YM316_YEAST Loading...

Putative uncharacterized membrane protein YMR316C-B

AlphaFold DB , UniProt , Accession A0A023PXQ9, Species YEAST (Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Baker's yeast), Gene n/a, Length 102 aa.

						>YM316_YEAST|A0A023PXQ9
METNDSDDRIEAIVSEESDELEVNSGTTEETNVLELLTIISGLVVTLVLVVLVVLVVVGVVVLVVLLVVVVLLCDVVVAVVDFEPDEPILIRRYPFLWIPFL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.9	Very low	62.4	Low	237 Å²	237	135.7 Å²	135.7	100%	1.167	69%	0.69	S	S	*	*				0	81.7	0	-170.9	154.3	176.1	0	0	105.3
2	E	58.7	Low	62.4	Low	190 Å²	190	129.5 Å²	129.5	89%	0.888	67%	0.674	S	S	*	*			trans	-136.1	69.5	-172.9	-77.4	179.4	110	0	0	107.7
3	T	61.5	Low	62.3	Low	115 Å²	115	126.9 Å²	126.9	71%	0.706	66%	0.66	S	S	*	*			trans	-126.9	3	174.8	55.9	0	0	0	0	113
4	N	63.6	Low	62.2	Low	121 Å²	121	123.9 Å²	123.9	65%	0.647	65%	0.65	S	S	*	*	S	Bend	trans	-89.8	-18.3	-171.6	-150.3	62.2	0	0	0	114.8
5	D	67.8	Low	61.9	Low	135 Å²	135	119.9 Å²	119.9	72%	0.722	64%	0.637	S	S	*	*	H	α-helix	trans	-86.3	-17.2	-171.1	-145.1	30.7	0	0	0	113.1
6	S	66.7	Low	61.9	Low	80 Å²	80	121.3 Å²	121.3	56%	0.559	64%	0.638	S	S	*	*	H	α-helix	trans	-85.7	-35.3	-177.5	-61	0	0	0	0	113.2	R9 I10	S6-R9 PolarHBondContact O-N 3.41Å; S6-I10 PolarHBondContact O-N 3.19Å
7	D	68.4	Low	61.5	Low	110 Å²	110	121.8 Å²	121.8	59%	0.588	64%	0.636	S	S	*	*	H	α-helix	trans	-69.5	-42.3	-177.3	-76	-21.6	0	0	0	111.1	R9 I10 E11	D7-R9 VanDerWaalsContact C-N 3.26Å; D7-R9 PolarHBondContact O-N 3.43Å; D7-I10 PolarHBondContact O-N 3.31Å; D7-E11 PolarHBondContact O-N 3.47Å; D7-E11 VanDerWaalsContact O-N 3.14Å
8	D	67.4	Low	61.2	Low	91 Å²	91	118.4 Å²	118.4	49%	0.487	63%	0.625	S	S	.	*	H	α-helix	trans	-59.9	-35.1	177.6	-68.5	-15.1	0	0	0	112.2	A12	D8-A12 PolarHBondContact O-N 3.26Å
9	R	63.6	Low	61	Low	175 Å²	175	117.8 Å²	117.8	66%	0.66	62%	0.622	S	S	*	*	H	α-helix	trans	-69.9	-33.9	176.7	-76.1	-172.2	68.9	-120.3	-2.4	112.7	S6 D7 I13	S6-R9 PolarHBondContact O-N 3.41Å; D7-R9 VanDerWaalsContact C-N 3.26Å; D7-R9 PolarHBondContact O-N 3.43Å; R9-I13 WeakPolarHBondContact O-CD1 3.25Å; R9-I13 VanDerWaalsContact O-CG1 3.25Å; R9-I13 WeakPolarHBondContact O-CG1 3.37Å; R9-I13 PolarHBondContact O-N 3.06Å
10	I	61.5	Low	60.6	Low	104 Å²	104	118.9 Å²	118.9	53%	0.533	62%	0.623	S	S	.	*	H	α-helix	trans	-72.7	-41.4	179.5	-63.9	173.2	0	0	0	109.7	S6 D7 A12 I13 V14	S6-I10 PolarHBondContact O-N 3.19Å; D7-I10 PolarHBondContact O-N 3.31Å; I10-A12 VanDerWaalsContact C-N 3.33Å; I10-A12 PolarHBondContact O-N 3.14Å; I10-I13 PolarHBondContact O-N 3.45Å; I10-V14 WeakPolarHBondContact O-CG2 3.39Å; I10-V14 PolarHBondContact O-N 3.04Å; I10-V14 VanDerWaalsContact O-N 3.1Å
11	E	60.6	Low	60.3	Low	135 Å²	135	119 Å²	119	63%	0.631	62%	0.624	S	S	*	*	H	α-helix	trans	-63.5	-37.9	177.9	-169	170.5	-170.6	0	0	112.5	D7 V14 S15	D7-E11 PolarHBondContact O-N 3.47Å; D7-E11 VanDerWaalsContact O-N 3.14Å; E11-V14 PolarHBondContact O-N 3.18Å; E11-S15 PolarHBondContact O-N 3.26Å; E11-S15 VanDerWaalsContact O-N 3.07Å; E11-S15 PolarHBondContact O-OG 3.4Å
12	A	61.8	Low	60.6	Low	61 Å²	61	114.8 Å²	114.8	50%	0.504	60%	0.602	S	S	.	*	H	α-helix	trans	-63.9	-40.1	175	0	0	0	0	0	112.8	D8 I10 S15 E16	D8-A12 PolarHBondContact O-N 3.26Å; I10-A12 VanDerWaalsContact C-N 3.33Å; I10-A12 PolarHBondContact O-N 3.14Å; A12-S15 PolarHBondContact O-N 3.49Å; A12-E16 PolarHBondContact O-N 3.1Å
13	I	61.8	Low	60.4	Low	96 Å²	96	110.9 Å²	110.9	49%	0.492	59%	0.59	S	S	.	*	H	α-helix	trans	-67.7	-39.9	178.7	-65.5	164.3	0	0	0	110.7	R9 I10 E17	R9-I13 WeakPolarHBondContact O-CD1 3.25Å; R9-I13 VanDerWaalsContact O-CG1 3.25Å; R9-I13 WeakPolarHBondContact O-CG1 3.37Å; R9-I13 PolarHBondContact O-N 3.06Å; I10-I13 PolarHBondContact O-N 3.45Å; I13-E17 PolarHBondContact O-N 3.43Å; I13-E17 VanDerWaalsContact O-N 3.1Å
14	V	59.9	Low	60.1	Low	84 Å²	84	110.4 Å²	110.4	51%	0.509	58%	0.584	S	S	.	*	H	α-helix	trans	-68.4	-35.2	179.4	177.2	0	0	0	0	111.8	I10 E11 S18	I10-V14 WeakPolarHBondContact O-CG2 3.39Å; I10-V14 PolarHBondContact O-N 3.04Å; I10-V14 VanDerWaalsContact O-N 3.1Å; E11-V14 PolarHBondContact O-N 3.18Å; V14-S18 WeakPolarHBondContact O-CB 3.34Å; V14-S18 PolarHBondContact O-N 3.28Å; V14-S18 VanDerWaalsContact O-N 3.11Å; V14-S18 PolarHBondContact O-OG 3.1Å
15	S	58.5	Low	59.7	Low	65 Å²	65	107.6 Å²	107.6	46%	0.455	57%	0.573	S	S	.	*	H	α-helix	trans	-67.6	-45	176.2	-66.6	0	0	0	0	112.1	E11 A12 E17 S18 D19	E11-S15 PolarHBondContact O-N 3.26Å; E11-S15 VanDerWaalsContact O-N 3.07Å; E11-S15 PolarHBondContact O-OG 3.4Å; A12-S15 PolarHBondContact O-N 3.49Å; S15-E17 PolarHBondContact O-N 3.47Å; S15-S18 PolarHBondContact O-N 3.07Å; S15-D19 PolarHBondContact O-N 3.32Å
16	E	61.7	Low	59.2	Low	141 Å²	141	102.8 Å²	102.8	66%	0.659	56%	0.556	S	S	*	*	H	α-helix	trans	-66.9	-39	-179.4	-165	133.8	78.8	0	0	111.8	A12 S18 D19 E20	A12-E16 PolarHBondContact O-N 3.1Å; E16-S18 VanDerWaalsContact C-N 3.33Å; E16-S18 PolarHBondContact O-N 3.25Å; E16-D19 PolarHBondContact O-N 3.03Å; E16-E20 WeakPolarHBondContact O-CG 3.41Å; E16-E20 PolarHBondContact O-N 3.11Å; E16-E20 VanDerWaalsContact O-N 3.14Å
17	E	55.8	Low	58.9	Low	130 Å²	130	102.5 Å²	102.5	61%	0.607	55%	0.551	S	S	*	*	H	α-helix	trans	-67.8	-33	175.9	-153.5	-174.5	118.8	0	0	112.1	I13 S15 L21	I13-E17 PolarHBondContact O-N 3.43Å; I13-E17 VanDerWaalsContact O-N 3.1Å; S15-E17 PolarHBondContact O-N 3.47Å; E17-L21 WeakPolarHBondContact O-CB 3.38Å; E17-L21 PolarHBondContact O-N 3.47Å
18	S	55.2	Low	58.5	Low	62 Å²	62	100.4 Å²	100.4	43%	0.434	54%	0.542	S	S	.	.	H	α-helix	trans	-69.6	-41.6	177.3	-57.8	0	0	0	0	112.1	V14 S15 E16 L21 E22	V14-S18 WeakPolarHBondContact O-CB 3.34Å; V14-S18 PolarHBondContact O-N 3.28Å; V14-S18 VanDerWaalsContact O-N 3.11Å; V14-S18 PolarHBondContact O-OG 3.1Å; S15-S18 PolarHBondContact O-N 3.07Å; E16-S18 VanDerWaalsContact C-N 3.33Å; E16-S18 PolarHBondContact O-N 3.25Å; S18-L21 PolarHBondContact O-N 3.14Å; S18-E22 PolarHBondContact O-N 3.44Å
19	D	56.9	Low	58.2	Low	107 Å²	107	102.3 Å²	102.3	57%	0.572	55%	0.548	S	S	*	.	H	α-helix	trans	-66.3	-38.7	177.9	-75.6	-21	0	0	0	111.4	S15 E16 V23	S15-D19 PolarHBondContact O-N 3.32Å; E16-D19 PolarHBondContact O-N 3.03Å; D19-V23 WeakPolarHBondContact O-CG2 3.33Å; D19-V23 PolarHBondContact O-N 2.68Å
20	E	54.5	Low	58.3	Low	138 Å²	138	101 Å²	101	65%	0.645	55%	0.549	S	S	*	.	H	α-helix	trans	-68.8	-35.7	174.9	-68.5	-170.9	137.1	0	0	112.6	E16 N24	E16-E20 WeakPolarHBondContact O-CG 3.41Å; E16-E20 PolarHBondContact O-N 3.11Å; E16-E20 VanDerWaalsContact O-N 3.14Å; E20-N24 PolarHBondContact O-N 3.46Å
21	L	53.1	Low	58.7	Low	121 Å²	121	99.8 Å²	99.8	63%	0.634	55%	0.547	S	S	*	.	H	α-helix	trans	-70.9	-37.7	179.3	-153.5	84.6	0	0	0	112.3	E17 S18 N24 S25	E17-L21 WeakPolarHBondContact O-CB 3.38Å; E17-L21 PolarHBondContact O-N 3.47Å; S18-L21 PolarHBondContact O-N 3.14Å; L21-N24 PolarHBondContact O-N 2.91Å; L21-S25 WeakPolarHBondContact O-CB 3.35Å; L21-S25 PolarHBondContact O-N 3.41Å
22	E	53	Low	59.6	Low	150 Å²	150	98 Å²	98	70%	0.701	54%	0.541	S	S	*	.	H	α-helix	trans	-65.3	-42.1	179.1	-169.2	174.4	147.5	0	0	111.5	S18 N24 S25 G26	S18-E22 PolarHBondContact O-N 3.44Å; E22-N24 PolarHBondContact O-N 3.06Å; E22-S25 PolarHBondContact O-N 3.28Å; E22-G26 PolarHBondContact O-N 3.08Å; E22-G26 VanDerWaalsContact O-N 3.08Å
23	V	55.7	Low	60.4	Low	107 Å²	107	99.8 Å²	99.8	65%	0.648	55%	0.546	S	S	*	.	H	α-helix	trans	-66.6	-37.7	178.3	-177.7	0	0	0	0	111.3	D19	D19-V23 WeakPolarHBondContact O-CG2 3.33Å; D19-V23 PolarHBondContact O-N 2.68Å
24	N	55.6	Low	61.4	Low	106 Å²	106	100.9 Å²	100.9	57%	0.567	55%	0.552	S	S	*	*	H	α-helix	trans	-74.7	-39	178.1	-164.4	32.5	0	0	0	112.3	E20 L21 E22 T27 T28	E20-N24 PolarHBondContact O-N 3.46Å; L21-N24 PolarHBondContact O-N 2.91Å; E22-N24 PolarHBondContact O-N 3.06Å; N24-T27 PolarHBondContact O-OG1 3.38Å; N24-T28 PolarHBondContact O-N 3.13Å; N24-T28 PolarHBondContact O-OG1 2.71Å
25	S	54.4	Low	62.6	Low	61 Å²	61	102.9 Å²	102.9	43%	0.427	56%	0.556	S	S	.	*	H	α-helix	trans	-63.6	-43.8	178	-172.2	0	0	0	0	112.2	L21 E22 T27 T28 E29	L21-S25 WeakPolarHBondContact O-CB 3.35Å; L21-S25 PolarHBondContact O-N 3.41Å; E22-S25 PolarHBondContact O-N 3.28Å; S25-T27 VanDerWaalsContact C-N 3.35Å; S25-T27 PolarHBondContact O-N 3.07Å; S25-T28 PolarHBondContact O-N 3.02Å; S25-E29 PolarHBondContact O-N 3.39Å
26	G	56.5	Low	64	Low	35 Å²	35	105 Å²	105	36%	0.361	56%	0.562	S	S	.	*	H	α-helix	trans	-57.8	-45.2	180	0	0	0	0	0	112.6	E22 T28 E30	E22-G26 PolarHBondContact O-N 3.08Å; E22-G26 VanDerWaalsContact O-N 3.08Å; G26-T28 PolarHBondContact O-N 3.27Å; G26-E30 WeakPolarHBondContact O-CG 3.37Å; G26-E30 PolarHBondContact O-N 3.5Å
27	T	60.4	Low	65.2	Low	74 Å²	74	103.9 Å²	103.9	45%	0.454	56%	0.56	S	S	.	*	H	α-helix	trans	-68.1	-36.7	178.5	63.4	0	0	0	0	113	N24 S25 T31	N24-T27 PolarHBondContact O-OG1 3.38Å; S25-T27 VanDerWaalsContact C-N 3.35Å; S25-T27 PolarHBondContact O-N 3.07Å; T27-T31 WeakPolarHBondContact O-CG2 3.38Å; T27-T31 PolarHBondContact O-N 3.21Å; T27-T31 VanDerWaalsContact O-N 3.13Å; T27-T31 PolarHBondContact O-OG1 3.22Å
28	T	61.3	Low	66.8	Low	65 Å²	65	101.6 Å²	101.6	40%	0.399	56%	0.555	S	S	.	*	H	α-helix	trans	-70.3	-42	-176.8	-39.9	0	0	0	0	111.3	N24 S25 G26 T31 N32	N24-T28 PolarHBondContact O-N 3.13Å; N24-T28 PolarHBondContact O-OG1 2.71Å; S25-T28 PolarHBondContact O-N 3.02Å; G26-T28 PolarHBondContact O-N 3.27Å; T28-T31 PolarHBondContact O-N 3.1Å; T28-T31 PolarHBondContact O-OG1 3.29Å; T28-N32 PolarHBondContact O-N 3.17Å; T28-N32 PolarHBondContact O-ND2 3.33Å
29	E	61	Low	68.5	Low	131 Å²	131	104.4 Å²	104.4	61%	0.612	56%	0.563	S	S	*	*	H	α-helix	trans	-64.5	-42.7	176.4	-68.2	-164.4	137	0	0	112.1	S25 T31 N32 V33	S25-E29 PolarHBondContact O-N 3.39Å; E29-T31 PolarHBondContact O-N 3.17Å; E29-N32 PolarHBondContact O-N 3.28Å; E29-V33 WeakPolarHBondContact O-CG2 3.41Å; E29-V33 PolarHBondContact O-N 3.44Å
30	E	65.6	Low	70.1	Confident	147 Å²	147	103.6 Å²	103.6	69%	0.687	56%	0.558	S	S	*	*	H	α-helix	trans	-61.3	-42.3	177.6	-73.1	-169.5	137	0	0	112.4	G26 N32 V33 L34	G26-E30 WeakPolarHBondContact O-CG 3.37Å; G26-E30 PolarHBondContact O-N 3.5Å; E30-N32 VanDerWaalsContact C-N 3.35Å; E30-N32 PolarHBondContact O-N 3.44Å; E30-V33 PolarHBondContact O-N 3.45Å; E30-L34 PolarHBondContact O-N 3.45Å
31	T	70.2	Confident	71.8	Confident	79 Å²	79	99.8 Å²	99.8	49%	0.485	55%	0.547	S	S	.	.	H	α-helix	trans	-62.5	-40.7	177.4	56.3	0	0	0	0	112.5	T27 T28 E29 V33 L34 E35	T27-T31 WeakPolarHBondContact O-CG2 3.38Å; T27-T31 PolarHBondContact O-N 3.21Å; T27-T31 VanDerWaalsContact O-N 3.13Å; T27-T31 PolarHBondContact O-OG1 3.22Å; T28-T31 PolarHBondContact O-N 3.1Å; T28-T31 PolarHBondContact O-OG1 3.29Å; E29-T31 PolarHBondContact O-N 3.17Å; T31-V33 VanDerWaalsContact C-N 3.35Å; T31-V33 PolarHBondContact O-N 3.23Å; T31-L34 PolarHBondContact O-N 3.42Å; T31-E35 PolarHBondContact O-N 2.83Å; T31-E35 VanDerWaalsContact O-N 3.1Å
32	N	77.8	Confident	73.8	Confident	97 Å²	97	95.7 Å²	95.7	52%	0.519	53%	0.534	S	S	.	.	H	α-helix	trans	-63.6	-40	178.4	-74.5	-25.9	0	0	0	112.1	T28 E29 E30 L34 L36	T28-N32 PolarHBondContact O-N 3.17Å; T28-N32 PolarHBondContact O-ND2 3.33Å; E29-N32 PolarHBondContact O-N 3.28Å; E30-N32 VanDerWaalsContact C-N 3.35Å; E30-N32 PolarHBondContact O-N 3.44Å; N32-L34 VanDerWaalsContact C-N 3.35Å; N32-L36 WeakPolarHBondContact O-CB 3.47Å; N32-L36 PolarHBondContact O-N 3.26Å
33	V	80.5	Confident	75.7	Confident	99 Å²	99	93.8 Å²	93.8	60%	0.6	53%	0.528	S	S	*	.	H	α-helix	trans	-65.6	-40	178.6	177.5	0	0	0	0	111	E29 E30 T31 L36 L37	E29-V33 WeakPolarHBondContact O-CG2 3.41Å; E29-V33 PolarHBondContact O-N 3.44Å; E30-V33 PolarHBondContact O-N 3.45Å; T31-V33 VanDerWaalsContact C-N 3.35Å; T31-V33 PolarHBondContact O-N 3.23Å; V33-L36 PolarHBondContact O-N 3.03Å; V33-L37 WeakPolarHBondContact O-CB 3.35Å; V33-L37 PolarHBondContact O-N 3.21Å
34	L	82.4	Confident	77.5	Confident	119 Å²	119	92.5 Å²	92.5	62%	0.623	52%	0.52	S	S	*	.	H	α-helix	trans	-69.1	-40.5	-179	-167.4	137.7	0	0	0	112.5	E30 T31 N32 L37 T38	E30-L34 PolarHBondContact O-N 3.45Å; T31-L34 PolarHBondContact O-N 3.42Å; N32-L34 VanDerWaalsContact C-N 3.35Å; L34-L37 PolarHBondContact O-N 3.42Å; L34-T38 WeakPolarHBondContact O-CB 3.3Å; L34-T38 PolarHBondContact O-N 2.92Å; L34-T38 PolarHBondContact O-OG1 2.82Å
35	E	85.3	Confident	79.4	Confident	127 Å²	127	92.1 Å²	92.1	59%	0.593	52%	0.521	S	S	*	.	H	α-helix	trans	-62.6	-45.9	172.9	-71.9	-166.7	171.2	0	0	111.5	T31 L37 T38 I39	T31-E35 PolarHBondContact O-N 2.83Å; T31-E35 VanDerWaalsContact O-N 3.1Å; E35-L37 PolarHBondContact O-N 2.87Å; E35-T38 PolarHBondContact O-N 2.79Å; E35-I39 WeakPolarHBondContact O-CG1 3.35Å; E35-I39 PolarHBondContact O-N 2.99Å
36	L	86.4	Confident	81.3	Confident	109 Å²	109	93.2 Å²	93.2	57%	0.571	53%	0.525	S	S	*	.	H	α-helix	trans	-59.8	-45.9	178.3	-164.5	98.9	0	0	0	111.5	N32 V33 T38 I39 I40	N32-L36 WeakPolarHBondContact O-CB 3.47Å; N32-L36 PolarHBondContact O-N 3.26Å; V33-L36 PolarHBondContact O-N 3.03Å; L36-T38 VanDerWaalsContact C-N 3.31Å; L36-T38 PolarHBondContact O-N 3.42Å; L36-I39 PolarHBondContact O-N 3.43Å; L36-I40 HydrophobicContact CD2-CD1 3.84Å; L36-I40 HydrophobicContact CG-CD1 3.96Å; L36-I40 VanDerWaalsContact O-CG1 3.28Å; L36-I40 WeakPolarHBondContact O-CG1 3.32Å; L36-I40 PolarHBondContact O-N 3.01Å
37	L	87.9	Confident	83.1	Confident	117 Å²	117	96.4 Å²	96.4	61%	0.613	53%	0.534	S	S	*	.	H	α-helix	trans	-61	-42	178	-172.5	72.6	0	0	0	111.3	V33 L34 E35 I40 S41	V33-L37 WeakPolarHBondContact O-CB 3.35Å; V33-L37 PolarHBondContact O-N 3.21Å; L34-L37 PolarHBondContact O-N 3.42Å; E35-L37 PolarHBondContact O-N 2.87Å; L37-I40 PolarHBondContact O-N 3.49Å; L37-S41 VanDerWaalsContact O-CB 3.3Å; L37-S41 WeakPolarHBondContact O-CB 3.39Å; L37-S41 PolarHBondContact O-N 3.43Å; L37-S41 PolarHBondContact O-OG 3.01Å
38	T	89.1	Confident	84.9	Confident	82 Å²	82	97 Å²	97	50%	0.503	54%	0.537	S	S	.	.	H	α-helix	trans	-62.4	-45.9	178.8	-57.1	0	0	0	0	111	L34 E35 L36 S41 G42	L34-T38 WeakPolarHBondContact O-CB 3.3Å; L34-T38 PolarHBondContact O-N 2.92Å; L34-T38 PolarHBondContact O-OG1 2.82Å; E35-T38 PolarHBondContact O-N 2.79Å; L36-T38 VanDerWaalsContact C-N 3.31Å; L36-T38 PolarHBondContact O-N 3.42Å; T38-S41 PolarHBondContact O-N 3.39Å; T38-S41 PolarHBondContact O-OG 3.34Å; T38-G42 PolarHBondContact O-N 3.05Å
39	I	90.2	Very high	86.5	Confident	121 Å²	121	99.1 Å²	99.1	62%	0.621	55%	0.545	S	S	*	.	H	α-helix	trans	-60.9	-48.7	177.4	-66.1	164.5	0	0	0	111	E35 L36 S41 G42 L43	E35-I39 WeakPolarHBondContact O-CG1 3.35Å; E35-I39 PolarHBondContact O-N 2.99Å; L36-I39 PolarHBondContact O-N 3.43Å; I39-S41 PolarHBondContact O-N 3.47Å; I39-G42 PolarHBondContact O-N 3.4Å; I39-L43 PolarHBondContact O-N 2.98Å
40	I	90.7	Very high	88.3	Confident	90 Å²	90	97 Å²	97	46%	0.462	54%	0.541	S	S	.	.	H	α-helix	trans	-62.2	-45.4	-179.6	-66.5	165.8	0	0	0	110.2	L36 L37 G42 L43 V44	L36-I40 HydrophobicContact CD2-CD1 3.84Å; L36-I40 HydrophobicContact CG-CD1 3.96Å; L36-I40 VanDerWaalsContact O-CG1 3.28Å; L36-I40 WeakPolarHBondContact O-CG1 3.32Å; L36-I40 PolarHBondContact O-N 3.01Å; L37-I40 PolarHBondContact O-N 3.49Å; I40-G42 PolarHBondContact O-N 3.29Å; I40-L43 PolarHBondContact O-N 3.45Å; I40-V44 HydrophobicContact CG2-CG2 4.45Å; I40-V44 WeakPolarHBondContact O-CG2 3.35Å; I40-V44 PolarHBondContact O-N 2.99Å
41	S	91.8	Very high	89.8	Confident	59 Å²	59	93.6 Å²	93.6	41%	0.413	53%	0.53	S	S	.	.	H	α-helix	trans	-61.8	-42.1	179.9	73.6	0	0	0	0	112.2	L37 T38 I39 L43 V44 V45	L37-S41 VanDerWaalsContact O-CB 3.3Å; L37-S41 WeakPolarHBondContact O-CB 3.39Å; L37-S41 PolarHBondContact O-N 3.43Å; L37-S41 PolarHBondContact O-OG 3.01Å; T38-S41 PolarHBondContact O-N 3.39Å; T38-S41 PolarHBondContact O-OG 3.34Å; I39-S41 PolarHBondContact O-N 3.47Å; S41-L43 VanDerWaalsContact C-N 3.34Å; S41-L43 PolarHBondContact O-N 2.96Å; S41-V44 PolarHBondContact O-N 3.22Å; S41-V45 VanDerWaalsContact O-CG2 3.32Å; S41-V45 WeakPolarHBondContact O-CG2 3.28Å; S41-V45 PolarHBondContact O-N 3.44Å
42	G	93.6	Very high	91.1	Very high	34 Å²	34	94.9 Å²	94.9	35%	0.351	53%	0.534	S	S	.	.	H	α-helix	trans	-61.5	-41.9	175.4	0	0	0	0	0	112.3	T38 I39 I40 V45 T46	T38-G42 PolarHBondContact O-N 3.05Å; I39-G42 PolarHBondContact O-N 3.4Å; I40-G42 PolarHBondContact O-N 3.29Å; G42-V45 PolarHBondContact O-N 3.5Å; G42-T46 WeakPolarHBondContact O-CG2 3.38Å; G42-T46 PolarHBondContact O-N 3.06Å; G42-T46 PolarHBondContact O-OG1 3.07Å; G42-T46 VanDerWaalsContact O-OG1 3.07Å
43	L	92.6	Very high	92	Very high	110 Å²	110	93.8 Å²	93.8	58%	0.576	53%	0.53	S	S	*	.	H	α-helix	trans	-64.2	-42.2	176.2	-174.2	135.2	0	0	0	112.2	I39 I40 S41 T46 L47	I39-L43 PolarHBondContact O-N 2.98Å; I40-L43 PolarHBondContact O-N 3.45Å; S41-L43 VanDerWaalsContact C-N 3.34Å; S41-L43 PolarHBondContact O-N 2.96Å; L43-T46 WeakPolarHBondContact CA-OG1 3.45Å; L43-T46 PolarHBondContact O-N 3.41Å; L43-T46 PolarHBondContact O-OG1 2.99Å; L43-L47 WeakPolarHBondContact O-CB 3.5Å; L43-L47 PolarHBondContact O-N 2.99Å
44	V	94.4	Very high	92.8	Very high	80 Å²	80	92.9 Å²	92.9	49%	0.485	53%	0.525	S	S	.	.	H	α-helix	trans	-63	-44.9	176.5	174.2	0	0	0	0	111.2	I40 S41 T46 L47 V48	I40-V44 HydrophobicContact CG2-CG2 4.45Å; I40-V44 WeakPolarHBondContact O-CG2 3.35Å; I40-V44 PolarHBondContact O-N 2.99Å; S41-V44 PolarHBondContact O-N 3.22Å; V44-T46 PolarHBondContact O-N 3.36Å; V44-L47 PolarHBondContact O-N 2.98Å; V44-V48 HydrophobicContact CG1-CG2 4.47Å; V44-V48 VanDerWaalsContact O-CG2 3.32Å; V44-V48 WeakPolarHBondContact O-CG2 3.34Å; V44-V48 PolarHBondContact O-N 3.3Å
45	V	95.1	Very high	93.6	Very high	99 Å²	99	92.9 Å²	92.9	60%	0.6	53%	0.525	S	S	*	.	H	α-helix	trans	-62.1	-45.4	178.9	172.7	0	0	0	0	111.3	S41 G42 L47 V48 L49	S41-V45 VanDerWaalsContact O-CG2 3.32Å; S41-V45 WeakPolarHBondContact O-CG2 3.28Å; S41-V45 PolarHBondContact O-N 3.44Å; G42-V45 PolarHBondContact O-N 3.5Å; V45-L47 PolarHBondContact O-N 3.35Å; V45-V48 PolarHBondContact O-N 3.5Å; V45-L49 WeakPolarHBondContact O-CB 3.41Å; V45-L49 PolarHBondContact O-N 2.98Å
46	T	93.7	Very high	94.2	Very high	83 Å²	83	90.9 Å²	90.9	51%	0.509	52%	0.521	S	S	.	.	H	α-helix	trans	-62.9	-40.9	176.9	52.7	0	0	0	0	112.2	G42 L43 V44 L49 V50	G42-T46 WeakPolarHBondContact O-CG2 3.38Å; G42-T46 PolarHBondContact O-N 3.06Å; G42-T46 PolarHBondContact O-OG1 3.07Å; G42-T46 VanDerWaalsContact O-OG1 3.07Å; L43-T46 WeakPolarHBondContact CA-OG1 3.45Å; L43-T46 PolarHBondContact O-N 3.41Å; L43-T46 PolarHBondContact O-OG1 2.99Å; V44-T46 PolarHBondContact O-N 3.36Å; T46-L49 PolarHBondContact O-N 3.46Å; T46-V50 WeakPolarHBondContact O-CG2 3.32Å; T46-V50 PolarHBondContact O-N 3.29Å
47	L	95.5	Very high	94.7	Very high	102 Å²	102	89.7 Å²	89.7	53%	0.534	52%	0.518	S	S	.	.	H	α-helix	trans	-61.6	-46.7	176.4	-170.3	155.4	0	0	0	111.6	L43 V44 V45 L49 V50 V51	L43-L47 WeakPolarHBondContact O-CB 3.5Å; L43-L47 PolarHBondContact O-N 2.99Å; V44-L47 PolarHBondContact O-N 2.98Å; V45-L47 PolarHBondContact O-N 3.35Å; L47-L49 VanDerWaalsContact C-N 3.3Å; L47-L49 PolarHBondContact O-N 2.87Å; L47-V50 PolarHBondContact O-N 3.07Å; L47-V51 HydrophobicContact CD2-CG2 4.09Å; L47-V51 WeakPolarHBondContact O-CG2 3.36Å; L47-V51 PolarHBondContact O-N 3.48Å
48	V	96.8	Very high	95.2	Very high	88 Å²	88	88 Å²	88	53%	0.533	51%	0.513	S	S	.	.	H	α-helix	trans	-60	-42.3	176.9	172.4	0	0	0	0	111.1	V44 V45 V50 V51 L52	V44-V48 HydrophobicContact CG1-CG2 4.47Å; V44-V48 VanDerWaalsContact O-CG2 3.32Å; V44-V48 WeakPolarHBondContact O-CG2 3.34Å; V44-V48 PolarHBondContact O-N 3.3Å; V45-V48 PolarHBondContact O-N 3.5Å; V48-V50 PolarHBondContact O-N 3.38Å; V48-V51 PolarHBondContact O-N 3.49Å; V48-L52 WeakPolarHBondContact O-CB 3.37Å; V48-L52 PolarHBondContact O-N 2.97Å
49	L	96.6	Very high	95.6	Very high	108 Å²	108	86.1 Å²	86.1	57%	0.565	51%	0.509	S	S	*	.	H	α-helix	trans	-62.4	-43.1	177.6	-174.9	139.3	0	0	0	111.8	V45 T46 L47 L52 V53	V45-L49 WeakPolarHBondContact O-CB 3.41Å; V45-L49 PolarHBondContact O-N 2.98Å; T46-L49 PolarHBondContact O-N 3.46Å; L47-L49 VanDerWaalsContact C-N 3.3Å; L47-L49 PolarHBondContact O-N 2.87Å; L49-L52 PolarHBondContact O-N 3.02Å; L49-V53 HydrophobicContact CD2-CG2 4.39Å; L49-V53 WeakPolarHBondContact O-CG2 3.41Å; L49-V53 PolarHBondContact O-N 3.03Å
50	V	97.5	Very high	95.9	Very high	87 Å²	87	84.4 Å²	84.4	53%	0.527	50%	0.504	S	S	.	.	H	α-helix	trans	-61.5	-46	176.4	171.7	0	0	0	0	111.1	T46 L47 V48 L52 V53 V54	T46-V50 WeakPolarHBondContact O-CG2 3.32Å; T46-V50 PolarHBondContact O-N 3.29Å; L47-V50 PolarHBondContact O-N 3.07Å; V48-V50 PolarHBondContact O-N 3.38Å; V50-L52 VanDerWaalsContact C-N 3.32Å; V50-L52 PolarHBondContact O-N 3.41Å; V50-V53 PolarHBondContact O-N 3.01Å; V50-V54 WeakPolarHBondContact O-CG2 3.38Å; V50-V54 PolarHBondContact O-N 3.32Å
51	V	97.4	Very high	96.2	Very high	75 Å²	75	84.1 Å²	84.1	46%	0.455	51%	0.507	S	S	.	.	H	α-helix	trans	-60	-43.4	177.9	173	0	0	0	0	111.1	L47 V48 V53 V54 L55	L47-V51 HydrophobicContact CD2-CG2 4.09Å; L47-V51 WeakPolarHBondContact O-CG2 3.36Å; L47-V51 PolarHBondContact O-N 3.48Å; V48-V51 PolarHBondContact O-N 3.49Å; V51-V53 PolarHBondContact O-N 3.25Å; V51-V54 PolarHBondContact O-N 3.5Å; V51-L55 HydrophobicContact CG1-CD1 4.15Å; V51-L55 WeakPolarHBondContact O-CG 3.38Å; V51-L55 PolarHBondContact O-N 3.28Å
52	L	97.2	Very high	96.4	Very high	106 Å²	106	85 Å²	85	56%	0.555	51%	0.509	S	S	*	.	H	α-helix	trans	-62.2	-44	178.3	-174.8	139.5	0	0	0	112	V48 L49 V50 V54 L55 V56	V48-L52 WeakPolarHBondContact O-CB 3.37Å; V48-L52 PolarHBondContact O-N 2.97Å; L49-L52 PolarHBondContact O-N 3.02Å; V50-L52 VanDerWaalsContact C-N 3.32Å; V50-L52 PolarHBondContact O-N 3.41Å; L52-V54 PolarHBondContact O-N 3.33Å; L52-L55 PolarHBondContact O-N 3.31Å; L52-V56 HydrophobicContact CD2-CG2 4.45Å; L52-V56 WeakPolarHBondContact O-CG2 3.31Å; L52-V56 PolarHBondContact O-N 3Å
53	V	97.7	Very high	96.5	Very high	74 Å²	74	88.3 Å²	88.3	45%	0.448	52%	0.518	S	S	.	.	H	α-helix	trans	-60.9	-45	176.4	172.3	0	0	0	0	111	L49 V50 V51 L55 V56 V57	L49-V53 HydrophobicContact CD2-CG2 4.39Å; L49-V53 WeakPolarHBondContact O-CG2 3.41Å; L49-V53 PolarHBondContact O-N 3.03Å; V50-V53 PolarHBondContact O-N 3.01Å; V51-V53 PolarHBondContact O-N 3.25Å; V53-L55 VanDerWaalsContact C-N 3.35Å; V53-L55 PolarHBondContact O-N 2.91Å; V53-V56 PolarHBondContact O-N 3.27Å; V53-V57 HydrophobicContact CG1-CG2 4.44Å; V53-V57 WeakPolarHBondContact O-CG2 3.35Å; V53-V57 PolarHBondContact O-N 2.93Å
54	V	97.9	Very high	96.7	Very high	81 Å²	81	86.7 Å²	86.7	49%	0.491	51%	0.513	S	S	.	.	H	α-helix	trans	-60.8	-44.1	178.2	173.2	0	0	0	0	111.2	V50 V51 L52 V56 V57 V58	V50-V54 WeakPolarHBondContact O-CG2 3.38Å; V50-V54 PolarHBondContact O-N 3.32Å; V51-V54 PolarHBondContact O-N 3.5Å; L52-V54 PolarHBondContact O-N 3.33Å; V54-V56 VanDerWaalsContact C-N 3.34Å; V54-V56 PolarHBondContact O-N 3.49Å; V54-V57 PolarHBondContact O-N 3.24Å; V54-V58 HydrophobicContact CG1-CG2 4.31Å; V54-V58 VanDerWaalsContact O-CG2 3.31Å; V54-V58 WeakPolarHBondContact O-CG2 3.34Å; V54-V58 PolarHBondContact O-N 3.44Å
55	L	97.5	Very high	96.8	Very high	119 Å²	119	86.9 Å²	86.9	62%	0.623	51%	0.514	S	S	*	.	H	α-helix	trans	-60.3	-42.7	177.3	-73.4	171.7	0	0	0	112.4	V51 L52 V53 V58 G59	V51-L55 HydrophobicContact CG1-CD1 4.15Å; V51-L55 WeakPolarHBondContact O-CG 3.38Å; V51-L55 PolarHBondContact O-N 3.28Å; L52-L55 PolarHBondContact O-N 3.31Å; V53-L55 VanDerWaalsContact C-N 3.35Å; V53-L55 PolarHBondContact O-N 2.91Å; L55-V58 PolarHBondContact O-N 3.43Å; L55-G59 PolarHBondContact O-N 3.29Å
56	V	97.8	Very high	96.7	Very high	85 Å²	85	87.2 Å²	87.2	52%	0.515	51%	0.512	S	S	.	.	H	α-helix	trans	-63	-46.4	176.8	173.1	0	0	0	0	110.8	L52 V53 V54 V58 G59 V60	L52-V56 HydrophobicContact CD2-CG2 4.45Å; L52-V56 WeakPolarHBondContact O-CG2 3.31Å; L52-V56 PolarHBondContact O-N 3Å; V53-V56 PolarHBondContact O-N 3.27Å; V54-V56 VanDerWaalsContact C-N 3.34Å; V54-V56 PolarHBondContact O-N 3.49Å; V56-V58 PolarHBondContact O-N 3.44Å; V56-G59 PolarHBondContact O-N 3.48Å; V56-V60 HydrophobicContact CG1-CG2 4.48Å; V56-V60 WeakPolarHBondContact O-CG2 3.38Å; V56-V60 PolarHBondContact O-N 3.37Å
57	V	97.8	Very high	96.7	Very high	84 Å²	84	88.2 Å²	88.2	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-60.8	-47.1	179	173	0	0	0	0	111	V53 V54 G59 V60 V61	V53-V57 HydrophobicContact CG1-CG2 4.44Å; V53-V57 WeakPolarHBondContact O-CG2 3.35Å; V53-V57 PolarHBondContact O-N 2.93Å; V54-V57 PolarHBondContact O-N 3.24Å; V57-G59 VanDerWaalsContact C-N 3.33Å; V57-G59 PolarHBondContact O-N 2.99Å; V57-V60 PolarHBondContact O-N 3.45Å; V57-V61 WeakPolarHBondContact O-CG2 3.42Å; V57-V61 PolarHBondContact O-N 3.25Å
58	V	97.8	Very high	96.7	Very high	81 Å²	81	87.1 Å²	87.1	49%	0.491	51%	0.511	S	S	.	.	H	α-helix	trans	-61	-43.3	177.1	173.7	0	0	0	0	110.8	V54 L55 V56 V60 V61 V62	V54-V58 HydrophobicContact CG1-CG2 4.31Å; V54-V58 VanDerWaalsContact O-CG2 3.31Å; V54-V58 WeakPolarHBondContact O-CG2 3.34Å; V54-V58 PolarHBondContact O-N 3.44Å; L55-V58 PolarHBondContact O-N 3.43Å; V56-V58 PolarHBondContact O-N 3.44Å; V58-V60 PolarHBondContact O-N 3.28Å; V58-V61 PolarHBondContact O-N 3.34Å; V58-V62 HydrophobicContact CG1-CG2 4.4Å; V58-V62 WeakPolarHBondContact O-CG2 3.34Å; V58-V62 PolarHBondContact O-N 2.94Å
59	G	97.1	Very high	96.5	Very high	42 Å²	42	86.2 Å²	86.2	43%	0.433	51%	0.506	S	S	.	.	H	α-helix	trans	-59.1	-43.9	176.7	0	0	0	0	0	113	L55 V56 V57 V62 L63	L55-G59 PolarHBondContact O-N 3.29Å; V56-G59 PolarHBondContact O-N 3.48Å; V57-G59 VanDerWaalsContact C-N 3.33Å; V57-G59 PolarHBondContact O-N 2.99Å; G59-V62 PolarHBondContact O-N 3.41Å; G59-L63 WeakPolarHBondContact O-CB 3.35Å; G59-L63 PolarHBondContact O-N 2.97Å
60	V	97.2	Very high	96.3	Very high	85 Å²	85	85 Å²	85	52%	0.515	50%	0.503	S	S	.	.	H	α-helix	trans	-64.6	-44.4	176.5	174	0	0	0	0	111.2	V56 V57 V58 V62 L63 V64	V56-V60 HydrophobicContact CG1-CG2 4.48Å; V56-V60 WeakPolarHBondContact O-CG2 3.38Å; V56-V60 PolarHBondContact O-N 3.37Å; V57-V60 PolarHBondContact O-N 3.45Å; V58-V60 PolarHBondContact O-N 3.28Å; V60-V62 PolarHBondContact O-N 2.94Å; V60-L63 PolarHBondContact O-N 3.28Å; V60-V64 HydrophobicContact CG1-CG2 4.44Å; V60-V64 WeakPolarHBondContact O-CG2 3.06Å; V60-V64 PolarHBondContact O-N 3.3Å
61	V	96.7	Very high	95.9	Very high	84 Å²	84	85.5 Å²	85.5	51%	0.509	51%	0.506	S	S	.	.	H	α-helix	trans	-60.5	-46.1	178.4	172.1	0	0	0	0	111.1	V57 V58 L63 V64 V65	V57-V61 WeakPolarHBondContact O-CG2 3.42Å; V57-V61 PolarHBondContact O-N 3.25Å; V58-V61 PolarHBondContact O-N 3.34Å; V61-L63 VanDerWaalsContact C-N 3.33Å; V61-L63 PolarHBondContact O-N 3.45Å; V61-V64 PolarHBondContact O-N 2.95Å; V61-V65 WeakPolarHBondContact O-CG2 3.34Å; V61-V65 PolarHBondContact O-N 3.01Å
62	V	97.3	Very high	95.5	Very high	78 Å²	78	86.8 Å²	86.8	47%	0.473	51%	0.509	S	S	.	.	H	α-helix	trans	-61.4	-43	177.5	172.8	0	0	0	0	111.1	V58 G59 V60 V64 V65 L66	V58-V62 HydrophobicContact CG1-CG2 4.4Å; V58-V62 WeakPolarHBondContact O-CG2 3.34Å; V58-V62 PolarHBondContact O-N 2.94Å; G59-V62 PolarHBondContact O-N 3.41Å; V60-V62 PolarHBondContact O-N 2.94Å; V62-V64 PolarHBondContact O-N 3.33Å; V62-V65 PolarHBondContact O-N 3.48Å; V62-L66 HydrophobicContact CG1-CD1 4.17Å; V62-L66 HydrophobicContact CG1-CG 4.46Å; V62-L66 WeakPolarHBondContact O-CG 3.4Å; V62-L66 PolarHBondContact O-N 3.48Å
63	L	95.1	Very high	95.1	Very high	103 Å²	103	86.9 Å²	86.9	54%	0.539	51%	0.51	S	S	.	.	H	α-helix	trans	-61.2	-44.5	177.7	-174.4	148.1	0	0	0	111.7	G59 V60 V61 L66 L67	G59-L63 WeakPolarHBondContact O-CB 3.35Å; G59-L63 PolarHBondContact O-N 2.97Å; V60-L63 PolarHBondContact O-N 3.28Å; V61-L63 VanDerWaalsContact C-N 3.33Å; V61-L63 PolarHBondContact O-N 3.45Å; L63-L66 PolarHBondContact O-N 3.22Å; L63-L67 HydrophobicContact CD2-CD1 3.68Å; L63-L67 HydrophobicContact CD2-CG 4.25Å; L63-L67 WeakPolarHBondContact O-CG 3.31Å; L63-L67 PolarHBondContact O-N 3.35Å
64	V	96.2	Very high	94.6	Very high	77 Å²	77	86.6 Å²	86.6	47%	0.467	51%	0.51	S	S	.	.	H	α-helix	trans	-62.3	-45.3	176.9	172.5	0	0	0	0	111.1	V60 V61 V62 L66 L67 V68	V60-V64 HydrophobicContact CG1-CG2 4.44Å; V60-V64 WeakPolarHBondContact O-CG2 3.06Å; V60-V64 PolarHBondContact O-N 3.3Å; V61-V64 PolarHBondContact O-N 2.95Å; V62-V64 PolarHBondContact O-N 3.33Å; V64-L66 VanDerWaalsContact C-N 3.33Å; V64-L66 PolarHBondContact O-N 2.99Å; V64-L67 PolarHBondContact O-N 2.98Å; V64-V68 WeakPolarHBondContact O-CG2 3.36Å; V64-V68 PolarHBondContact O-N 3.48Å
65	V	96.4	Very high	94	Very high	83 Å²	83	87.9 Å²	87.9	50%	0.503	51%	0.514	S	S	.	.	H	α-helix	trans	-60.5	-44	177.6	172.2	0	0	0	0	111	V61 V62 L67 V68 V69	V61-V65 WeakPolarHBondContact O-CG2 3.34Å; V61-V65 PolarHBondContact O-N 3.01Å; V62-V65 PolarHBondContact O-N 3.48Å; V65-L67 VanDerWaalsContact C-N 3.35Å; V65-L67 PolarHBondContact O-N 2.92Å; V65-V68 PolarHBondContact O-N 3.26Å; V65-V69 HydrophobicContact CG1-CG2 4.48Å; V65-V69 WeakPolarHBondContact O-CG2 3.33Å; V65-V69 PolarHBondContact O-N 3.34Å
66	L	94.3	Very high	93.2	Very high	106 Å²	106	86.4 Å²	86.4	56%	0.555	51%	0.51	S	S	*	.	H	α-helix	trans	-60.6	-43.7	176.5	-74.5	175.1	0	0	0	112	V62 L63 V64 V68 V69 V70	V62-L66 HydrophobicContact CG1-CD1 4.17Å; V62-L66 HydrophobicContact CG1-CG 4.46Å; V62-L66 WeakPolarHBondContact O-CG 3.4Å; V62-L66 PolarHBondContact O-N 3.48Å; L63-L66 PolarHBondContact O-N 3.22Å; V64-L66 VanDerWaalsContact C-N 3.33Å; V64-L66 PolarHBondContact O-N 2.99Å; L66-V68 VanDerWaalsContact C-N 3.35Å; L66-V68 PolarHBondContact O-N 2.97Å; L66-V69 PolarHBondContact O-N 3.46Å; L66-V70 WeakPolarHBondContact O-CG2 3.38Å; L66-V70 PolarHBondContact O-N 2.98Å
67	L	93.4	Very high	92.3	Very high	104 Å²	104	86.5 Å²	86.5	55%	0.545	51%	0.511	S	S	.	.	H	α-helix	trans	-60.8	-44.1	176.1	-71.5	177.6	0	0	0	111.8	L63 V64 V65 V69 V70 V71	L63-L67 HydrophobicContact CD2-CD1 3.68Å; L63-L67 HydrophobicContact CD2-CG 4.25Å; L63-L67 WeakPolarHBondContact O-CG 3.31Å; L63-L67 PolarHBondContact O-N 3.35Å; V64-L67 PolarHBondContact O-N 2.98Å; V65-L67 VanDerWaalsContact C-N 3.35Å; V65-L67 PolarHBondContact O-N 2.92Å; L67-V69 VanDerWaalsContact C-N 3.34Å; L67-V69 PolarHBondContact O-N 3.5Å; L67-V70 PolarHBondContact O-N 3.3Å; L67-V71 VanDerWaalsContact O-CG2 3.31Å; L67-V71 WeakPolarHBondContact O-CG2 3.32Å; L67-V71 PolarHBondContact O-N 3.46Å
68	V	94.3	Very high	91.1	Very high	79 Å²	79	86.4 Å²	86.4	48%	0.479	51%	0.51	S	S	.	.	H	α-helix	trans	-60.6	-44.8	176.7	173.1	0	0	0	0	111	V64 V65 L66 V70 V71 L72	V64-V68 WeakPolarHBondContact O-CG2 3.36Å; V64-V68 PolarHBondContact O-N 3.48Å; V65-V68 PolarHBondContact O-N 3.26Å; L66-V68 VanDerWaalsContact C-N 3.35Å; L66-V68 PolarHBondContact O-N 2.97Å; V68-V70 VanDerWaalsContact C-N 3.35Å; V68-V70 PolarHBondContact O-N 3.26Å; V68-V71 PolarHBondContact O-N 3.23Å; V68-L72 HydrophobicContact CG1-CD1 4.03Å; V68-L72 HydrophobicContact CG1-CG 4.4Å; V68-L72 VanDerWaalsContact O-CG 3.31Å; V68-L72 WeakPolarHBondContact O-CG 3.35Å; V68-L72 PolarHBondContact O-N 3.29Å
69	V	93.1	Very high	90	Very high	70 Å²	70	84.6 Å²	84.6	42%	0.424	50%	0.504	S	S	.	.	H	α-helix	trans	-60.7	-44.4	176.9	172.3	0	0	0	0	111.2	V65 L66 L67 V71 L72 L73	V65-V69 HydrophobicContact CG1-CG2 4.48Å; V65-V69 WeakPolarHBondContact O-CG2 3.33Å; V65-V69 PolarHBondContact O-N 3.34Å; L66-V69 PolarHBondContact O-N 3.46Å; L67-V69 VanDerWaalsContact C-N 3.34Å; L67-V69 PolarHBondContact O-N 3.5Å; V69-V71 PolarHBondContact O-N 2.93Å; V69-L72 PolarHBondContact O-N 3.43Å; V69-L73 HydrophobicContact CG1-CD1 4.06Å; V69-L73 HydrophobicContact CG1-CG 4.44Å; V69-L73 VanDerWaalsContact O-CG 3.31Å; V69-L73 WeakPolarHBondContact O-CG 3.31Å; V69-L73 PolarHBondContact O-N 3.27Å
70	V	92	Very high	88.8	Confident	82 Å²	82	87.1 Å²	87.1	50%	0.497	51%	0.511	S	S	.	.	H	α-helix	trans	-61.9	-44.5	177.5	171.6	0	0	0	0	111.1	L66 L67 V68 L72 L73 C74	L66-V70 WeakPolarHBondContact O-CG2 3.38Å; L66-V70 PolarHBondContact O-N 2.98Å; L67-V70 PolarHBondContact O-N 3.3Å; V68-V70 VanDerWaalsContact C-N 3.35Å; V68-V70 PolarHBondContact O-N 3.26Å; V70-L72 PolarHBondContact O-N 3.46Å; V70-L73 PolarHBondContact O-N 2.85Å; V70-C74 WeakPolarHBondContact O-CB 3.32Å; V70-C74 PolarHBondContact O-N 3.34Å; V70-C74 PolarHBondContact O-SG 3.47Å; V70-C74 VanDerWaalsContact O-SG 3.34Å
71	V	90	Very high	87.2	Confident	98 Å²	98	87.5 Å²	87.5	59%	0.594	51%	0.513	S	S	*	.	H	α-helix	trans	-62	-44.3	178.1	171.6	0	0	0	0	111.2	L67 V68 V69 L73 C74 D75	L67-V71 VanDerWaalsContact O-CG2 3.31Å; L67-V71 WeakPolarHBondContact O-CG2 3.32Å; L67-V71 PolarHBondContact O-N 3.46Å; V68-V71 PolarHBondContact O-N 3.23Å; V69-V71 PolarHBondContact O-N 2.93Å; V71-L73 VanDerWaalsContact C-N 3.35Å; V71-L73 PolarHBondContact O-N 3.23Å; V71-C74 WeakPolarHBondContact O-CB 3.48Å; V71-C74 PolarHBondContact O-N 2.86Å; V71-D75 PolarHBondContact O-N 2.95Å
72	L	89.6	Confident	85.4	Confident	102 Å²	102	89.4 Å²	89.4	53%	0.534	52%	0.52	S	S	.	.	H	α-helix	trans	-62.5	-41.8	176.8	-70.6	173.4	0	0	0	111.9	V68 V69 V70 C74 D75 V76	V68-L72 HydrophobicContact CG1-CD1 4.03Å; V68-L72 HydrophobicContact CG1-CG 4.4Å; V68-L72 VanDerWaalsContact O-CG 3.31Å; V68-L72 WeakPolarHBondContact O-CG 3.35Å; V68-L72 PolarHBondContact O-N 3.29Å; V69-L72 PolarHBondContact O-N 3.43Å; V70-L72 PolarHBondContact O-N 3.46Å; L72-C74 VanDerWaalsContact C-N 3.35Å; L72-D75 PolarHBondContact O-N 2.95Å; L72-V76 VanDerWaalsContact O-CG2 3.32Å; L72-V76 WeakPolarHBondContact O-CG2 3.26Å; L72-V76 PolarHBondContact O-N 3.49Å
73	L	88.4	Confident	83.3	Confident	107 Å²	107	93.9 Å²	93.9	56%	0.56	53%	0.534	S	S	*	.	H	α-helix	trans	-65.4	-39.5	175.5	-70.5	175.3	0	0	0	111.6	V69 V70 V71 V76 V77	V69-L73 HydrophobicContact CG1-CD1 4.06Å; V69-L73 HydrophobicContact CG1-CG 4.44Å; V69-L73 VanDerWaalsContact O-CG 3.31Å; V69-L73 WeakPolarHBondContact O-CG 3.31Å; V69-L73 PolarHBondContact O-N 3.27Å; V70-L73 PolarHBondContact O-N 2.85Å; V71-L73 VanDerWaalsContact C-N 3.35Å; V71-L73 PolarHBondContact O-N 3.23Å; L73-V76 PolarHBondContact O-N 3.37Å; L73-V77 WeakPolarHBondContact O-CB 3.49Å; L73-V77 WeakPolarHBondContact O-CG2 3.47Å; L73-V77 PolarHBondContact O-N 2.91Å
74	C	86.5	Confident	81.1	Confident	68 Å²	68	96.1 Å²	96.1	46%	0.459	54%	0.542	S	S	.	.	H	α-helix	trans	-61.8	-43.8	174.3	-74.6	0	0	0	0	111.9	V70 V71 L72 V77 V78	V70-C74 WeakPolarHBondContact O-CB 3.32Å; V70-C74 PolarHBondContact O-N 3.34Å; V70-C74 PolarHBondContact O-SG 3.47Å; V70-C74 VanDerWaalsContact O-SG 3.34Å; V71-C74 WeakPolarHBondContact O-CB 3.48Å; V71-C74 PolarHBondContact O-N 2.86Å; L72-C74 VanDerWaalsContact C-N 3.35Å; C74-V77 PolarHBondContact O-N 3.23Å; C74-V78 VanDerWaalsContact O-CG2 3.32Å; C74-V78 WeakPolarHBondContact O-CG2 3.49Å; C74-V78 PolarHBondContact O-N 3.29Å
75	D	85.8	Confident	79	Confident	108 Å²	108	97.8 Å²	97.8	58%	0.578	55%	0.554	S	S	*	*	H	α-helix	trans	-61.9	-44.2	177.3	-168.8	28.5	0	0	0	111.5	V71 L72 V77 V78 A79	V71-D75 PolarHBondContact O-N 2.95Å; L72-D75 PolarHBondContact O-N 2.95Å; D75-V77 PolarHBondContact O-N 3.15Å; D75-V78 PolarHBondContact O-N 3.32Å; D75-A79 WeakPolarHBondContact O-CB 3.31Å; D75-A79 PolarHBondContact O-N 3.44Å
76	V	80.4	Confident	76.9	Confident	89 Å²	89	99.8 Å²	99.8	54%	0.539	56%	0.562	S	S	.	*	H	α-helix	trans	-61.6	-42.3	173.8	173.3	0	0	0	0	111.6	L72 L73 A79 V80	L72-V76 VanDerWaalsContact O-CG2 3.32Å; L72-V76 WeakPolarHBondContact O-CG2 3.26Å; L72-V76 PolarHBondContact O-N 3.49Å; L73-V76 PolarHBondContact O-N 3.37Å; V76-A79 PolarHBondContact O-N 2.94Å; V76-V80 VanDerWaalsContact O-CG2 3.26Å; V76-V80 WeakPolarHBondContact O-CG2 3.22Å; V76-V80 PolarHBondContact O-N 3.46Å
77	V	77.9	Confident	74.7	Confident	87 Å²	87	102.6 Å²	102.6	53%	0.527	57%	0.572	S	S	.	*	H	α-helix	trans	-66.3	-42	177.9	170.8	0	0	0	0	111.2	L73 C74 D75 V80 V81	L73-V77 WeakPolarHBondContact O-CB 3.49Å; L73-V77 WeakPolarHBondContact O-CG2 3.47Å; L73-V77 PolarHBondContact O-N 2.91Å; C74-V77 PolarHBondContact O-N 3.23Å; D75-V77 PolarHBondContact O-N 3.15Å; V77-V80 PolarHBondContact O-N 2.87Å; V77-V81 HydrophobicContact CG1-CG2 4.24Å; V77-V81 WeakPolarHBondContact O-CB 3.26Å; V77-V81 VanDerWaalsContact O-CG2 3.26Å; V77-V81 WeakPolarHBondContact O-CG2 3.32Å; V77-V81 PolarHBondContact O-N 3.44Å
78	V	74.5	Confident	72.5	Confident	81 Å²	81	103.8 Å²	103.8	49%	0.491	59%	0.586	S	S	.	*	H	α-helix	trans	-61.3	-47.7	175.4	170.9	0	0	0	0	110.1	C74 D75 V80 V81 D82	C74-V78 VanDerWaalsContact O-CG2 3.32Å; C74-V78 WeakPolarHBondContact O-CG2 3.49Å; C74-V78 PolarHBondContact O-N 3.29Å; D75-V78 PolarHBondContact O-N 3.32Å; V78-V80 VanDerWaalsContact C-N 3.28Å; V78-V80 PolarHBondContact O-N 2.9Å; V78-V81 PolarHBondContact O-N 3.43Å; V78-V81 VanDerWaalsContact O-N 3.15Å; V78-D82 PolarHBondContact O-N 3.29Å
79	A	74.1	Confident	70.6	Confident	44 Å²	44	106.2 Å²	106.2	36%	0.364	60%	0.595	S	S	.	*	H	α-helix	trans	-57.2	-41.7	176.5	0	0	0	0	0	112.1	D75 V76 F83	D75-A79 WeakPolarHBondContact O-CB 3.31Å; D75-A79 PolarHBondContact O-N 3.44Å; V76-A79 PolarHBondContact O-N 2.94Å; A79-F83 WeakPolarHBondContact O-CD2 3.47Å; A79-F83 PolarHBondContact O-N 3.37Å
80	V	71.8	Confident	68.6	Low	95 Å²	95	110.9 Å²	110.9	58%	0.576	62%	0.617	S	S	*	*	H	α-helix	trans	-69.2	-38.7	177	172.7	0	0	0	0	112.4	V76 V77 V78 F83	V76-V80 VanDerWaalsContact O-CG2 3.26Å; V76-V80 WeakPolarHBondContact O-CG2 3.22Å; V76-V80 PolarHBondContact O-N 3.46Å; V77-V80 PolarHBondContact O-N 2.87Å; V78-V80 VanDerWaalsContact C-N 3.28Å; V78-V80 PolarHBondContact O-N 2.9Å; V80-F83 WeakPolarHBondContact O-CB 3.41Å; V80-F83 PolarHBondContact O-N 2.96Å; V80-F83 VanDerWaalsContact O-N 3.12Å
81	V	63.2	Low	66.8	Low	93 Å²	93	115 Å²	115	56%	0.564	63%	0.634	S	S	*	*	H	α-helix	trans	-68.4	-36.3	178	171.8	0	0	0	0	111.2	V77 V78 F83 E84	V77-V81 HydrophobicContact CG1-CG2 4.24Å; V77-V81 WeakPolarHBondContact O-CB 3.26Å; V77-V81 VanDerWaalsContact O-CG2 3.26Å; V77-V81 WeakPolarHBondContact O-CG2 3.32Å; V77-V81 PolarHBondContact O-N 3.44Å; V78-V81 PolarHBondContact O-N 3.43Å; V78-V81 VanDerWaalsContact O-N 3.15Å; V81-F83 PolarHBondContact O-N 3.01Å; V81-E84 WeakPolarHBondContact O-CB 3.39Å; V81-E84 PolarHBondContact O-N 2.89Å
82	D	58.3	Low	65	Low	123 Å²	123	121.2 Å²	121.2	66%	0.658	65%	0.647	S	S	*	*	H	α-helix	trans	-66.7	-17.6	172.6	-72.9	-27.8	0	0	0	112.6	V78 E84	V78-D82 PolarHBondContact O-N 3.29Å; D82-E84 VanDerWaalsContact C-N 3.33Å
83	F	54.3	Low	63.6	Low	173 Å²	173	126.1 Å²	126.1	76%	0.759	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.4	-1.2	170.8	-82	-67.2	0	0	0	114.1	A79 V80 V81 P85	A79-F83 WeakPolarHBondContact O-CD2 3.47Å; A79-F83 PolarHBondContact O-N 3.37Å; V80-F83 WeakPolarHBondContact O-CB 3.41Å; V80-F83 PolarHBondContact O-N 2.96Å; V80-F83 VanDerWaalsContact O-N 3.12Å; V81-F83 PolarHBondContact O-N 3.01Å; F83-P85 WeakPolarHBondContact O-CD 3Å
84	E	49.2	Very low	62	Low	150 Å²	150	127.5 Å²	127.5	70%	0.701	66%	0.657	S	S	*	*	S	Bend	trans	-89	100.7	167.7	-154.4	100.2	93.7	0	0	107.5	V81 D82 D86	V81-E84 WeakPolarHBondContact O-CB 3.39Å; V81-E84 PolarHBondContact O-N 2.89Å; D82-E84 VanDerWaalsContact C-N 3.33Å; E84-D86 PolarHBondContact O-N 2.91Å
85	P	51.9	Low	60.3	Low	112 Å²	112	129.1 Å²	129.1	73%	0.727	67%	0.667	S	S	*	*			trans	-70.7	7.2	-169	28.7	-36.1	0	0	0	115.2	F83	F83-P85 WeakPolarHBondContact O-CD 3Å
86	D	52	Low	59	Low	125 Å²	125	130.5 Å²	130.5	67%	0.668	67%	0.668	S	S	*	*	S	Bend	trans	-136.2	120.1	-175.1	-66.4	-56.1	0	0	0	111.5	E84	E84-D86 PolarHBondContact O-N 2.91Å
87	E	48.5	Very low	57.7	Low	164 Å²	164	133.2 Å²	133.2	77%	0.766	68%	0.679	S	S	*	*			trans	103.4	121	159.1	-52.4	-176.4	-164.7	0	0	119.1	I89	E87-I89 PolarHBondContact O-N 2.94Å
88	P	46.2	Very low	56	Low	129 Å²	129	139.4 Å²	139.4	84%	0.838	69%	0.692	S	S	*	*			trans	-84.4	102.7	-175.4	33.9	-32.4	0	0	0	111.6
89	I	54.3	Low	54.8	Low	131 Å²	131	141.9 Å²	141.9	67%	0.672	70%	0.702	S	S	*	*			trans	-124.7	60.7	173.8	-48.5	175.2	0	0	0	110.1	E87	E87-I89 PolarHBondContact O-N 2.94Å
90	L	52.7	Low	53.8	Low	168 Å²	168	144 Å²	144	88%	0.88	71%	0.712	S	S	*	*			trans	-89.5	6.7	178.7	-99.4	154.9	0	0	0	114.9
91	I	53.8	Low	52.5	Low	167 Å²	167	148.3 Å²	148.3	86%	0.856	72%	0.723	S	S	*	*	S	Bend	trans	-121.5	-8	-171.3	-62	175.2	0	0	0	115.2
92	R	52.4	Low	51.5	Low	230 Å²	230	156 Å²	156	87%	0.868	76%	0.759	S	S	*	*	S	Bend	trans	-97.1	-19	-171.7	-114.1	-174	-164.8	-147	4.5	118.2
93	R	58.4	Low	51.2	Low	204 Å²	204	157.6 Å²	157.6	77%	0.77	77%	0.765	S	S	*	*	S	Bend	trans	-97.6	-24	-163.4	-144.4	164.2	-172.9	167.1	-0.4	116.6
94	Y	55.6	Low	51	Low	136 Å²	136	156.8 Å²	156.8	53%	0.533	77%	0.765	S	S	.	*			trans	-138.6	76.9	-173.2	-55.1	-56.5	0	0	0	114.1	F96 L97	Y94-F96 HydrophobicContact CD1-CD1 4.5Å; Y94-F96 AromaticContact CD1-CE1 3.46Å; Y94-F96 HydrophobicContact CD1-CE1 3.46Å; Y94-F96 VanDerWaalsContact CD1-CE1 3.46Å; Y94-F96 AromaticContact CD1-CE2 3.88Å; Y94-F96 HydrophobicContact CD1-CE2 3.88Å; Y94-F96 AromaticContact CD1-CZ 3.08Å; Y94-F96 HydrophobicContact CD1-CZ 3.08Å; Y94-F96 HydrophobicContact CE1-CE1 4.27Å; Y94-F96 AromaticContact CE1-CZ 3.72Å; Y94-F96 HydrophobicContact CE1-CZ 3.72Å; Y94-F96 HydrophobicContact CG-CE1 4.31Å; Y94-F96 HydrophobicContact CG-CE2 4.32Å; Y94-F96 AromaticContact CG-CZ 3.91Å; Y94-F96 HydrophobicContact CG-CZ 3.91Å; Y94-F96 PolarHBondContact O-N 3.12Å; Y94-L97 PolarHBondContact O-N 3.03Å
95	P	50.8	Low	51.1	Low	103 Å²	103	157.2 Å²	157.2	67%	0.669	77%	0.768	S	S	*	*	G	3₁₀ helix	trans	-63.9	-16.9	170.5	26.3	-33.4	0	0	0	113.2	W98	P95-W98 PolarHBondContact O-N 3.27Å
96	F	58.5	Low	51	Low	137 Å²	137	159.8 Å²	159.8	60%	0.601	77%	0.771	S	S	*	*	G	3₁₀ helix	trans	-80.6	-11	179.6	54.2	-100.2	0	0	0	114.5	Y94	Y94-F96 HydrophobicContact CD1-CD1 4.5Å; Y94-F96 AromaticContact CD1-CE1 3.46Å; Y94-F96 HydrophobicContact CD1-CE1 3.46Å; Y94-F96 VanDerWaalsContact CD1-CE1 3.46Å; Y94-F96 AromaticContact CD1-CE2 3.88Å; Y94-F96 HydrophobicContact CD1-CE2 3.88Å; Y94-F96 AromaticContact CD1-CZ 3.08Å; Y94-F96 HydrophobicContact CD1-CZ 3.08Å; Y94-F96 HydrophobicContact CE1-CE1 4.27Å; Y94-F96 AromaticContact CE1-CZ 3.72Å; Y94-F96 HydrophobicContact CE1-CZ 3.72Å; Y94-F96 HydrophobicContact CG-CE1 4.31Å; Y94-F96 HydrophobicContact CG-CE2 4.32Å; Y94-F96 AromaticContact CG-CZ 3.91Å; Y94-F96 HydrophobicContact CG-CZ 3.91Å; Y94-F96 PolarHBondContact O-N 3.12Å
97	L	53.3	Low	51	Low	146 Å²	146	162 Å²	162	76%	0.764	78%	0.777	S	S	*	*	G	3₁₀ helix	trans	-78.3	-9.8	168.9	-120	97.5	0	0	0	112.3	Y94 I99	Y94-L97 PolarHBondContact O-N 3.03Å; L97-I99 VanDerWaalsContact C-N 3.32Å; L97-I99 PolarHBondContact O-N 3.31Å
98	W	42.4	Very low	51.1	Low	216 Å²	216	161.9 Å²	161.9	82%	0.818	78%	0.778	S	S	*	*			trans	-94.9	36.8	-179.3	-165.4	5.2	0	0	0	112.9	P95 P100	P95-W98 PolarHBondContact O-N 3.27Å; W98-P100 WeakPolarHBondContact O-CD 3.14Å
99	I	49.4	Very low	51.5	Low	133 Å²	133	164.2 Å²	164.2	68%	0.682	77%	0.774	S	S	*	*			trans	-100.5	90.7	161.3	-59.2	166.2	0	0	0	107	L97 F101	L97-I99 VanDerWaalsContact C-N 3.32Å; L97-I99 PolarHBondContact O-N 3.31Å; I99-F101 VanDerWaalsContact C-N 3.32Å; I99-F101 PolarHBondContact O-N 3.35Å
100	P	53.2	Low	51.3	Low	89 Å²	89	166.8 Å²	166.8	58%	0.578	78%	0.782	S	S	*	*			trans	-94.3	58.4	174.2	39	-33.6	0	0	0	109.3	W98	W98-P100 WeakPolarHBondContact O-CD 3.14Å
101	F	44.7	Very low	51.2	Low	186 Å²	186	166.7 Å²	166.7	82%	0.816	77%	0.773	S	S	*	*			trans	-156.6	82.9	173.3	-87.3	-75.8	0	0	0	111.5	I99	I99-F101 VanDerWaalsContact C-N 3.32Å; I99-F101 PolarHBondContact O-N 3.35Å
102	L	41.5	Very low	50.9	Low	253 Å²	253	166.6 Å²	166.6	100%	1.325	77%	0.766	S	S	*	*			trans	-147	0	133.6	-146.4	102.2	0	0	0	109.3

Retrieved 102 of 102 residues in 16.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).