	K	78.8	Confident	80.5	Confident	147 Å²	147	86.8 Å²	86.8	64%	0.639	44%	0.443	S	S	*	.	H	α-helix	trans	-61.3	-29	177.3	-68.4	-171.6	175.5	-174.1	113.7	Y2 G7 E8	Y2-K5 PolarHBondContact O-N 2.85Å; K5-G7 VanDerWaalsContact C-N 3.28Å; K5-G7 PolarHBondContact O-N 2.86Å; K5-E8 PolarHBondContact O-N 2.81Å
6	F	80.8	Confident	81.3	Confident	95 Å²	95	83.8 Å²	83.8	42%	0.417	44%	0.441	S	S	.	.	H	α-helix	trans	-60.6	-36.9	178.4	-175.2	-101.2	0	0	112.5	Y2 V3 K4 S12 W36	Y2-F6 PolarHBondContact O-N 2.91Å; Y2-F6 VanDerWaalsContact O-N 3.08Å; V3-F6 WeakPolarHBondContact O-CB 3.4Å; V3-F6 PolarHBondContact O-N 2.89Å; K4-F6 PolarHBondContact O-N 3.1Å; F6-S12 VanDerWaalsContact CE1-CB 3.48Å; F6-S12 WeakPolarHBondContact O-CB 3.17Å; F6-S12 PolarHBondContact O-N 3.19Å; F6-S12 PolarHBondContact O-OG 3.22Å; F6-W36 AromaticContact CD1-CH2 3.75Å; F6-W36 HydrophobicContact CD1-CH2 3.75Å; F6-W36 AromaticContact CE1-CH2 3.66Å; F6-W36 HydrophobicContact CE1-CH2 3.66Å; F6-W36 HydrophobicContact CE1-CZ2 4.11Å
7	G	77.1	Confident	82.1	Confident	0 Å²	0	86.1 Å²	86.1	0%	0	45%	0.452	C	S	.	.	T	Hydrogen-bonded Turn	trans	-88.6	-5.3	179.1	0	0	0	0	115.2	K4 K5 S34 Y35	K4-G7 PolarHBondContact O-N 2.8Å; K5-G7 VanDerWaalsContact C-N 3.28Å; K5-G7 PolarHBondContact O-N 2.86Å; G7-S34 WeakPolarHBondContact O-CA 3.46Å; G7-Y35 PolarHBondContact O-N 3.25Å
8	E	83.8	Confident	82.8	Confident	79 Å²	79	85 Å²	85	37%	0.369	45%	0.453	S	S	.	.	S	Bend	trans	-71.3	136.7	-174.6	-73.2	-177.5	166	0	112.5	K5 F10 A11 Y35	K5-E8 PolarHBondContact O-N 2.81Å; E8-F10 PolarHBondContact O-N 2.85Å; E8-A11 VanDerWaalsContact O-CB 3.3Å; E8-A11 WeakPolarHBondContact O-CB 3.21Å; E8-A11 PolarHBondContact O-N 2.86Å; E8-Y35 HydrophobicContact CG-CE2 4.2Å; E8-Y35 WeakPolarHBondContact CG-OH 3.32Å; E8-Y35 PolarHBondContact OE1-OH 3Å
9	N	86.3	Confident	83.5	Confident	113 Å²	113	85.4 Å²	85.4	60%	0.604	46%	0.463	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.3	-107.9	174.1	-57.6	-48.5	0	0	112	S33 S34	N9-S33 CarbonylContact O-C 3.56Å; N9-S33 WeakPolarHBondContact O-CA 3.44Å; N9-S34 PolarHBondContact O-N 2.98Å
10	F	87.7	Confident	84.2	Confident	78 Å²	78	88.1 Å²	88.1	34%	0.342	47%	0.47	S	S	.	.	T	Hydrogen-bonded Turn	trans	-118.4	14.8	-178.7	-54	-64.9	0	0	113.1	E8 S12 C13 F41 A52	E8-F10 PolarHBondContact O-N 2.85Å; F10-S12 VanDerWaalsContact C-N 3.32Å; F10-S12 PolarHBondContact O-N 2.9Å; F10-C13 HydrophobicContact CB-CB 3.97Å; F10-C13 HydrophobicContact CD1-CB 4.36Å; F10-C13 VanDerWaalsContact O-CB 3.3Å; F10-C13 WeakPolarHBondContact O-CB 3.43Å; F10-C13 PolarHBondContact O-N 2.83Å; F10-C13 PolarHBondContact O-SG 2.84Å; F10-F41 HydrophobicContact CB-CZ 4.39Å; F10-F41 HydrophobicContact CD1-CE2 4.13Å; F10-F41 AromaticContact CD1-CZ 3.55Å; F10-F41 HydrophobicContact CD1-CZ 3.55Å; F10-F41 HydrophobicContact CE1-CE2 4.42Å; F10-F41 AromaticContact CE1-CZ 3.9Å; F10-F41 HydrophobicContact CE1-CZ 3.9Å; F10-F41 AromaticContact CG-CZ 3.9Å; F10-F41 HydrophobicContact CG-CZ 3.9Å; F10-A52 HydrophobicContact CE1-CB 4.2Å; F10-A52 HydrophobicContact CE2-CB 4.27Å; F10-A52 HydrophobicContact CZ-CB 3.69Å
11	A	87.6	Confident	84.8	Confident	74 Å²	74	91.1 Å²	91.1	61%	0.612	48%	0.476	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.4	-38.5	-172.1	0	0	0	0	113.3	E8	E8-A11 VanDerWaalsContact O-CB 3.3Å; E8-A11 WeakPolarHBondContact O-CB 3.21Å; E8-A11 PolarHBondContact O-N 2.86Å
12	S	88.3	Confident	86.4	Confident	9 Å²	9	86 Å²	86	6%	0.063	45%	0.45	C	S	.	.	T	Hydrogen-bonded Turn	trans	-117.3	32.4	174.9	52.8	0	0	0	112.1	F6 F10 Q14 G32 W36	F6-S12 VanDerWaalsContact CE1-CB 3.48Å; F6-S12 WeakPolarHBondContact O-CB 3.17Å; F6-S12 PolarHBondContact O-N 3.19Å; F6-S12 PolarHBondContact O-OG 3.22Å; F10-S12 VanDerWaalsContact C-N 3.32Å; F10-S12 PolarHBondContact O-N 2.9Å; S12-Q14 WeakPolarHBondContact O-CG 3.3Å; S12-Q14 PolarHBondContact O-N 2.81Å; S12-G32 CarbonylContact O-C 3.55Å; S12-G32 WeakPolarHBondContact O-CA 3.48Å; S12-W36 WeakPolarHBondContact OG-CH2 3.22Å
13	C	89.1	Confident	87.9	Confident	25 Å²	25	86 Å²	86	17%	0.169	46%	0.455	C	S	.	.			trans	-59.8	-23.6	-168.7	62.7	0	0	0	116	F10 A15 A30 G32 S33 F41	F10-C13 HydrophobicContact CB-CB 3.97Å; F10-C13 HydrophobicContact CD1-CB 4.36Å; F10-C13 VanDerWaalsContact O-CB 3.3Å; F10-C13 WeakPolarHBondContact O-CB 3.43Å; F10-C13 PolarHBondContact O-N 2.83Å; F10-C13 PolarHBondContact O-SG 2.84Å; C13-A15 PolarHBondContact O-N 2.83Å; C13-A30 HydrophobicContact CB-CB 4.15Å; C13-A30 CarbonylContact O-C 3Å; C13-A30 WeakPolarHBondContact O-CA 3.23Å; C13-A30 WeakPolarHBondContact O-CB 3.44Å; C13-G32 PolarHBondContact O-N 2.94Å; C13-G32 VanDerWaalsContact O-N 3.12Å; C13-S33 VanDerWaalsContact CB-OG 3.23Å; C13-S33 WeakPolarHBondContact CB-OG 3.49Å; C13-F41 HydrophobicContact CB-CE2 4.49Å
14	Q	92.5	Very high	89.2	Confident	100 Å²	100	85 Å²	85	47%	0.467	45%	0.446	S	S	.	.			trans	52.7	40.2	-179.3	-63.8	166.2	9.3	0	112.2	S12 G16 P31	S12-Q14 WeakPolarHBondContact O-CG 3.3Å; S12-Q14 PolarHBondContact O-N 2.81Å; Q14-G16 PolarHBondContact O-N 2.77Å; Q14-P31 HydrophobicContact CB-CG 4.46Å
15	A	94.4	Very high	90.5	Very high	49 Å²	49	83.5 Å²	83.5	41%	0.405	44%	0.442	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.7	136	178.7	0	0	0	0	111.1	C13 G29 A30 F41	C13-A15 PolarHBondContact O-N 2.83Å; A15-G29 WeakPolarHBondContact CA-O 3.48Å; A15-A30 HydrophobicContact CB-CB 3.91Å; A15-F41 HydrophobicContact CB-CD2 4.16Å; A15-F41 HydrophobicContact CB-CE2 4.26Å
16	G	93.9	Very high	91.4	Very high	39 Å²	39	78.4 Å²	78.4	40%	0.402	42%	0.421	S	S	.	.	T	Hydrogen-bonded Turn	trans	98.5	2.4	177	0	0	0	0	115	Q14 S18 G29	Q14-G16 PolarHBondContact O-N 2.77Å; G16-S18 PolarHBondContact O-N 2.83Å; G16-G29 PolarHBondContact N-O 3.09Å
17	I	94.3	Very high	92.2	Very high	122 Å²	122	75.8 Å²	75.8	63%	0.626	41%	0.413	S	S	*	.	S	Bend	trans	-57.4	-30.6	170.2	-164.2	170.9	0	0	112.2	P31	I17-P31 HydrophobicContact CD1-CG 4.29Å; I17-P31 VanDerWaalsContact CG2-CD 3.49Å; I17-P31 HydrophobicContact CG2-CG 3.85Å
18	S	94.4	Very high	93.2	Very high	67 Å²	67	78.4 Å²	78.4	47%	0.469	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	146.2	169.7	55.5	0	0	0	108.6	G16 M28 G29	G16-S18 PolarHBondContact O-N 2.83Å; S18-M28 WeakPolarHBondContact O-CA 3.39Å; S18-G29 PolarHBondContact O-N 2.82Å
19	S	96.1	Very high	93.7	Very high	93 Å²	93	75 Å²	75	65%	0.65	41%	0.412	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-145.5	151.3	178.6	62.1	0	0	0	111.7	V27	S19-V27 CarbonylContact C-O 3.58Å; S19-V27 WeakPolarHBondContact CA-O 3.5Å
20	F	97.3	Very high	94.1	Very high	139 Å²	139	69.7 Å²	69.7	61%	0.61	38%	0.384	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-137.4	129.1	172.1	-172.5	-108.5	0	0	109.6	T22 V27	F20-T22 HydrophobicContact CD1-CG2 3.69Å; F20-T22 HydrophobicContact CE1-CG2 3.51Å; F20-V27 HydrophobicContact CB-CB 4.37Å; F20-V27 PolarHBondContact N-O 3.46Å; F20-V27 PolarHBondContact O-N 3.28Å
21	Y	96.9	Very high	94.3	Very high	151 Å²	151	68.3 Å²	68.3	59%	0.592	38%	0.383	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.8	125.6	-176.7	-157.2	-76.1	0	0	109.7	I26 I45	Y21-I26 HydrophobicContact CD2-CD1 4.03Å; Y21-I26 HydrophobicContact CD2-CG1 3.74Å; Y21-I26 HydrophobicContact CE2-CD1 3.55Å; Y21-I26 HydrophobicContact CE2-CG1 3.57Å; Y21-I45 HydrophobicContact CE1-CD1 4.01Å; Y21-I45 HydrophobicContact CE2-CD1 4.28Å; Y21-I45 WeakPolarHBondContact OH-CD1 3.4Å
22	T	95	Very high	94.4	Very high	49 Å²	49	64.9 Å²	64.9	30%	0.301	35%	0.354	S	S	.	.			trans	-117.1	176.2	171.7	68.7	0	0	0	109.4	F20 D24 L25	F20-T22 HydrophobicContact CD1-CG2 3.69Å; F20-T22 HydrophobicContact CE1-CG2 3.51Å; T22-D24 VanDerWaalsContact C-N 3.28Å; T22-D24 PolarHBondContact O-N 3.12Å; T22-L25 PolarHBondContact N-O 3.04Å; T22-L25 WeakPolarHBondContact OG1-CA 3.42Å; T22-L25 VanDerWaalsContact OG1-CB 3.26Å; T22-L25 WeakPolarHBondContact OG1-CB 3.42Å; T22-L25 PolarHBondContact OG1-N 3.23Å; T22-L25 VanDerWaalsContact OG1-N 3.1Å; T22-L25 PolarHBondContact OG1-O 2.95Å
23	K	93.9	Very high	94.4	Very high	186 Å²	186	64.4 Å²	64.4	81%	0.809	35%	0.351	S	S	*	.	S	Bend	trans	-51.2	-45.2	-177.3	-170.2	178.4	178.2	-178.3	113.5
24	D	95.8	Very high	94.4	Very high	76 Å²	76	63.6 Å²	63.6	41%	0.406	35%	0.346	S	S	.	.	S	Bend	trans	-123.1	-2.9	-173.4	-57.7	-46.3	0	0	113.5	T22 N44 I45	T22-D24 VanDerWaalsContact C-N 3.28Å; T22-D24 PolarHBondContact O-N 3.12Å; D24-N44 WeakPolarHBondContact O-CA 3.3Å; D24-I45 PolarHBondContact O-N 2.8Å
25	L	97	Very high	94.1	Very high	62 Å²	62	59.8 Å²	59.8	33%	0.325	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	139.9	-175.5	-47.5	169	0	0	112	T22 V42 Y43 N44	T22-L25 PolarHBondContact N-O 3.04Å; T22-L25 WeakPolarHBondContact OG1-CA 3.42Å; T22-L25 VanDerWaalsContact OG1-CB 3.26Å; T22-L25 WeakPolarHBondContact OG1-CB 3.42Å; T22-L25 PolarHBondContact OG1-N 3.23Å; T22-L25 VanDerWaalsContact OG1-N 3.1Å; T22-L25 PolarHBondContact OG1-O 2.95Å; L25-V42 HydrophobicContact CB-CG1 4.13Å; L25-V42 HydrophobicContact CD1-CG1 4.19Å; L25-V42 HydrophobicContact CD2-CG1 4.01Å; L25-V42 HydrophobicContact CG-CG1 4.35Å; L25-Y43 CarbonylContact C-O 3.48Å; L25-Y43 VanDerWaalsContact CA-O 3.23Å; L25-Y43 WeakPolarHBondContact CA-O 3.37Å; L25-N44 HydrophobicContact CD2-CB 3.81Å
26	I	97.4	Very high	93.7	Very high	41 Å²	41	60.4 Å²	60.4	21%	0.21	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.5	120.7	164.4	-51.3	-179.2	0	0	107.6	Y21 M28 V42 Y43 I45	Y21-I26 HydrophobicContact CD2-CD1 4.03Å; Y21-I26 HydrophobicContact CD2-CG1 3.74Å; Y21-I26 HydrophobicContact CE2-CD1 3.55Å; Y21-I26 HydrophobicContact CE2-CG1 3.57Å; I26-M28 HydrophobicContact CG2-CG 4.15Å; I26-V42 CarbonylContact O-C 3.51Å; I26-V42 WeakPolarHBondContact O-CA 3.38Å; I26-Y43 HydrophobicContact CB-CD1 4.27Å; I26-Y43 HydrophobicContact CD1-CD1 3.82Å; I26-Y43 HydrophobicContact CD1-CE1 4.29Å; I26-Y43 HydrophobicContact CG1-CD1 4.01Å; I26-Y43 PolarHBondContact N-O 3.31Å; I26-Y43 PolarHBondContact O-N 3.31Å; I26-I45 HydrophobicContact CD1-CG1 4.41Å; I26-I45 HydrophobicContact CG1-CD1 4.06Å; I26-I45 HydrophobicContact CG1-CG1 4.14Å
27	V	96.9	Very high	93.5	Very high	39 Å²	39	60 Å²	60	24%	0.236	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	132.9	173.8	-174.1	0	0	0	108.4	S19 F20 L40 F41 V42	S19-V27 CarbonylContact C-O 3.58Å; S19-V27 WeakPolarHBondContact CA-O 3.5Å; F20-V27 HydrophobicContact CB-CB 4.37Å; F20-V27 PolarHBondContact N-O 3.46Å; F20-V27 PolarHBondContact O-N 3.28Å; V27-L40 HydrophobicContact CG1-CD2 3.98Å; V27-F41 CarbonylContact C-O 3.55Å; V27-F41 VanDerWaalsContact CA-O 3.3Å; V27-F41 WeakPolarHBondContact CA-O 3.16Å; V27-V42 HydrophobicContact CG2-CG2 4.45Å
28	M	97.6	Very high	93.2	Very high	56 Å²	56	55 Å²	55	28%	0.276	29%	0.288	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	128.6	178.8	-66.2	174.4	-75.8	0	110.2	S18 I26 F41	S18-M28 WeakPolarHBondContact O-CA 3.39Å; I26-M28 HydrophobicContact CG2-CG 4.15Å; M28-F41 HydrophobicContact CB-CB 4.26Å; M28-F41 HydrophobicContact CE-CB 4.19Å; M28-F41 PolarHBondContact N-O 2.93Å; M28-F41 PolarHBondContact O-N 2.86Å
29	G	95.4	Very high	93.1	Very high	8 Å²	8	52.5 Å²	52.5	8%	0.082	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.7	140.9	169.7	0	0	0	0	111	A15 G16 S18	A15-G29 WeakPolarHBondContact CA-O 3.48Å; G16-G29 PolarHBondContact N-O 3.09Å; S18-G29 PolarHBondContact O-N 2.82Å
30	A	94.9	Very high	93.1	Very high	1 Å²	1	52 Å²	52	1%	0.008	26%	0.259	C	S	.	.			trans	-138.5	76.7	-178.8	0	0	0	0	111.3	C13 A15 G32 S33 G38 S39 F41	C13-A30 HydrophobicContact CB-CB 4.15Å; C13-A30 CarbonylContact O-C 3Å; C13-A30 WeakPolarHBondContact O-CA 3.23Å; C13-A30 WeakPolarHBondContact O-CB 3.44Å; A15-A30 HydrophobicContact CB-CB 3.91Å; A30-G32 PolarHBondContact O-N 3.05Å; A30-S33 WeakPolarHBondContact CB-OG 3.29Å; A30-S33 WeakPolarHBondContact O-CB 3.32Å; A30-S33 PolarHBondContact O-N 3.49Å; A30-S33 PolarHBondContact O-OG 3.45Å; A30-G38 WeakPolarHBondContact O-CA 3.47Å; A30-S39 PolarHBondContact N-O 2.63Å; A30-S39 PolarHBondContact O-N 3.39Å; A30-F41 HydrophobicContact CB-CD2 3.52Å; A30-F41 HydrophobicContact CB-CE2 3.34Å
31	P	91.6	Very high	93	Very high	49 Å²	49	46.6 Å²	46.6	32%	0.318	24%	0.236	S	C	.	.	T	Hydrogen-bonded Turn	trans	-66.5	-32.7	-169.5	27.7	-36.6	0	0	113.6	Q14 I17 S33 W36 G38	Q14-P31 HydrophobicContact CB-CG 4.46Å; I17-P31 HydrophobicContact CD1-CG 4.29Å; I17-P31 VanDerWaalsContact CG2-CD 3.49Å; I17-P31 HydrophobicContact CG2-CG 3.85Å; P31-S33 PolarHBondContact O-N 3.32Å; P31-S33 VanDerWaalsContact O-N 3.11Å; P31-W36 CarbonylContact O-C 3.48Å; P31-W36 VanDerWaalsContact O-CA 3.27Å; P31-W36 WeakPolarHBondContact O-CA 3.41Å; P31-G38 WeakPolarHBondContact O-CA 3.41Å; P31-G38 PolarHBondContact O-N 2.83Å
32	G	89.1	Confident	93	Very high	1 Å²	1	41.8 Å²	41.8	1%	0.01	22%	0.222	C	C	.	.	T	Hydrogen-bonded Turn	trans	-75.6	4.4	-178.8	0	0	0	0	114.5	S12 C13 A30	S12-G32 CarbonylContact O-C 3.55Å; S12-G32 WeakPolarHBondContact O-CA 3.48Å; C13-G32 PolarHBondContact O-N 2.94Å; C13-G32 VanDerWaalsContact O-N 3.12Å; A30-G32 PolarHBondContact O-N 3.05Å
33	S	89.6	Confident	93.1	Very high	0 Å²	0	42.5 Å²	42.5	0%	0	22%	0.22	C	C	.	.	H	α-helix	trans	-68.9	139.4	179.4	-52.5	0	0	0	110.8	N9 C13 A30 P31 W36 T37 G38 S39	N9-S33 CarbonylContact O-C 3.56Å; N9-S33 WeakPolarHBondContact O-CA 3.44Å; C13-S33 VanDerWaalsContact CB-OG 3.23Å; C13-S33 WeakPolarHBondContact CB-OG 3.49Å; A30-S33 WeakPolarHBondContact CB-OG 3.29Å; A30-S33 WeakPolarHBondContact O-CB 3.32Å; A30-S33 PolarHBondContact O-N 3.49Å; A30-S33 PolarHBondContact O-OG 3.45Å; P31-S33 PolarHBondContact O-N 3.32Å; P31-S33 VanDerWaalsContact O-N 3.11Å; S33-W36 PolarHBondContact O-N 3.12Å; S33-T37 PolarHBondContact O-N 3.34Å; S33-G38 PolarHBondContact O-N 3.2Å; S33-S39 WeakPolarHBondContact OG-CB 3.37Å
34	S	88	Confident	93.3	Very high	8 Å²	8	35.8 Å²	35.8	6%	0.056	19%	0.193	C	C	.	.	H	α-helix	trans	47.1	66.9	175.2	-68.6	0	0	0	112.9	G7 N9 W36 T37	G7-S34 WeakPolarHBondContact O-CA 3.46Å; N9-S34 PolarHBondContact O-N 2.98Å; S34-W36 VanDerWaalsContact C-N 3.34Å; S34-W36 PolarHBondContact O-N 3.22Å; S34-T37 VanDerWaalsContact O-CB 3.22Å; S34-T37 WeakPolarHBondContact O-CB 3.41Å; S34-T37 PolarHBondContact O-N 3.41Å; S34-T37 VanDerWaalsContact O-N 3.12Å; S34-T37 PolarHBondContact O-OG1 3.07Å
35	Y	86.3	Confident	93.3	Very high	20 Å²	20	34.9 Å²	34.9	8%	0.078	19%	0.187	C	C	.	.	H	α-helix	trans	55.1	47.2	-179.5	-55.2	-78.4	0	0	113.1	K4 G7 E8 T37 F62 S64 Y65	K4-Y35 VanDerWaalsContact O-CE1 3.29Å; K4-Y35 WeakPolarHBondContact O-CE1 3.27Å; K4-Y35 PolarHBondContact O-OH 3.2Å; G7-Y35 PolarHBondContact O-N 3.25Å; E8-Y35 HydrophobicContact CG-CE2 4.2Å; E8-Y35 WeakPolarHBondContact CG-OH 3.32Å; E8-Y35 PolarHBondContact OE1-OH 3Å; Y35-T37 PolarHBondContact O-N 2.78Å; Y35-F62 AromaticContact CD1-CD1 3.8Å; Y35-F62 HydrophobicContact CD1-CD1 3.8Å; Y35-F62 HydrophobicContact CD1-CE1 4.19Å; Y35-F62 HydrophobicContact CD1-CG 4.5Å; Y35-F62 HydrophobicContact CD2-CD1 4.32Å; Y35-F62 HydrophobicContact CD2-CE1 4.23Å; Y35-F62 HydrophobicContact CD2-CZ 4.38Å; Y35-F62 AromaticContact CE1-CD1 3.4Å; Y35-F62 HydrophobicContact CE1-CD1 3.4Å; Y35-F62 AromaticContact CE1-CE1 3.42Å; Y35-F62 HydrophobicContact CE1-CE1 3.42Å; Y35-F62 VanDerWaalsContact CE1-CE1 3.42Å; Y35-F62 HydrophobicContact CE1-CG 4.45Å; Y35-F62 HydrophobicContact CE1-CZ 4.38Å; Y35-F62 AromaticContact CE2-CD1 3.97Å; Y35-F62 HydrophobicContact CE2-CD1 3.97Å; Y35-F62 AromaticContact CE2-CE1 3.47Å; Y35-F62 HydrophobicContact CE2-CE1 3.47Å; Y35-F62 VanDerWaalsContact CE2-CE1 3.47Å; Y35-F62 HydrophobicContact CE2-CE2 4.31Å; Y35-F62 AromaticContact CE2-CZ 3.6Å; Y35-F62 HydrophobicContact CE2-CZ 3.6Å; Y35-F62 HydrophobicContact CG-CD1 4.24Å; Y35-F62 AromaticContact CZ-CD1 3.5Å; Y35-F62 AromaticContact CZ-CE1 2.99Å; Y35-F62 AromaticContact CZ-CZ 3.61Å; Y35-F62 WeakPolarHBondContact OH-CE1 3.48Å; Y35-S64 PolarHBondContact O-OG 3.43Å; Y35-S64 VanDerWaalsContact O-OG 3.14Å; Y35-Y65 WeakPolarHBondContact CD1-OH 2.88Å
36	W	87.4	Confident	93.2	Very high	61 Å²	61	37 Å²	37	23%	0.231	20%	0.203	C	C	.	.	H	α-helix	trans	63.2	18.5	-179.9	-67.5	-111.6	0	0	114.2	F6 S12 P31 S33 S34 G38 Y65	F6-W36 AromaticContact CD1-CH2 3.75Å; F6-W36 HydrophobicContact CD1-CH2 3.75Å; F6-W36 AromaticContact CE1-CH2 3.66Å; F6-W36 HydrophobicContact CE1-CH2 3.66Å; F6-W36 HydrophobicContact CE1-CZ2 4.11Å; S12-W36 WeakPolarHBondContact OG-CH2 3.22Å; P31-W36 CarbonylContact O-C 3.48Å; P31-W36 VanDerWaalsContact O-CA 3.27Å; P31-W36 WeakPolarHBondContact O-CA 3.41Å; S33-W36 PolarHBondContact O-N 3.12Å; S34-W36 VanDerWaalsContact C-N 3.34Å; S34-W36 PolarHBondContact O-N 3.22Å; W36-G38 PolarHBondContact O-N 3.11Å; W36-Y65 AromaticContact CD2-CD1 3.89Å; W36-Y65 HydrophobicContact CD2-CD1 3.89Å; W36-Y65 HydrophobicContact CD2-CE1 4.18Å; W36-Y65 AromaticContact CE3-CD1 3.46Å; W36-Y65 HydrophobicContact CE3-CD1 3.46Å; W36-Y65 VanDerWaalsContact CE3-CD1 3.46Å; W36-Y65 AromaticContact CE3-CE1 3.31Å; W36-Y65 HydrophobicContact CE3-CE1 3.31Å; W36-Y65 HydrophobicContact CE3-CG 4.26Å; W36-Y65 AromaticContact CE3-CZ 3.91Å; W36-Y65 AromaticContact CH2-CD1 3.69Å; W36-Y65 HydrophobicContact CH2-CD1 3.69Å; W36-Y65 AromaticContact CH2-CE1 3.29Å; W36-Y65 HydrophobicContact CH2-CE1 3.29Å; W36-Y65 AromaticContact CZ2-CD1 3.92Å; W36-Y65 HydrophobicContact CZ2-CD1 3.92Å; W36-Y65 HydrophobicContact CZ2-CE1 4.02Å; W36-Y65 AromaticContact CZ3-CD1 3.46Å; W36-Y65 HydrophobicContact CZ3-CD1 3.46Å; W36-Y65 VanDerWaalsContact CZ3-CD1 3.46Å; W36-Y65 AromaticContact CZ3-CE1 2.88Å; W36-Y65 HydrophobicContact CZ3-CE1 2.88Å; W36-Y65 AromaticContact CZ3-CZ 3.59Å
37	T	87.8	Confident	93.2	Very high	31 Å²	31	38.8 Å²	38.8	19%	0.19	22%	0.216	C	C	.	.	T	Hydrogen-bonded Turn	trans	-62.8	-33.9	167.6	-60.5	0	0	0	111	S33 S34 Y35 V60	S33-T37 PolarHBondContact O-N 3.34Å; S34-T37 VanDerWaalsContact O-CB 3.22Å; S34-T37 WeakPolarHBondContact O-CB 3.41Å; S34-T37 PolarHBondContact O-N 3.41Å; S34-T37 VanDerWaalsContact O-N 3.12Å; S34-T37 PolarHBondContact O-OG1 3.07Å; Y35-T37 PolarHBondContact O-N 2.78Å; T37-V60 HydrophobicContact CG2-CG2 4.12Å; T37-V60 WeakPolarHBondContact OG1-CB 3.46Å; T37-V60 WeakPolarHBondContact OG1-CG2 3.29Å; T37-V60 PolarHBondContact OG1-N 3.45Å
38	G	88.8	Confident	93.1	Very high	18 Å²	18	42.6 Å²	42.6	19%	0.186	24%	0.235	C	C	.	.			trans	86.3	161.6	-177.3	0	0	0	0	113.6	A30 P31 S33 W36	A30-G38 WeakPolarHBondContact O-CA 3.47Å; P31-G38 WeakPolarHBondContact O-CA 3.41Å; P31-G38 PolarHBondContact O-N 2.83Å; S33-G38 PolarHBondContact O-N 3.2Å; W36-G38 PolarHBondContact O-N 3.11Å
39	S	92.9	Very high	93	Very high	13 Å²	13	46.7 Å²	46.7	9%	0.091	25%	0.251	C	S	.	.			trans	-157	161.6	-178.4	174.9	0	0	0	109.8	A30 S33 F53	A30-S39 PolarHBondContact N-O 2.63Å; A30-S39 PolarHBondContact O-N 3.39Å; S33-S39 WeakPolarHBondContact OG-CB 3.37Å; S39-F53 WeakPolarHBondContact CB-O 3.46Å; S39-F53 PolarHBondContact OG-O 2.77Å
40	L	95.1	Very high	93	Very high	82 Å²	82	54.8 Å²	54.8	43%	0.429	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.5	130.9	168.1	-73.7	163.1	0	0	109.6	V27 A52 F53	V27-L40 HydrophobicContact CG1-CD2 3.98Å; L40-A52 CarbonylContact O-C 3.59Å; L40-A52 WeakPolarHBondContact O-CA 3.47Å; L40-F53 HydrophobicContact CB-CB 4.18Å; L40-F53 PolarHBondContact O-N 3.17Å
41	F	96.1	Very high	92.9	Very high	27 Å²	27	62.6 Å²	62.6	12%	0.118	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	133.4	169.9	-70.7	-94.5	0	0	109.6	F10 C13 A15 V27 M28 A30 K51 A52	F10-F41 HydrophobicContact CB-CZ 4.39Å; F10-F41 HydrophobicContact CD1-CE2 4.13Å; F10-F41 AromaticContact CD1-CZ 3.55Å; F10-F41 HydrophobicContact CD1-CZ 3.55Å; F10-F41 HydrophobicContact CE1-CE2 4.42Å; F10-F41 AromaticContact CE1-CZ 3.9Å; F10-F41 HydrophobicContact CE1-CZ 3.9Å; F10-F41 AromaticContact CG-CZ 3.9Å; F10-F41 HydrophobicContact CG-CZ 3.9Å; C13-F41 HydrophobicContact CB-CE2 4.49Å; A15-F41 HydrophobicContact CB-CD2 4.16Å; A15-F41 HydrophobicContact CB-CE2 4.26Å; V27-F41 CarbonylContact C-O 3.55Å; V27-F41 VanDerWaalsContact CA-O 3.3Å; V27-F41 WeakPolarHBondContact CA-O 3.16Å; M28-F41 HydrophobicContact CB-CB 4.26Å; M28-F41 HydrophobicContact CE-CB 4.19Å; M28-F41 PolarHBondContact N-O 2.93Å; M28-F41 PolarHBondContact O-N 2.86Å; A30-F41 HydrophobicContact CB-CD2 3.52Å; A30-F41 HydrophobicContact CB-CE2 3.34Å; F41-K51 CarbonylContact C-O 3.49Å; F41-K51 WeakPolarHBondContact CA-O 3.38Å; F41-A52 HydrophobicContact CD1-CB 3.91Å; F41-A52 HydrophobicContact CE1-CB 3.68Å; F41-A52 HydrophobicContact CZ-CB 4.19Å
42	V	97	Very high	93	Very high	49 Å²	49	62.3 Å²	62.3	30%	0.297	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	115.3	174	-175.8	0	0	0	107.9	L25 I26 V27 Y50 K51	L25-V42 HydrophobicContact CB-CG1 4.13Å; L25-V42 HydrophobicContact CD1-CG1 4.19Å; L25-V42 HydrophobicContact CD2-CG1 4.01Å; L25-V42 HydrophobicContact CG-CG1 4.35Å; I26-V42 CarbonylContact O-C 3.51Å; I26-V42 WeakPolarHBondContact O-CA 3.38Å; V27-V42 HydrophobicContact CG2-CG2 4.45Å; V42-Y50 CarbonylContact O-C 3.5Å; V42-Y50 VanDerWaalsContact O-CA 3.3Å; V42-Y50 WeakPolarHBondContact O-CA 3.32Å; V42-K51 PolarHBondContact N-O 2.86Å; V42-K51 PolarHBondContact O-N 3.37Å
43	Y	97.1	Very high	93	Very high	65 Å²	65	68.3 Å²	68.3	26%	0.255	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102	119.3	175.1	171.1	-103.2	0	0	109.6	L25 I26 I45 N48 K49	L25-Y43 CarbonylContact C-O 3.48Å; L25-Y43 VanDerWaalsContact CA-O 3.23Å; L25-Y43 WeakPolarHBondContact CA-O 3.37Å; I26-Y43 HydrophobicContact CB-CD1 4.27Å; I26-Y43 HydrophobicContact CD1-CD1 3.82Å; I26-Y43 HydrophobicContact CD1-CE1 4.29Å; I26-Y43 HydrophobicContact CG1-CD1 4.01Å; I26-Y43 PolarHBondContact N-O 3.31Å; I26-Y43 PolarHBondContact O-N 3.31Å; Y43-I45 HydrophobicContact CD1-CG1 4.01Å; Y43-I45 HydrophobicContact CE1-CB 4.3Å; Y43-I45 HydrophobicContact CE1-CG1 3.81Å; Y43-N48 VanDerWaalsContact CE2-OD1 3.29Å; Y43-N48 WeakPolarHBondContact CE2-OD1 3.42Å; Y43-N48 PolarHBondContact OH-OD1 3.34Å; Y43-K49 WeakPolarHBondContact CA-O 3.07Å
44	N	96.7	Very high	92.8	Very high	45 Å²	45	71.1 Å²	71.1	24%	0.241	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.5	117.1	174.7	-178.8	-62.4	0	0	109.4	D24 L25 T46 T47 N48 K49	D24-N44 WeakPolarHBondContact O-CA 3.3Å; L25-N44 HydrophobicContact CD2-CB 3.81Å; N44-T46 PolarHBondContact OD1-N 3.01Å; N44-T47 WeakPolarHBondContact CB-OG1 3.23Å; N44-T47 PolarHBondContact OD1-N 2.84Å; N44-T47 PolarHBondContact OD1-OG1 3.21Å; N44-N48 VanDerWaalsContact O-CA 3.32Å; N44-N48 WeakPolarHBondContact O-CA 3.22Å; N44-N48 PolarHBondContact O-N 3.36Å; N44-K49 PolarHBondContact N-O 2.69Å; N44-K49 PolarHBondContact O-N 3.49Å
45	I	96.1	Very high	92.4	Very high	56 Å²	56	73 Å²	73	29%	0.287	37%	0.366	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.2	-41.3	-172.5	-59.7	161	0	0	110.7	Y21 D24 I26 Y43	Y21-I45 HydrophobicContact CE1-CD1 4.01Å; Y21-I45 HydrophobicContact CE2-CD1 4.28Å; Y21-I45 WeakPolarHBondContact OH-CD1 3.4Å; D24-I45 PolarHBondContact O-N 2.8Å; I26-I45 HydrophobicContact CD1-CG1 4.41Å; I26-I45 HydrophobicContact CG1-CD1 4.06Å; I26-I45 HydrophobicContact CG1-CG1 4.14Å; Y43-I45 HydrophobicContact CD1-CG1 4.01Å; Y43-I45 HydrophobicContact CE1-CB 4.3Å; Y43-I45 HydrophobicContact CE1-CG1 3.81Å
46	T	95.5	Very high	92.1	Very high	108 Å²	108	80.4 Å²	80.4	66%	0.663	40%	0.399	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.8	-41.6	-177.9	-42.9	0	0	0	112.3	N44	N44-T46 PolarHBondContact OD1-N 3.01Å
47	T	96.6	Very high	91.8	Very high	77 Å²	77	86 Å²	86	47%	0.472	43%	0.427	S	S	.	.	T	Hydrogen-bonded Turn	trans	-95.8	-5.5	-176.3	61.3	0	0	0	113.2	N44 K49	N44-T47 WeakPolarHBondContact CB-OG1 3.23Å; N44-T47 PolarHBondContact OD1-N 2.84Å; N44-T47 PolarHBondContact OD1-OG1 3.21Å; T47-K49 WeakPolarHBondContact O-CG 3.3Å; T47-K49 PolarHBondContact O-N 3.14Å
48	N	95.1	Very high	91.1	Very high	120 Å²	120	89.7 Å²	89.7	64%	0.642	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.6	42.3	-174.9	-166.9	19.9	0	0	112.5	Y43 N44	Y43-N48 VanDerWaalsContact CE2-OD1 3.29Å; Y43-N48 WeakPolarHBondContact CE2-OD1 3.42Å; Y43-N48 PolarHBondContact OH-OD1 3.34Å; N44-N48 VanDerWaalsContact O-CA 3.32Å; N44-N48 WeakPolarHBondContact O-CA 3.22Å; N44-N48 PolarHBondContact O-N 3.36Å
49	K	96.3	Very high	90.4	Very high	142 Å²	142	93.2 Å²	93.2	62%	0.617	46%	0.458	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.6	139.8	-176.6	-75.9	-179.6	-176.6	-176.8	111.1	Y43 N44 T47	Y43-K49 WeakPolarHBondContact CA-O 3.07Å; N44-K49 PolarHBondContact N-O 2.69Å; N44-K49 PolarHBondContact O-N 3.49Å; T47-K49 WeakPolarHBondContact O-CG 3.3Å; T47-K49 PolarHBondContact O-N 3.14Å
50	Y	94.3	Very high	89.3	Confident	178 Å²	178	95.6 Å²	95.6	70%	0.698	47%	0.471	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.5	149.6	171.4	61.5	-89.4	0	0	111.1	V42	V42-Y50 CarbonylContact O-C 3.5Å; V42-Y50 VanDerWaalsContact O-CA 3.3Å; V42-Y50 WeakPolarHBondContact O-CA 3.32Å
51	K	94.6	Very high	87.9	Confident	165 Å²	165	100.4 Å²	100.4	72%	0.717	49%	0.489	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-132.1	137	166	-71.3	-172.3	177.7	-177.2	108.9	F41 V42	F41-K51 CarbonylContact C-O 3.49Å; F41-K51 WeakPolarHBondContact CA-O 3.38Å; V42-K51 PolarHBondContact N-O 2.86Å; V42-K51 PolarHBondContact O-N 3.37Å
52	A	92.3	Very high	86.3	Confident	43 Å²	43	104.9 Å²	104.9	36%	0.355	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.2	133.5	172.5	0	0	0	0	109.4	F10 L40 F41	F10-A52 HydrophobicContact CE1-CB 4.2Å; F10-A52 HydrophobicContact CE2-CB 4.27Å; F10-A52 HydrophobicContact CZ-CB 3.69Å; L40-A52 CarbonylContact O-C 3.59Å; L40-A52 WeakPolarHBondContact O-CA 3.47Å; F41-A52 HydrophobicContact CD1-CB 3.91Å; F41-A52 HydrophobicContact CE1-CB 3.68Å; F41-A52 HydrophobicContact CZ-CB 4.19Å
53	F	90.3	Very high	84.5	Confident	127 Å²	127	105.1 Å²	105.1	56%	0.557	52%	0.521	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91	121.1	170.2	176.3	-96	0	0	109.3	S39 L40 D55	S39-F53 WeakPolarHBondContact CB-O 3.46Å; S39-F53 PolarHBondContact OG-O 2.77Å; L40-F53 HydrophobicContact CB-CB 4.18Å; L40-F53 PolarHBondContact O-N 3.17Å; F53-D55 HydrophobicContact CE1-CB 4.14Å
54	L	84	Confident	82.5	Confident	59 Å²	59	104.4 Å²	104.4	31%	0.309	53%	0.526	S	S	.	.			trans	-117.9	118.6	175.5	-169	76.1	0	0	108.9	K56	L54-K56 PolarHBondContact O-N 3.27Å
55	D	80.4	Confident	80.6	Confident	47 Å²	47	106.1 Å²	106.1	25%	0.251	53%	0.529	S	S	.	.			trans	-73.4	108.9	170.5	-171.8	-14.7	0	0	109	F53 Q57 N58 Q59	F53-D55 HydrophobicContact CE1-CB 4.14Å; D55-Q57 WeakPolarHBondContact OD1-CA 3.33Å; D55-Q57 PolarHBondContact OD1-N 2.99Å; D55-N58 PolarHBondContact OD1-N 2.99Å; D55-N58 VanDerWaalsContact OD1-N 3.09Å; D55-N58 WeakPolarHBondContact OD2-CB 3.3Å; D55-N58 PolarHBondContact OD2-ND2 3.37Å; D55-Q59 PolarHBondContact O-NE2 3.2Å
56	K	79.6	Confident	78.5	Confident	176 Å²	176	114.7 Å²	114.7	77%	0.765	57%	0.574	S	S	*	*	S	Bend	trans	-84.3	-15.2	178.5	-66	-174.9	179.5	-178.5	113	L54	L54-K56 PolarHBondContact O-N 3.27Å
57	Q	80.6	Confident	77.6	Confident	178 Å²	178	115 Å²	115	83%	0.832	57%	0.57	S	S	*	*	S	Bend	trans	-90.4	-34.4	-175.3	-65	-179.8	-15.1	0	111.3	D55	D55-Q57 WeakPolarHBondContact OD1-CA 3.33Å; D55-Q57 PolarHBondContact OD1-N 2.99Å
58	N	74.7	Confident	76.6	Confident	109 Å²	109	117 Å²	117	58%	0.583	58%	0.575	S	S	*	*	S	Bend	trans	-114.4	45	-177.4	-55	-68.8	0	0	112.9	D55 V60	D55-N58 PolarHBondContact OD1-N 2.99Å; D55-N58 VanDerWaalsContact OD1-N 3.09Å; D55-N58 WeakPolarHBondContact OD2-CB 3.3Å; D55-N58 PolarHBondContact OD2-ND2 3.37Å; N58-V60 PolarHBondContact O-N 3.08Å
59	Q	72.4	Confident	75.6	Confident	92 Å²	92	116.8 Å²	116.8	43%	0.43	57%	0.571	S	S	.	*	P	Polyproline II helix	trans	-65.1	124.7	177.4	-66.2	-95.4	-58	0	110.4	D55	D55-Q59 PolarHBondContact O-NE2 3.2Å
60	V	69.8	Low	74.4	Confident	63 Å²	63	115.4 Å²	115.4	38%	0.382	57%	0.569	S	S	.	*	P	Polyproline II helix	trans	-76.5	138.6	176.4	-163.5	0	0	0	109.2	T37 N58 S64	T37-V60 HydrophobicContact CG2-CG2 4.12Å; T37-V60 WeakPolarHBondContact OG1-CB 3.46Å; T37-V60 WeakPolarHBondContact OG1-CG2 3.29Å; T37-V60 PolarHBondContact OG1-N 3.45Å; N58-V60 PolarHBondContact O-N 3.08Å; V60-S64 VanDerWaalsContact CG1-CB 3.43Å; V60-S64 WeakPolarHBondContact CG1-OG 2.93Å
61	K	67.1	Low	73.2	Confident	182 Å²	182	111.4 Å²	111.4	79%	0.791	56%	0.561	S	S	*	*	P	Polyproline II helix	trans	-79.3	151.3	177	-64.3	-177.5	-177.4	177.4	109.9	G63 S64	K61-G63 PolarHBondContact O-N 3.21Å; K61-S64 PolarHBondContact O-OG 3.25Å
62	F	62.9	Low	71.7	Confident	121 Å²	121	107.9 Å²	107.9	53%	0.531	55%	0.55	S	S	.	*	T	Hydrogen-bonded Turn	trans	-42.8	129.3	175.6	-63	-103	0	0	112.7	K4 Y35	K4-F62 HydrophobicContact CD-CE1 4.17Å; K4-F62 VanDerWaalsContact CE-CE1 3.44Å; K4-F62 HydrophobicContact CG-CD1 4.17Å; K4-F62 HydrophobicContact CG-CE1 3.62Å; Y35-F62 AromaticContact CD1-CD1 3.8Å; Y35-F62 HydrophobicContact CD1-CD1 3.8Å; Y35-F62 HydrophobicContact CD1-CE1 4.19Å; Y35-F62 HydrophobicContact CD1-CG 4.5Å; Y35-F62 HydrophobicContact CD2-CD1 4.32Å; Y35-F62 HydrophobicContact CD2-CE1 4.23Å; Y35-F62 HydrophobicContact CD2-CZ 4.38Å; Y35-F62 AromaticContact CE1-CD1 3.4Å; Y35-F62 HydrophobicContact CE1-CD1 3.4Å; Y35-F62 AromaticContact CE1-CE1 3.42Å; Y35-F62 HydrophobicContact CE1-CE1 3.42Å; Y35-F62 VanDerWaalsContact CE1-CE1 3.42Å; Y35-F62 HydrophobicContact CE1-CG 4.45Å; Y35-F62 HydrophobicContact CE1-CZ 4.38Å; Y35-F62 AromaticContact CE2-CD1 3.97Å; Y35-F62 HydrophobicContact CE2-CD1 3.97Å; Y35-F62 AromaticContact CE2-CE1 3.47Å; Y35-F62 HydrophobicContact CE2-CE1 3.47Å; Y35-F62 VanDerWaalsContact CE2-CE1 3.47Å; Y35-F62 HydrophobicContact CE2-CE2 4.31Å; Y35-F62 AromaticContact CE2-CZ 3.6Å; Y35-F62 HydrophobicContact CE2-CZ 3.6Å; Y35-F62 HydrophobicContact CG-CD1 4.24Å; Y35-F62 AromaticContact CZ-CD1 3.5Å; Y35-F62 AromaticContact CZ-CE1 2.99Å; Y35-F62 AromaticContact CZ-CZ 3.61Å; Y35-F62 WeakPolarHBondContact OH-CE1 3.48Å
63	G	57.7	Low	70.3	Confident	55 Å²	55	112.5 Å²	112.5	57%	0.567	56%	0.564	S	S	*	*	T	Hydrogen-bonded Turn	trans	114.6	-3.3	173.2	0	0	0	0	115.7	K61 Y65	K61-G63 PolarHBondContact O-N 3.21Å; G63-Y65 PolarHBondContact O-N 3.25Å
64	S	55.9	Low	68.7	Low	50 Å²	50	111.4 Å²	111.4	35%	0.35	57%	0.565	S	S	.	*			trans	-78.5	31.1	174.5	50.9	0	0	0	114.1	Y35 V60 K61 L66	Y35-S64 PolarHBondContact O-OG 3.43Å; Y35-S64 VanDerWaalsContact O-OG 3.14Å; V60-S64 VanDerWaalsContact CG1-CB 3.43Å; V60-S64 WeakPolarHBondContact CG1-OG 2.93Å; K61-S64 PolarHBondContact O-OG 3.25Å; S64-L66 PolarHBondContact O-N 2.95Å
65	Y	56.2	Low	67.4	Low	81 Å²	81	115.8 Å²	115.8	32%	0.318	59%	0.586	S	S	.	*			trans	-71.2	129.5	172.6	-59.3	-101.9	0	0	107.1	Y35 W36 G63	Y35-Y65 WeakPolarHBondContact CD1-OH 2.88Å; W36-Y65 AromaticContact CD2-CD1 3.89Å; W36-Y65 HydrophobicContact CD2-CD1 3.89Å; W36-Y65 HydrophobicContact CD2-CE1 4.18Å; W36-Y65 AromaticContact CE3-CD1 3.46Å; W36-Y65 HydrophobicContact CE3-CD1 3.46Å; W36-Y65 VanDerWaalsContact CE3-CD1 3.46Å; W36-Y65 AromaticContact CE3-CE1 3.31Å; W36-Y65 HydrophobicContact CE3-CE1 3.31Å; W36-Y65 HydrophobicContact CE3-CG 4.26Å; W36-Y65 AromaticContact CE3-CZ 3.91Å; W36-Y65 AromaticContact CH2-CD1 3.69Å; W36-Y65 HydrophobicContact CH2-CD1 3.69Å; W36-Y65 AromaticContact CH2-CE1 3.29Å; W36-Y65 HydrophobicContact CH2-CE1 3.29Å; W36-Y65 AromaticContact CZ2-CD1 3.92Å; W36-Y65 HydrophobicContact CZ2-CD1 3.92Å; W36-Y65 HydrophobicContact CZ2-CE1 4.02Å; W36-Y65 AromaticContact CZ3-CD1 3.46Å; W36-Y65 HydrophobicContact CZ3-CD1 3.46Å; W36-Y65 VanDerWaalsContact CZ3-CD1 3.46Å; W36-Y65 AromaticContact CZ3-CE1 2.88Å; W36-Y65 HydrophobicContact CZ3-CE1 2.88Å; W36-Y65 AromaticContact CZ3-CZ 3.59Å; G63-Y65 PolarHBondContact O-N 3.25Å
66	L	52.1	Low	66.3	Low	235 Å²	235	122 Å²	122	100%	1.23	62%	0.616	S	S	*	*			trans	-52.9	0	168.5	-84	158.7	0	0	111.3	S64	S64-L66 PolarHBondContact O-N 2.95Å

Retrieved 66 of 66 residues in 94 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).