YD008_YEAST Loading...

Putative uncharacterized protein YDR008C

AlphaFold DB , UniProt , Accession A0A023PZ99, Species YEAST (Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Baker's yeast), Gene n/a, Length 116 aa.

						>YD008_YEAST|A0A023PZ99
MFRSFMLAFQKACRQVHKQYLNKYYSVITYFLAFLTKFAILLESFTPFVSTPPLTSTPITPFNLSASPTFSGVSPPANIKCKLSGLSCLPTQSEIEFQSKSSPVPPASESNKGINE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	73.7	Confident	87	Confident	215 Å²	215	126.7 Å²	126.7	100%	1.059	61%	0.609	S	S	*	*				0	-53.3	0	-91.2	179.6	-171.2	0	0	113.8	R3 S4 F5	M1-R3 PolarHBondContact O-N 3.34Å; M1-S4 PolarHBondContact O-N 2.88Å; M1-S4 VanDerWaalsContact O-N 3.14Å; M1-F5 PolarHBondContact O-N 2.86Å
2	F	85.8	Confident	87	Confident	145 Å²	145	120.2 Å²	120.2	64%	0.636	59%	0.591	S	S	*	*	H	α-helix	trans	-54.2	-42.4	-172.5	-169.7	-103.4	0	0	0	115.3	S4 F5 M6	F2-S4 PolarHBondContact O-N 3.48Å; F2-F5 WeakPolarHBondContact O-CB 3.45Å; F2-F5 PolarHBondContact O-N 3.42Å; F2-M6 HydrophobicContact CD1-CG 4.17Å; F2-M6 HydrophobicContact CE1-CE 3.69Å; F2-M6 HydrophobicContact CE1-CG 3.85Å; F2-M6 HydrophobicContact CE2-CE 4.23Å; F2-M6 HydrophobicContact CZ-CE 3.35Å; F2-M6 HydrophobicContact CZ-CG 4.18Å; F2-M6 PolarHBondContact O-N 2.82Å
3	R	88.9	Confident	86.6	Confident	208 Å²	208	115.5 Å²	115.5	79%	0.785	58%	0.577	S	S	*	*	H	α-helix	trans	-62	-39.9	179.4	-168.2	175	-179.4	-175.9	0	113	M1 M6 L7	M1-R3 PolarHBondContact O-N 3.34Å; R3-M6 PolarHBondContact O-N 2.86Å; R3-L7 WeakPolarHBondContact O-CG 3.23Å; R3-L7 PolarHBondContact O-N 3.31Å; R3-L7 VanDerWaalsContact O-N 3.13Å
4	S	90.8	Very high	86.5	Confident	86 Å²	86	118.2 Å²	118.2	60%	0.601	58%	0.577	S	S	*	*	H	α-helix	trans	-67.2	-39.4	177.4	-51.5	0	0	0	0	111.5	M1 F2 L7 A8	M1-S4 PolarHBondContact O-N 2.88Å; M1-S4 VanDerWaalsContact O-N 3.14Å; F2-S4 PolarHBondContact O-N 3.48Å; S4-L7 PolarHBondContact O-N 2.81Å; S4-A8 PolarHBondContact O-N 3.04Å
5	F	90.4	Very high	86.2	Confident	135 Å²	135	119.2 Å²	119.2	59%	0.592	58%	0.58	S	S	*	*	H	α-helix	trans	-62.8	-47.6	175.1	178	-98.1	0	0	0	111.8	M1 F2 L7 A8 F9	M1-F5 PolarHBondContact O-N 2.86Å; F2-F5 WeakPolarHBondContact O-CB 3.45Å; F2-F5 PolarHBondContact O-N 3.42Å; F5-L7 VanDerWaalsContact C-N 3.32Å; F5-L7 PolarHBondContact O-N 3.29Å; F5-A8 PolarHBondContact O-N 2.78Å; F5-F9 WeakPolarHBondContact O-CB 3.42Å; F5-F9 PolarHBondContact O-N 2.67Å
6	M	88.7	Confident	85.7	Confident	95 Å²	95	117.1 Å²	117.1	47%	0.468	58%	0.576	S	S	.	*	H	α-helix	trans	-58.9	-41	177.4	-79.9	-67.5	-163.5	0	0	112.8	F2 R3 F9 Q10	F2-M6 HydrophobicContact CD1-CG 4.17Å; F2-M6 HydrophobicContact CE1-CE 3.69Å; F2-M6 HydrophobicContact CE1-CG 3.85Å; F2-M6 HydrophobicContact CE2-CE 4.23Å; F2-M6 HydrophobicContact CZ-CE 3.35Å; F2-M6 HydrophobicContact CZ-CG 4.18Å; F2-M6 PolarHBondContact O-N 2.82Å; R3-M6 PolarHBondContact O-N 2.86Å; M6-F9 PolarHBondContact O-N 3.03Å; M6-Q10 WeakPolarHBondContact O-CB 2.84Å; M6-Q10 PolarHBondContact O-N 3.23Å
7	L	91.8	Very high	85.1	Confident	88 Å²	88	116.9 Å²	116.9	46%	0.461	57%	0.573	S	S	.	*	H	α-helix	trans	-67	-39.7	176.6	-73.2	170.2	0	0	0	112.4	R3 S4 F5 Q10 K11	R3-L7 WeakPolarHBondContact O-CG 3.23Å; R3-L7 PolarHBondContact O-N 3.31Å; R3-L7 VanDerWaalsContact O-N 3.13Å; S4-L7 PolarHBondContact O-N 2.81Å; F5-L7 VanDerWaalsContact C-N 3.32Å; F5-L7 PolarHBondContact O-N 3.29Å; L7-Q10 PolarHBondContact O-N 3.39Å; L7-K11 WeakPolarHBondContact O-CG 3.31Å; L7-K11 PolarHBondContact O-N 3.42Å
8	A	89.9	Confident	84.7	Confident	58 Å²	58	118.7 Å²	118.7	48%	0.479	58%	0.577	S	S	.	*	H	α-helix	trans	-64.5	-45.2	175.6	0	0	0	0	0	111.2	S4 F5 Q10 K11 A12	S4-A8 PolarHBondContact O-N 3.04Å; F5-A8 PolarHBondContact O-N 2.78Å; A8-Q10 PolarHBondContact O-N 2.99Å; A8-K11 PolarHBondContact O-N 3.4Å; A8-A12 PolarHBondContact O-N 2.84Å
9	F	83.4	Confident	84.4	Confident	121 Å²	121	119.1 Å²	119.1	53%	0.531	58%	0.578	S	S	.	*	H	α-helix	trans	-61.3	-45.1	175.9	-172.7	-101.1	0	0	0	111.8	F5 M6 K11 A12 C13	F5-F9 WeakPolarHBondContact O-CB 3.42Å; F5-F9 PolarHBondContact O-N 2.67Å; M6-F9 PolarHBondContact O-N 3.03Å; F9-K11 VanDerWaalsContact C-N 3.33Å; F9-K11 PolarHBondContact O-N 3.5Å; F9-A12 PolarHBondContact O-N 2.96Å; F9-C13 VanDerWaalsContact CE1-SG 3.51Å; F9-C13 PolarHBondContact O-N 2.88Å; F9-C13 PolarHBondContact O-SG 2.93Å
10	Q	86	Confident	83.8	Confident	91 Å²	91	120.5 Å²	120.5	43%	0.425	58%	0.578	S	S	.	*	H	α-helix	trans	-60.1	-42.2	176.5	-169.5	-174.5	17.7	0	0	112	M6 L7 A8 R14	M6-Q10 WeakPolarHBondContact O-CB 2.84Å; M6-Q10 PolarHBondContact O-N 3.23Å; L7-Q10 PolarHBondContact O-N 3.39Å; A8-Q10 PolarHBondContact O-N 2.99Å; Q10-R14 WeakPolarHBondContact O-CG 2.94Å; Q10-R14 PolarHBondContact O-N 2.04Å
11	K	88.2	Confident	83.2	Confident	152 Å²	152	118 Å²	118	66%	0.661	57%	0.567	S	S	*	*	H	α-helix	trans	-63.5	-44.6	175.6	-75.9	178.9	179.9	-178.3	0	111.5	L7 A8 F9 R14 Q15	L7-K11 WeakPolarHBondContact O-CG 3.31Å; L7-K11 PolarHBondContact O-N 3.42Å; A8-K11 PolarHBondContact O-N 3.4Å; F9-K11 VanDerWaalsContact C-N 3.33Å; F9-K11 PolarHBondContact O-N 3.5Å; K11-R14 PolarHBondContact O-N 3.03Å; K11-Q15 PolarHBondContact O-N 3.07Å
12	A	86.2	Confident	83.3	Confident	48 Å²	48	112.9 Å²	112.9	40%	0.397	55%	0.545	S	S	.	.	H	α-helix	trans	-60.2	-48.3	177.1	0	0	0	0	0	111.5	A8 F9 R14 Q15 V16	A8-A12 PolarHBondContact O-N 2.84Å; F9-A12 PolarHBondContact O-N 2.96Å; A12-R14 VanDerWaalsContact C-N 3.34Å; A12-R14 PolarHBondContact O-N 2.72Å; A12-Q15 PolarHBondContact O-N 2.8Å; A12-Q15 VanDerWaalsContact O-N 3.09Å; A12-V16 WeakPolarHBondContact O-CG2 3.02Å; A12-V16 PolarHBondContact O-N 3.11Å
13	C	82.7	Confident	82.8	Confident	60 Å²	60	113.4 Å²	113.4	41%	0.405	55%	0.546	S	S	.	.	H	α-helix	trans	-57.6	-44	176.1	-72.7	0	0	0	0	112.2	F9 Q15 V16 H17	F9-C13 VanDerWaalsContact CE1-SG 3.51Å; F9-C13 PolarHBondContact O-N 2.88Å; F9-C13 PolarHBondContact O-SG 2.93Å; C13-Q15 VanDerWaalsContact C-N 3.31Å; C13-Q15 PolarHBondContact O-N 2.65Å; C13-V16 PolarHBondContact O-N 3.48Å; C13-H17 VanDerWaalsContact O-CB 3.28Å; C13-H17 WeakPolarHBondContact O-CB 3.05Å; C13-H17 PolarHBondContact O-N 2.85Å
14	R	84.4	Confident	82.1	Confident	153 Å²	153	110.2 Å²	110.2	58%	0.577	54%	0.535	S	S	*	.	H	α-helix	trans	-62.1	-39.2	176	-72.7	-175.2	-158.1	-169.1	7	112.2	Q10 K11 A12 K18	Q10-R14 WeakPolarHBondContact O-CG 2.94Å; Q10-R14 PolarHBondContact O-N 2.04Å; K11-R14 PolarHBondContact O-N 3.03Å; A12-R14 VanDerWaalsContact C-N 3.34Å; A12-R14 PolarHBondContact O-N 2.72Å; R14-K18 WeakPolarHBondContact O-CG 3.08Å; R14-K18 PolarHBondContact O-N 3.12Å
15	Q	82.7	Confident	81.4	Confident	133 Å²	133	113 Å²	113	62%	0.621	53%	0.534	S	S	*	.	H	α-helix	trans	-70.5	-43.3	-179.3	-169.7	167.6	-14.5	0	0	111.6	K11 A12 C13 H17 K18 Q19	K11-Q15 PolarHBondContact O-N 3.07Å; A12-Q15 PolarHBondContact O-N 2.8Å; A12-Q15 VanDerWaalsContact O-N 3.09Å; C13-Q15 VanDerWaalsContact C-N 3.31Å; C13-Q15 PolarHBondContact O-N 2.65Å; Q15-H17 VanDerWaalsContact C-N 3.35Å; Q15-K18 PolarHBondContact O-N 3.1Å; Q15-Q19 WeakPolarHBondContact O-CG 3.48Å; Q15-Q19 PolarHBondContact O-N 2.62Å
16	V	77.4	Confident	80.8	Confident	85 Å²	85	109.1 Å²	109.1	52%	0.515	52%	0.523	S	S	.	.	H	α-helix	trans	-60.9	-45.3	173.6	174.8	0	0	0	0	110.5	A12 C13 K18 Q19 Y20	A12-V16 WeakPolarHBondContact O-CG2 3.02Å; A12-V16 PolarHBondContact O-N 3.11Å; C13-V16 PolarHBondContact O-N 3.48Å; V16-K18 PolarHBondContact O-N 2.92Å; V16-Q19 PolarHBondContact O-N 3.08Å; V16-Y20 HydrophobicContact CG1-CD2 4.09Å; V16-Y20 HydrophobicContact CG1-CE2 4.47Å; V16-Y20 PolarHBondContact O-N 3.42Å
17	H	76.4	Confident	80.5	Confident	115 Å²	115	108.9 Å²	108.9	53%	0.532	53%	0.527	S	S	.	.	H	α-helix	trans	-62.7	-42	179.2	-166.7	-107.4	0	0	0	112.3	C13 Q15 Q19 Y20 L21	C13-H17 VanDerWaalsContact O-CB 3.28Å; C13-H17 WeakPolarHBondContact O-CB 3.05Å; C13-H17 PolarHBondContact O-N 2.85Å; Q15-H17 VanDerWaalsContact C-N 3.35Å; H17-Q19 PolarHBondContact O-N 3.07Å; H17-Y20 PolarHBondContact O-N 2.91Å; H17-L21 WeakPolarHBondContact CE1-CD1 3.41Å; H17-L21 WeakPolarHBondContact ND1-CD1 3.34Å; H17-L21 WeakPolarHBondContact O-CB 3.47Å; H17-L21 WeakPolarHBondContact O-CG 3.49Å; H17-L21 PolarHBondContact O-N 2.94Å
18	K	78.1	Confident	80	Confident	148 Å²	148	108.9 Å²	108.9	64%	0.643	53%	0.526	S	S	*	.	H	α-helix	trans	-61.5	-42.7	174.4	-79	-177.7	178.3	-172.2	0	112.3	R14 Q15 V16 N22	R14-K18 WeakPolarHBondContact O-CG 3.08Å; R14-K18 PolarHBondContact O-N 3.12Å; Q15-K18 PolarHBondContact O-N 3.1Å; V16-K18 PolarHBondContact O-N 2.92Å; K18-N22 VanDerWaalsContact O-CB 3.28Å; K18-N22 WeakPolarHBondContact O-CB 3.48Å; K18-N22 PolarHBondContact O-N 3.3Å
19	Q	77.8	Confident	79.5	Confident	127 Å²	127	110.3 Å²	110.3	59%	0.593	53%	0.529	S	S	*	.	H	α-helix	trans	-65.1	-43.9	178	-72.2	-71.6	5.7	0	0	111.7	Q15 V16 H17 K23	Q15-Q19 WeakPolarHBondContact O-CG 3.48Å; Q15-Q19 PolarHBondContact O-N 2.62Å; V16-Q19 PolarHBondContact O-N 3.08Å; H17-Q19 PolarHBondContact O-N 3.07Å; Q19-K23 WeakPolarHBondContact O-CB 3.43Å; Q19-K23 PolarHBondContact O-N 2.69Å
20	Y	73.1	Confident	79.5	Confident	147 Å²	147	112.8 Å²	112.8	58%	0.576	54%	0.536	S	S	*	.	H	α-helix	trans	-60	-55.9	175.6	-105.1	-101.4	0	0	0	111.1	V16 H17 N22 K23 Y24	V16-Y20 HydrophobicContact CG1-CD2 4.09Å; V16-Y20 HydrophobicContact CG1-CE2 4.47Å; V16-Y20 PolarHBondContact O-N 3.42Å; H17-Y20 PolarHBondContact O-N 2.91Å; Y20-N22 VanDerWaalsContact C-N 3.34Å; Y20-N22 PolarHBondContact O-N 3.48Å; Y20-K23 PolarHBondContact O-N 3.12Å; Y20-K23 VanDerWaalsContact O-N 3.15Å; Y20-Y24 HydrophobicContact CD1-CD2 4.17Å; Y20-Y24 AromaticContact CD1-CE2 3.56Å; Y20-Y24 HydrophobicContact CD1-CE2 3.56Å; Y20-Y24 AromaticContact CE1-CE2 3.88Å; Y20-Y24 HydrophobicContact CE1-CE2 3.88Å; Y20-Y24 VanDerWaalsContact O-CD2 3.22Å; Y20-Y24 WeakPolarHBondContact O-CD2 3.47Å; Y20-Y24 PolarHBondContact O-N 3.25Å
21	L	71.2	Confident	79.4	Confident	67 Å²	67	114.2 Å²	114.2	35%	0.351	54%	0.542	S	S	.	.	H	α-helix	trans	-57.2	-47.7	179.7	-74.2	-179.2	0	0	0	111.2	H17 K23 Y24 Y25	H17-L21 WeakPolarHBondContact CE1-CD1 3.41Å; H17-L21 WeakPolarHBondContact ND1-CD1 3.34Å; H17-L21 WeakPolarHBondContact O-CB 3.47Å; H17-L21 WeakPolarHBondContact O-CG 3.49Å; H17-L21 PolarHBondContact O-N 2.94Å; L21-K23 VanDerWaalsContact C-N 3.29Å; L21-K23 PolarHBondContact O-N 3.5Å; L21-Y24 PolarHBondContact O-N 2.76Å; L21-Y25 HydrophobicContact CB-CD2 3.9Å; L21-Y25 HydrophobicContact CB-CE2 3.97Å; L21-Y25 HydrophobicContact CD1-CE2 4.45Å; L21-Y25 HydrophobicContact CD2-CD2 4.42Å; L21-Y25 HydrophobicContact CD2-CE2 3.83Å; L21-Y25 HydrophobicContact CG-CE2 4.3Å; L21-Y25 VanDerWaalsContact O-CB 3.31Å; L21-Y25 WeakPolarHBondContact O-CB 3.32Å; L21-Y25 WeakPolarHBondContact O-CD2 3.47Å; L21-Y25 PolarHBondContact O-N 2.97Å
22	N	75.8	Confident	79.3	Confident	109 Å²	109	111.6 Å²	111.6	58%	0.583	53%	0.534	S	S	*	.	H	α-helix	trans	-59.6	-39.2	179.2	-82.5	-7	0	0	0	112.7	K18 Y20 S26	K18-N22 VanDerWaalsContact O-CB 3.28Å; K18-N22 WeakPolarHBondContact O-CB 3.48Å; K18-N22 PolarHBondContact O-N 3.3Å; Y20-N22 VanDerWaalsContact C-N 3.34Å; Y20-N22 PolarHBondContact O-N 3.48Å; N22-S26 WeakPolarHBondContact O-CB 3.39Å; N22-S26 PolarHBondContact O-N 3.13Å
23	K	74.5	Confident	79.1	Confident	155 Å²	155	111.4 Å²	111.4	67%	0.674	53%	0.532	S	S	*	.	H	α-helix	trans	-65.5	-46.5	177.9	-169.5	176.3	179.4	-179.7	0	111.5	Q19 Y20 L21 V27	Q19-K23 WeakPolarHBondContact O-CB 3.43Å; Q19-K23 PolarHBondContact O-N 2.69Å; Y20-K23 PolarHBondContact O-N 3.12Å; Y20-K23 VanDerWaalsContact O-N 3.15Å; L21-K23 VanDerWaalsContact C-N 3.29Å; L21-K23 PolarHBondContact O-N 3.5Å; K23-V27 VanDerWaalsContact O-CG2 3.29Å; K23-V27 WeakPolarHBondContact O-CG2 3.45Å; K23-V27 PolarHBondContact O-N 3.42Å; K23-V27 VanDerWaalsContact O-N 3.12Å
24	Y	74.3	Confident	79.4	Confident	142 Å²	142	114.7 Å²	114.7	56%	0.557	54%	0.54	S	S	*	.	H	α-helix	trans	-69.5	-45.4	178.8	-76.2	-78.7	0	0	0	112.4	Y20 L21 S26 V27 I28	Y20-Y24 HydrophobicContact CD1-CD2 4.17Å; Y20-Y24 AromaticContact CD1-CE2 3.56Å; Y20-Y24 HydrophobicContact CD1-CE2 3.56Å; Y20-Y24 AromaticContact CE1-CE2 3.88Å; Y20-Y24 HydrophobicContact CE1-CE2 3.88Å; Y20-Y24 VanDerWaalsContact O-CD2 3.22Å; Y20-Y24 WeakPolarHBondContact O-CD2 3.47Å; Y20-Y24 PolarHBondContact O-N 3.25Å; L21-Y24 PolarHBondContact O-N 2.76Å; Y24-S26 VanDerWaalsContact C-N 3.32Å; Y24-S26 PolarHBondContact O-N 3.2Å; Y24-V27 PolarHBondContact O-N 3.29Å; Y24-I28 WeakPolarHBondContact O-CB 3.49Å; Y24-I28 WeakPolarHBondContact O-CD1 3.44Å; Y24-I28 WeakPolarHBondContact O-CG1 3.29Å; Y24-I28 PolarHBondContact O-N 3.44Å
25	Y	76.9	Confident	79.5	Confident	145 Å²	145	111.1 Å²	111.1	57%	0.569	53%	0.532	S	S	*	.	H	α-helix	trans	-59.5	-44.4	176.1	-82.7	-66.6	0	0	0	111.2	L21 V27 I28 T29	L21-Y25 HydrophobicContact CB-CD2 3.9Å; L21-Y25 HydrophobicContact CB-CE2 3.97Å; L21-Y25 HydrophobicContact CD1-CE2 4.45Å; L21-Y25 HydrophobicContact CD2-CD2 4.42Å; L21-Y25 HydrophobicContact CD2-CE2 3.83Å; L21-Y25 HydrophobicContact CG-CE2 4.3Å; L21-Y25 VanDerWaalsContact O-CB 3.31Å; L21-Y25 WeakPolarHBondContact O-CB 3.32Å; L21-Y25 WeakPolarHBondContact O-CD2 3.47Å; L21-Y25 PolarHBondContact O-N 2.97Å; Y25-V27 PolarHBondContact O-N 3.05Å; Y25-I28 PolarHBondContact O-N 3.08Å; Y25-T29 WeakPolarHBondContact O-CB 3.28Å; Y25-T29 PolarHBondContact O-N 2.88Å; Y25-T29 PolarHBondContact O-OG1 3.01Å
26	S	78.1	Confident	79.5	Confident	52 Å²	52	108.8 Å²	108.8	36%	0.364	53%	0.527	S	S	.	.	H	α-helix	trans	-57	-51.6	176.3	-177.4	0	0	0	0	111.2	N22 Y24 I28 T29 Y30	N22-S26 WeakPolarHBondContact O-CB 3.39Å; N22-S26 PolarHBondContact O-N 3.13Å; Y24-S26 VanDerWaalsContact C-N 3.32Å; Y24-S26 PolarHBondContact O-N 3.2Å; S26-I28 PolarHBondContact O-N 3.26Å; S26-T29 PolarHBondContact O-N 2.85Å; S26-Y30 WeakPolarHBondContact O-CD2 3.4Å; S26-Y30 PolarHBondContact O-N 3.49Å; S26-Y30 VanDerWaalsContact OG-CE2 3.24Å; S26-Y30 WeakPolarHBondContact OG-CE2 3.33Å
27	V	81.6	Confident	79.7	Confident	91 Å²	91	111.5 Å²	111.5	55%	0.552	53%	0.532	S	S	*	.	H	α-helix	trans	-60.3	-44.9	178.1	174.2	0	0	0	0	111.9	K23 Y24 Y25 Y30 F31	K23-V27 VanDerWaalsContact O-CG2 3.29Å; K23-V27 WeakPolarHBondContact O-CG2 3.45Å; K23-V27 PolarHBondContact O-N 3.42Å; K23-V27 VanDerWaalsContact O-N 3.12Å; Y24-V27 PolarHBondContact O-N 3.29Å; Y25-V27 PolarHBondContact O-N 3.05Å; V27-Y30 PolarHBondContact O-N 3.29Å; V27-F31 WeakPolarHBondContact O-CB 3.24Å; V27-F31 PolarHBondContact O-N 3.26Å
28	I	81.8	Confident	80	Confident	87 Å²	87	111.4 Å²	111.4	45%	0.446	53%	0.53	S	S	.	.	H	α-helix	trans	-63.4	-43.9	178.7	-67.9	165	0	0	0	110.7	Y24 Y25 S26 F31 L32	Y24-I28 WeakPolarHBondContact O-CB 3.49Å; Y24-I28 WeakPolarHBondContact O-CD1 3.44Å; Y24-I28 WeakPolarHBondContact O-CG1 3.29Å; Y24-I28 PolarHBondContact O-N 3.44Å; Y25-I28 PolarHBondContact O-N 3.08Å; S26-I28 PolarHBondContact O-N 3.26Å; I28-F31 PolarHBondContact O-N 3.43Å; I28-L32 HydrophobicContact CG2-CD1 3.83Å; I28-L32 HydrophobicContact CG2-CG 4.34Å; I28-L32 WeakPolarHBondContact O-CB 3.33Å; I28-L32 WeakPolarHBondContact O-CG 3.01Å; I28-L32 PolarHBondContact O-N 3.37Å
29	T	79.1	Confident	80.2	Confident	89 Å²	89	106.7 Å²	106.7	55%	0.546	52%	0.519	S	S	.	.	H	α-helix	trans	-64.9	-42.4	178.3	-58.5	0	0	0	0	111.4	Y25 S26 L32 A33	Y25-T29 WeakPolarHBondContact O-CB 3.28Å; Y25-T29 PolarHBondContact O-N 2.88Å; Y25-T29 PolarHBondContact O-OG1 3.01Å; S26-T29 PolarHBondContact O-N 2.85Å; T29-L32 PolarHBondContact O-N 3.49Å; T29-A33 VanDerWaalsContact O-CB 3.28Å; T29-A33 WeakPolarHBondContact O-CB 3.35Å; T29-A33 PolarHBondContact O-N 3.09Å
30	Y	83.6	Confident	80.2	Confident	172 Å²	172	105.6 Å²	105.6	68%	0.675	52%	0.516	S	S	*	.	H	α-helix	trans	-62.9	-42.1	174.1	-78.2	-64	0	0	0	112	S26 V27 A33 F34	S26-Y30 WeakPolarHBondContact O-CD2 3.4Å; S26-Y30 PolarHBondContact O-N 3.49Å; S26-Y30 VanDerWaalsContact OG-CE2 3.24Å; S26-Y30 WeakPolarHBondContact OG-CE2 3.33Å; V27-Y30 PolarHBondContact O-N 3.29Å; Y30-A33 PolarHBondContact O-N 2.92Å; Y30-F34 WeakPolarHBondContact O-CB 3.29Å; Y30-F34 PolarHBondContact O-N 3.18Å
31	F	84	Confident	80.4	Confident	122 Å²	122	103.1 Å²	103.1	54%	0.535	51%	0.512	S	S	.	.	H	α-helix	trans	-64.4	-45.4	177.5	-176.8	-105.7	0	0	0	112	V27 I28 F34 L35	V27-F31 WeakPolarHBondContact O-CB 3.24Å; V27-F31 PolarHBondContact O-N 3.26Å; I28-F31 PolarHBondContact O-N 3.43Å; F31-F34 WeakPolarHBondContact O-CB 3.47Å; F31-F34 PolarHBondContact O-N 2.89Å; F31-L35 HydrophobicContact CD1-CD1 3.89Å; F31-L35 HydrophobicContact CD1-CG 4.4Å; F31-L35 HydrophobicContact CE1-CD1 3.41Å; F31-L35 VanDerWaalsContact CE1-CD1 3.41Å; F31-L35 HydrophobicContact CE1-CG 4.06Å; F31-L35 HydrophobicContact CZ-CD1 3.89Å; F31-L35 HydrophobicContact CZ-CD2 4.29Å; F31-L35 HydrophobicContact CZ-CG 4.15Å; F31-L35 WeakPolarHBondContact O-CG 3.02Å; F31-L35 PolarHBondContact O-N 2.89Å
32	L	84.9	Confident	80.6	Confident	96 Å²	96	104.8 Å²	104.8	50%	0.503	52%	0.521	S	S	.	.	H	α-helix	trans	-60.7	-46.5	174.5	-75.3	169.2	0	0	0	111.2	I28 T29 F34 L35 T36	I28-L32 HydrophobicContact CG2-CD1 3.83Å; I28-L32 HydrophobicContact CG2-CG 4.34Å; I28-L32 WeakPolarHBondContact O-CB 3.33Å; I28-L32 WeakPolarHBondContact O-CG 3.01Å; I28-L32 PolarHBondContact O-N 3.37Å; T29-L32 PolarHBondContact O-N 3.49Å; L32-F34 VanDerWaalsContact C-N 3.28Å; L32-F34 PolarHBondContact O-N 2.89Å; L32-L35 PolarHBondContact O-N 3.31Å; L32-T36 PolarHBondContact O-N 3.4Å; L32-T36 PolarHBondContact O-OG1 3.36Å
33	A	83.8	Confident	80.2	Confident	44 Å²	44	106 Å²	106	36%	0.364	52%	0.523	S	S	.	.	H	α-helix	trans	-60.9	-38.1	177.2	0	0	0	0	0	112.2	T29 Y30 K37	T29-A33 VanDerWaalsContact O-CB 3.28Å; T29-A33 WeakPolarHBondContact O-CB 3.35Å; T29-A33 PolarHBondContact O-N 3.09Å; Y30-A33 PolarHBondContact O-N 2.92Å; A33-K37 VanDerWaalsContact O-CG 3.32Å; A33-K37 WeakPolarHBondContact O-CG 3.5Å; A33-K37 PolarHBondContact O-N 2.89Å; A33-K37 VanDerWaalsContact O-N 3.09Å
34	F	87.8	Confident	79.9	Confident	129 Å²	129	102.7 Å²	102.7	57%	0.566	52%	0.52	S	S	*	.	H	α-helix	trans	-63.7	-47.6	173.7	177.9	-96.6	0	0	0	111.5	Y30 F31 L32 T36 K37 F38	Y30-F34 WeakPolarHBondContact O-CB 3.29Å; Y30-F34 PolarHBondContact O-N 3.18Å; F31-F34 WeakPolarHBondContact O-CB 3.47Å; F31-F34 PolarHBondContact O-N 2.89Å; L32-F34 VanDerWaalsContact C-N 3.28Å; L32-F34 PolarHBondContact O-N 2.89Å; F34-T36 VanDerWaalsContact C-N 3.35Å; F34-T36 PolarHBondContact O-N 2.91Å; F34-K37 PolarHBondContact O-N 3.26Å; F34-F38 WeakPolarHBondContact O-CB 3.22Å; F34-F38 PolarHBondContact O-N 2.84Å
35	L	87.3	Confident	79.3	Confident	78 Å²	78	103.3 Å²	103.3	41%	0.408	53%	0.525	S	S	.	.	H	α-helix	trans	-59.7	-43.2	176.8	-73.6	178.5	0	0	0	112.2	F31 L32 K37 F38 A39	F31-L35 HydrophobicContact CD1-CD1 3.89Å; F31-L35 HydrophobicContact CD1-CG 4.4Å; F31-L35 HydrophobicContact CE1-CD1 3.41Å; F31-L35 VanDerWaalsContact CE1-CD1 3.41Å; F31-L35 HydrophobicContact CE1-CG 4.06Å; F31-L35 HydrophobicContact CZ-CD1 3.89Å; F31-L35 HydrophobicContact CZ-CD2 4.29Å; F31-L35 HydrophobicContact CZ-CG 4.15Å; F31-L35 WeakPolarHBondContact O-CG 3.02Å; F31-L35 PolarHBondContact O-N 2.89Å; L32-L35 PolarHBondContact O-N 3.31Å; L35-K37 PolarHBondContact O-N 2.89Å; L35-F38 PolarHBondContact O-N 3.4Å; L35-A39 WeakPolarHBondContact O-CB 3.43Å; L35-A39 PolarHBondContact O-N 3.43Å
36	T	82.8	Confident	78.4	Confident	85 Å²	85	100.6 Å²	100.6	52%	0.521	52%	0.524	S	S	.	.	H	α-helix	trans	-63	-43.6	177.9	-42.2	0	0	0	0	111.2	L32 F34 F38 A39 I40	L32-T36 PolarHBondContact O-N 3.4Å; L32-T36 PolarHBondContact O-OG1 3.36Å; F34-T36 VanDerWaalsContact C-N 3.35Å; F34-T36 PolarHBondContact O-N 2.91Å; T36-F38 VanDerWaalsContact C-N 3.34Å; T36-F38 PolarHBondContact O-N 2.91Å; T36-A39 PolarHBondContact O-N 2.87Å; T36-I40 HydrophobicContact CG2-CD1 4.3Å; T36-I40 WeakPolarHBondContact O-CD1 3.31Å; T36-I40 VanDerWaalsContact O-CG1 3.29Å; T36-I40 WeakPolarHBondContact O-CG1 3.28Å; T36-I40 PolarHBondContact O-N 3.31Å; T36-I40 VanDerWaalsContact O-N 3.08Å
37	K	81.7	Confident	77.3	Confident	142 Å²	142	102.8 Å²	102.8	62%	0.617	54%	0.537	S	S	*	.	H	α-helix	trans	-63.3	-41	176.1	-72.7	178	-174	-63.1	0	111.9	A33 F34 L35 I40 L41	A33-K37 VanDerWaalsContact O-CG 3.32Å; A33-K37 WeakPolarHBondContact O-CG 3.5Å; A33-K37 PolarHBondContact O-N 2.89Å; A33-K37 VanDerWaalsContact O-N 3.09Å; F34-K37 PolarHBondContact O-N 3.26Å; L35-K37 PolarHBondContact O-N 2.89Å; K37-I40 PolarHBondContact O-N 3.48Å; K37-L41 WeakPolarHBondContact O-CG 3.11Å; K37-L41 PolarHBondContact O-N 3.28Å
38	F	82.7	Confident	75.9	Confident	113 Å²	113	107.9 Å²	107.9	50%	0.496	55%	0.552	S	S	.	*	H	α-helix	trans	-63.9	-42.6	176.9	-174.4	-97.5	0	0	0	111.8	F34 L35 T36 L41 L42	F34-F38 WeakPolarHBondContact O-CB 3.22Å; F34-F38 PolarHBondContact O-N 2.84Å; L35-F38 PolarHBondContact O-N 3.4Å; T36-F38 VanDerWaalsContact C-N 3.34Å; T36-F38 PolarHBondContact O-N 2.91Å; F38-L41 PolarHBondContact O-N 3.12Å; F38-L42 HydrophobicContact CE1-CD1 4.36Å; F38-L42 HydrophobicContact CZ-CD1 4.4Å; F38-L42 WeakPolarHBondContact O-CB 3.22Å; F38-L42 PolarHBondContact O-N 3.29Å
39	A	80.9	Confident	74.7	Confident	48 Å²	48	108.4 Å²	108.4	40%	0.397	56%	0.559	S	S	.	*	H	α-helix	trans	-61.3	-44.9	176.2	0	0	0	0	0	112.2	L35 T36 L41 L42 E43	L35-A39 WeakPolarHBondContact O-CB 3.43Å; L35-A39 PolarHBondContact O-N 3.43Å; T36-A39 PolarHBondContact O-N 2.87Å; A39-L41 VanDerWaalsContact C-N 3.32Å; A39-L41 PolarHBondContact O-N 3.47Å; A39-L42 WeakPolarHBondContact O-CB 3.36Å; A39-L42 PolarHBondContact O-N 2.81Å; A39-L42 VanDerWaalsContact O-N 3.13Å; A39-E43 PolarHBondContact O-N 3.04Å
40	I	79.1	Confident	73.4	Confident	105 Å²	105	108.1 Å²	108.1	54%	0.538	56%	0.561	S	S	.	*	H	α-helix	trans	-60.7	-42.9	176.4	-65.7	163.1	0	0	0	110.9	T36 K37 E43 S44	T36-I40 HydrophobicContact CG2-CD1 4.3Å; T36-I40 WeakPolarHBondContact O-CD1 3.31Å; T36-I40 VanDerWaalsContact O-CG1 3.29Å; T36-I40 WeakPolarHBondContact O-CG1 3.28Å; T36-I40 PolarHBondContact O-N 3.31Å; T36-I40 VanDerWaalsContact O-N 3.08Å; K37-I40 PolarHBondContact O-N 3.48Å; I40-E43 PolarHBondContact O-N 3.15Å; I40-S44 PolarHBondContact O-N 2.78Å; I40-S44 VanDerWaalsContact O-N 3.07Å
41	L	76.3	Confident	71.9	Confident	95 Å²	95	105.3 Å²	105.3	50%	0.497	56%	0.562	S	S	.	*	H	α-helix	trans	-63.2	-43.7	174.9	-73.2	169.5	0	0	0	110.9	K37 F38 A39 E43 S44 F45	K37-L41 WeakPolarHBondContact O-CG 3.11Å; K37-L41 PolarHBondContact O-N 3.28Å; F38-L41 PolarHBondContact O-N 3.12Å; A39-L41 VanDerWaalsContact C-N 3.32Å; A39-L41 PolarHBondContact O-N 3.47Å; L41-E43 VanDerWaalsContact C-N 3.33Å; L41-E43 PolarHBondContact O-N 3.3Å; L41-S44 CarbonylContact O-C 3.58Å; L41-S44 WeakPolarHBondContact O-CA 3.31Å; L41-S44 WeakPolarHBondContact O-CB 3.48Å; L41-S44 PolarHBondContact O-N 3.43Å; L41-S44 VanDerWaalsContact O-N 3.08Å; L41-S44 PolarHBondContact O-OG 3.06Å; L41-F45 HydrophobicContact CB-CE2 4.48Å; L41-F45 WeakPolarHBondContact O-CD2 3.4Å; L41-F45 PolarHBondContact O-N 3.25Å
42	L	75.3	Confident	70.5	Confident	101 Å²	101	104 Å²	104	53%	0.529	57%	0.565	S	S	.	*	H	α-helix	trans	-62.3	-40.4	179.9	-159.5	77.1	0	0	0	111.9	F38 A39 S44 F45 T46	F38-L42 HydrophobicContact CE1-CD1 4.36Å; F38-L42 HydrophobicContact CZ-CD1 4.4Å; F38-L42 WeakPolarHBondContact O-CB 3.22Å; F38-L42 PolarHBondContact O-N 3.29Å; A39-L42 WeakPolarHBondContact O-CB 3.36Å; A39-L42 PolarHBondContact O-N 2.81Å; A39-L42 VanDerWaalsContact O-N 3.13Å; L42-S44 VanDerWaalsContact C-N 3.34Å; L42-F45 CarbonylContact O-C 3.43Å; L42-F45 WeakPolarHBondContact O-CA 3.4Å; L42-F45 PolarHBondContact O-N 2.91Å; L42-F45 VanDerWaalsContact O-N 3.1Å; L42-T46 PolarHBondContact O-N 2.91Å
43	E	66.8	Low	69	Low	134 Å²	134	104.3 Å²	104.3	63%	0.626	57%	0.573	S	S	*	*	H	α-helix	trans	-61.3	-41.8	171.9	-75.2	-176.4	171.6	0	0	111.7	A39 I40 L41 F45 T46	A39-E43 PolarHBondContact O-N 3.04Å; I40-E43 PolarHBondContact O-N 3.15Å; L41-E43 VanDerWaalsContact C-N 3.33Å; L41-E43 PolarHBondContact O-N 3.3Å; E43-F45 PolarHBondContact O-N 3.37Å; E43-T46 PolarHBondContact O-N 2.91Å; E43-T46 VanDerWaalsContact O-N 3.12Å; E43-T46 PolarHBondContact O-OG1 3.4Å
44	S	68.3	Low	67.4	Low	87 Å²	87	110.1 Å²	110.1	61%	0.608	60%	0.597	S	S	*	*	H	α-helix	trans	-65	-26.3	174.1	75.9	0	0	0	0	113.3	I40 L41 L42	I40-S44 PolarHBondContact O-N 2.78Å; I40-S44 VanDerWaalsContact O-N 3.07Å; L41-S44 CarbonylContact O-C 3.58Å; L41-S44 WeakPolarHBondContact O-CA 3.31Å; L41-S44 WeakPolarHBondContact O-CB 3.48Å; L41-S44 PolarHBondContact O-N 3.43Å; L41-S44 VanDerWaalsContact O-N 3.08Å; L41-S44 PolarHBondContact O-OG 3.06Å; L42-S44 VanDerWaalsContact C-N 3.34Å
45	F	61.9	Low	65.6	Low	154 Å²	154	108.4 Å²	108.4	68%	0.675	60%	0.597	S	S	*	*	H	α-helix	trans	-87	-10.4	175.1	-78.7	-65.9	0	0	0	113.7	L41 L42 E43 P47	L41-F45 HydrophobicContact CB-CE2 4.48Å; L41-F45 WeakPolarHBondContact O-CD2 3.4Å; L41-F45 PolarHBondContact O-N 3.25Å; L42-F45 CarbonylContact O-C 3.43Å; L42-F45 WeakPolarHBondContact O-CA 3.4Å; L42-F45 PolarHBondContact O-N 2.91Å; L42-F45 VanDerWaalsContact O-N 3.1Å; E43-F45 PolarHBondContact O-N 3.37Å; F45-P47 VanDerWaalsContact C-N 3.31Å; F45-P47 WeakPolarHBondContact O-CD 3.28Å
46	T	58.6	Low	63.6	Low	88 Å²	88	110 Å²	110	54%	0.54	62%	0.615	S	S	.	*	S	Bend	trans	-58.6	104	169.2	55.9	0	0	0	0	105.8	L42 E43 F48	L42-T46 PolarHBondContact O-N 2.91Å; E43-T46 PolarHBondContact O-N 2.91Å; E43-T46 VanDerWaalsContact O-N 3.12Å; E43-T46 PolarHBondContact O-OG1 3.4Å; T46-F48 PolarHBondContact O-N 3.05Å
47	P	56.1	Low	62.1	Low	99 Å²	99	111 Å²	111	64%	0.643	62%	0.621	S	S	*	*			trans	-67.4	119.5	178	32.7	-28.5	0	0	0	101	F45 V49	F45-P47 VanDerWaalsContact C-N 3.31Å; F45-P47 WeakPolarHBondContact O-CD 3.28Å; P47-V49 HydrophobicContact CB-CG2 3.72Å; P47-V49 HydrophobicContact CG-CG2 3.81Å; P47-V49 PolarHBondContact O-N 3.23Å
48	F	52.3	Low	60.4	Low	198 Å²	198	109.3 Å²	109.3	87%	0.868	63%	0.625	S	S	*	*			trans	-63.8	60.5	159.8	-125.1	-90.5	0	0	0	105.8	T46 S50	T46-F48 PolarHBondContact O-N 3.05Å; F48-S50 PolarHBondContact O-N 3.49Å; F48-S50 PolarHBondContact O-OG 2.92Å
49	V	55.6	Low	58.6	Low	97 Å²	97	111.5 Å²	111.5	59%	0.588	64%	0.64	S	S	*	*			trans	-66.5	81.7	149.9	-171.5	0	0	0	0	101.1	P47 T51	P47-V49 HydrophobicContact CB-CG2 3.72Å; P47-V49 HydrophobicContact CG-CG2 3.81Å; P47-V49 PolarHBondContact O-N 3.23Å; V49-T51 HydrophobicContact CG1-CG2 4.48Å; V49-T51 PolarHBondContact O-N 2.89Å
50	S	51.8	Low	56.7	Low	84 Å²	84	114.4 Å²	114.4	59%	0.587	65%	0.653	S	S	*	*				-27.7	84.6	122.4	38.2	0	0	0	0	107.7	F48 P52	F48-S50 PolarHBondContact O-N 3.49Å; F48-S50 PolarHBondContact O-OG 2.92Å; S50-P52 VanDerWaalsContact C-CD 3.43Å; S50-P52 WeakPolarHBondContact O-CD 3.38Å; S50-P52 VanDerWaalsContact O-N 3.12Å
51	T	52.3	Low	54.9	Low	113 Å²	113	114.6 Å²	114.6	69%	0.693	66%	0.661	S	S	*	*			trans	-58.4	99.9	137.6	35.1	0	0	0	0	102.3	V49 P53	V49-T51 HydrophobicContact CG1-CG2 4.48Å; V49-T51 PolarHBondContact O-N 2.89Å; T51-P53 VanDerWaalsContact O-N 3.15Å
52	P	53.8	Low	53.3	Low	93 Å²	93	118.2 Å²	118.2	60%	0.604	67%	0.673	S	S	*	*			trans	-51.6	130.1	162.3	25.2	-33.3	0	0	0	104.2	S50 L54	S50-P52 VanDerWaalsContact C-CD 3.43Å; S50-P52 WeakPolarHBondContact O-CD 3.38Å; S50-P52 VanDerWaalsContact O-N 3.12Å; P52-L54 PolarHBondContact O-N 3.45Å
53	P	53.1	Low	51.5	Low	103 Å²	103	120.1 Å²	120.1	67%	0.669	68%	0.684	S	S	*	*			trans	-50.4	124.4	167	23.6	-31.4	0	0	0	104.8	T51 T55	T51-P53 VanDerWaalsContact O-N 3.15Å; P53-T55 WeakPolarHBondContact CB-OG1 3.38Å; P53-T55 PolarHBondContact O-N 3.39Å; P53-T55 PolarHBondContact O-OG1 2.99Å
54	L	50.9	Low	50.4	Low	167 Å²	167	121.6 Å²	121.6	87%	0.874	70%	0.695	S	S	*	*			trans	-65.5	66.4	166.5	-79.7	89.7	0	0	0	106.2	P52 S56	P52-L54 PolarHBondContact O-N 3.45Å; L54-S56 PolarHBondContact O-N 2.9Å
55	T	49.5	Very low	49.1	Very low	92 Å²	92	123 Å²	123	56%	0.564	71%	0.705	S	S	*	*			trans	-80	86.2	168.5	-28.3	0	0	0	0	103.4	P53 T57	P53-T55 WeakPolarHBondContact CB-OG1 3.38Å; P53-T55 PolarHBondContact O-N 3.39Å; P53-T55 PolarHBondContact O-OG1 2.99Å; T55-T57 HydrophobicContact CG2-CG2 4.44Å; T55-T57 PolarHBondContact O-N 3.47Å; T55-T57 PolarHBondContact O-OG1 2.9Å
56	S	46.2	Very low	48.5	Very low	111 Å²	111	119.4 Å²	119.4	78%	0.776	70%	0.704	S	S	*	*			trans	-61.5	69.2	162.2	54.9	0	0	0	0	108.5	L54 P58	L54-S56 PolarHBondContact O-N 2.9Å; S56-P58 VanDerWaalsContact O-CD 3.31Å; S56-P58 WeakPolarHBondContact O-CD 3.4Å
57	T	51.4	Low	47.8	Very low	107 Å²	107	119.3 Å²	119.3	66%	0.656	71%	0.707	S	S	*	*			trans	-85.3	109.6	165.2	19.2	0	0	0	0	106.7	T55 I59	T55-T57 HydrophobicContact CG2-CG2 4.44Å; T55-T57 PolarHBondContact O-N 3.47Å; T55-T57 PolarHBondContact O-OG1 2.9Å; T57-I59 PolarHBondContact O-N 3Å
58	P	46.3	Very low	47.4	Very low	106 Å²	106	120.5 Å²	120.5	69%	0.688	71%	0.714	S	S	*	*			trans	-58.3	130.1	179.5	22.3	-30.9	0	0	0	109.1	S56 T60	S56-P58 VanDerWaalsContact O-CD 3.31Å; S56-P58 WeakPolarHBondContact O-CD 3.4Å; P58-T60 VanDerWaalsContact C-N 3.26Å; P58-T60 PolarHBondContact O-N 3.42Å
59	I	45.1	Very low	47.1	Very low	160 Å²	160	116.8 Å²	116.8	82%	0.821	71%	0.708	S	S	*	*			trans	-62.4	91.3	173.3	-56.1	166.8	0	0	0	106.4	T57 P61	T57-I59 PolarHBondContact O-N 3Å; I59-P61 VanDerWaalsContact O-CD 3.23Å; I59-P61 WeakPolarHBondContact O-CD 3.5Å
60	T	40	Very low	46.7	Very low	108 Å²	108	120 Å²	120	66%	0.663	72%	0.715	S	S	*	*			trans	-92	104	160.3	45.9	0	0	0	0	106.9	P58 F62	P58-T60 VanDerWaalsContact C-N 3.26Å; P58-T60 PolarHBondContact O-N 3.42Å; T60-F62 PolarHBondContact O-N 2.87Å
61	P	41.9	Very low	46.4	Very low	110 Å²	110	121.8 Å²	121.8	71%	0.714	73%	0.727	S	S	*	*			trans	-77.1	70.8	175.1	33	-33.7	0	0	0	108.8	I59	I59-P61 VanDerWaalsContact O-CD 3.23Å; I59-P61 WeakPolarHBondContact O-CD 3.5Å
62	F	42	Very low	45.8	Very low	170 Å²	170	119.8 Å²	119.8	75%	0.746	73%	0.728	S	S	*	*			trans	-125.6	97.9	169.3	-87.5	-83.2	0	0	0	109.2	T60 L64	T60-F62 PolarHBondContact O-N 2.87Å; F62-L64 PolarHBondContact O-N 3.37Å
63	N	37.7	Very low	45.4	Very low	142 Å²	142	120.2 Å²	120.2	76%	0.759	73%	0.729	S	S	*	*			trans	43.9	77.5	142.2	-77.2	-44.8	0	0	0	117.2
64	L	44	Very low	45.1	Very low	165 Å²	165	120.1 Å²	120.1	86%	0.864	73%	0.731	S	S	*	*			trans	-128.2	76.8	143.4	-74.7	173.2	0	0	0	108.8	F62 A66	F62-L64 PolarHBondContact O-N 3.37Å; L64-A66 PolarHBondContact O-N 3.09Å
65	S	41.6	Very low	45	Very low	116 Å²	116	117.7 Å²	117.7	81%	0.811	73%	0.725	S	S	*	*			trans	-52.7	77.3	142.5	157.9	0	0	0	0	108.5
66	A	48	Very low	45	Very low	79 Å²	79	118.2 Å²	118.2	65%	0.653	73%	0.73	S	S	*	*			trans	-105.4	84.4	157.8	0	0	0	0	0	105.2	L64 P68	L64-A66 PolarHBondContact O-N 3.09Å; A66-P68 WeakPolarHBondContact O-CD 3.37Å
67	S	44.6	Very low	45.2	Very low	86 Å²	86	117.7 Å²	117.7	60%	0.601	73%	0.732	S	S	*	*			trans	-56.3	124.9	170.3	60.1	0	0	0	0	107.6	T69	S67-T69 VanDerWaalsContact C-N 3.33Å; S67-T69 PolarHBondContact O-N 2.92Å; S67-T69 PolarHBondContact O-OG1 3.3Å
68	P	48.5	Very low	44.7	Very low	123 Å²	123	119 Å²	119	80%	0.799	74%	0.736	S	S	*	*			trans	-70.2	95.8	176.8	27.3	-31.2	0	0	0	108.1	A66 F70	A66-P68 WeakPolarHBondContact O-CD 3.37Å; P68-F70 PolarHBondContact O-N 3.06Å
69	T	44.1	Very low	44.7	Very low	120 Å²	120	119.9 Å²	119.9	74%	0.736	73%	0.733	S	S	*	*			trans	-70.5	78.4	168	-19.5	0	0	0	0	107.5	S67	S67-T69 VanDerWaalsContact C-N 3.33Å; S67-T69 PolarHBondContact O-N 2.92Å; S67-T69 PolarHBondContact O-OG1 3.3Å
70	F	47.5	Very low	44.5	Very low	166 Å²	166	120.7 Å²	120.7	73%	0.728	73%	0.731	S	S	*	*			trans	-114.6	49.2	167.7	-129.6	-96.7	0	0	0	109.9	P68 G72 V73	P68-F70 PolarHBondContact O-N 3.06Å; F70-G72 PolarHBondContact O-N 3.43Å; F70-V73 HydrophobicContact CD1-CG2 4.19Å; F70-V73 HydrophobicContact CE1-CB 3.94Å; F70-V73 HydrophobicContact CE1-CG2 3.48Å; F70-V73 VanDerWaalsContact CE1-CG2 3.48Å; F70-V73 HydrophobicContact CZ-CG2 4.02Å
71	S	45.3	Very low	44.4	Very low	121 Å²	121	118.5 Å²	118.5	85%	0.846	72%	0.719	S	S	*	*			trans	-71.9	105.3	157.5	-70.2	0	0	0	0	107.6
72	G	40.9	Very low	44.4	Very low	70 Å²	70	121.9 Å²	121.9	72%	0.722	72%	0.722	S	S	*	*	S	Bend	trans	141.5	-4.6	155.5	0	0	0	0	0	118.5	F70	F70-G72 PolarHBondContact O-N 3.43Å
73	V	45.7	Very low	44.5	Very low	102 Å²	102	121.2 Å²	121.2	62%	0.618	73%	0.726	S	S	*	*			trans	-131.7	88.3	176.1	-128.5	0	0	0	0	109.5	F70	F70-V73 HydrophobicContact CD1-CG2 4.19Å; F70-V73 HydrophobicContact CE1-CB 3.94Å; F70-V73 HydrophobicContact CE1-CG2 3.48Å; F70-V73 VanDerWaalsContact CE1-CG2 3.48Å; F70-V73 HydrophobicContact CZ-CG2 4.02Å
74	S	46	Very low	44.7	Very low	102 Å²	102	118.6 Å²	118.6	71%	0.713	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-52.1	129.3	163.9	44	0	0	0	0	108.4
75	P	48.2	Very low	44.8	Very low	115 Å²	115	114 Å²	114	75%	0.747	71%	0.712	S	S	*	*	P	Polyproline II helix	trans	-55.3	133.5	178.3	21.1	-30.4	0	0	0	108.9	A77	P75-A77 PolarHBondContact O-N 3.38Å
76	P	50.5	Low	45	Very low	104 Å²	104	116.7 Å²	116.7	68%	0.675	72%	0.716	S	S	*	*	P	Polyproline II helix	trans	-54.1	119.4	-175.9	18.5	-29.7	0	0	0	109.2	N78	P76-N78 PolarHBondContact O-N 2.89Å
77	A	49.9	Very low	44.7	Very low	99 Å²	99	116.5 Å²	116.5	82%	0.818	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	114	-177.3	0	0	0	0	0	109	P75 I79	P75-A77 PolarHBondContact O-N 3.38Å; A77-I79 PolarHBondContact O-N 3.2Å
78	N	42.3	Very low	44.5	Very low	136 Å²	136	116.1 Å²	116.1	73%	0.727	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	61.5	56.1	155	-151.1	-11	0	0	0	114.2	P76 K80	P76-N78 PolarHBondContact O-N 2.89Å; N78-K80 VanDerWaalsContact C-N 3.3Å; N78-K80 PolarHBondContact O-N 3.27Å
79	I	45.8	Very low	44.1	Very low	123 Å²	123	117 Å²	117	63%	0.631	70%	0.703	S	S	*	*			trans	-58.7	100.2	155.9	14.3	171.1	0	0	0	107.2	A77 C81	A77-I79 PolarHBondContact O-N 3.2Å; I79-C81 PolarHBondContact O-N 3.47Å
80	K	40.4	Very low	44.1	Very low	178 Å²	178	116 Å²	116	77%	0.774	70%	0.699	S	S	*	*			trans	-65	84.2	169.9	-76.3	179.2	178.5	174.6	0	107.8	N78 K82	N78-K80 VanDerWaalsContact C-N 3.3Å; N78-K80 PolarHBondContact O-N 3.27Å; K80-K82 PolarHBondContact O-N 3.18Å
81	C	37.4	Very low	43.9	Very low	61 Å²	61	112.2 Å²	112.2	41%	0.412	69%	0.69	S	S	.	*			trans	-63.4	109	167	-111.7	0	0	0	0	107.8	I79 L83 C88	I79-C81 PolarHBondContact O-N 3.47Å; C81-L83 PolarHBondContact O-N 3.5Å; C81-L83 VanDerWaalsContact O-N 3.07Å; C81-C88 HydrophobicContact CB-CB 4.49Å; C81-C88 WeakPolarHBondContact CB-SG 3.49Å; C81-C88 WeakPolarHBondContact SG-CB 3.34Å; C81-C88 CovalentContact SG-SG 2.04Å; C81-C88 PolarHBondContact SG-SG 2.97Å
82	K	43.1	Very low	43.8	Very low	182 Å²	182	114.9 Å²	114.9	79%	0.791	69%	0.689	S	S	*	*			trans	-71.4	103.4	169.7	-165.1	173.1	-176.7	178.8	0	106.4	K80 S84	K80-K82 PolarHBondContact O-N 3.18Å; K82-S84 PolarHBondContact O-N 3.06Å
83	L	43.2	Very low	43.9	Very low	155 Å²	155	116.4 Å²	116.4	81%	0.812	69%	0.688	S	S	*	*			trans	-67.2	76.7	-176.7	-153.3	91.8	0	0	0	110.3	C81 G85	C81-L83 PolarHBondContact O-N 3.5Å; C81-L83 VanDerWaalsContact O-N 3.07Å; L83-G85 PolarHBondContact O-N 3.02Å
84	S	43	Very low	43.7	Very low	88 Å²	88	118.1 Å²	118.1	62%	0.615	69%	0.69	S	S	*	*			trans	-84.8	88.1	168	-76.2	0	0	0	0	108.3	K82 L86 S87	K82-S84 PolarHBondContact O-N 3.06Å; S84-L86 PolarHBondContact O-N 3.5Å; S84-S87 PolarHBondContact O-N 2.89Å
85	G	45.3	Very low	43.7	Very low	69 Å²	69	119.4 Å²	119.4	71%	0.711	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	53.4	48.1	155.3	0	0	0	0	0	118.3	L83	L83-G85 PolarHBondContact O-N 3.02Å
86	L	46.4	Very low	43.3	Very low	171 Å²	171	122.2 Å²	122.2	90%	0.895	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	100	-4.9	172.8	-66.1	128.5	0	0	0	118.3	S84	S84-L86 PolarHBondContact O-N 3.5Å
87	S	40.5	Very low	42.8	Very low	76 Å²	76	126.2 Å²	126.2	53%	0.531	70%	0.697	S	S	.	*			trans	-129.7	116.3	174.2	-75.2	0	0	0	0	112	S84 L89	S84-S87 PolarHBondContact O-N 2.89Å; S87-L89 VanDerWaalsContact C-N 3.29Å; S87-L89 PolarHBondContact O-N 3.48Å
88	C	40.1	Very low	42.4	Very low	78 Å²	78	130.8 Å²	130.8	53%	0.527	70%	0.702	S	S	.	*			trans	-68	90.8	161.5	-96.9	0	0	0	0	107.5	C81 P90	C81-C88 HydrophobicContact CB-CB 4.49Å; C81-C88 WeakPolarHBondContact CB-SG 3.49Å; C81-C88 WeakPolarHBondContact SG-CB 3.34Å; C81-C88 CovalentContact SG-SG 2.04Å; C81-C88 PolarHBondContact SG-SG 2.97Å; C88-P90 WeakPolarHBondContact O-CD 3.41Å
89	L	40.8	Very low	42.3	Very low	140 Å²	140	129.5 Å²	129.5	73%	0.733	70%	0.703	S	S	*	*			trans	-73.9	120.4	162	-101.4	86	0	0	0	107.4	S87 T91	S87-L89 VanDerWaalsContact C-N 3.29Å; S87-L89 PolarHBondContact O-N 3.48Å; L89-T91 PolarHBondContact O-N 3.36Å
90	P	44.9	Very low	42	Very low	99 Å²	99	133.1 Å²	133.1	64%	0.643	71%	0.714	S	S	*	*			trans	-57.8	125.3	165.1	24.8	-30.6	0	0	0	107.2	C88 Q92	C88-P90 WeakPolarHBondContact O-CD 3.41Å; P90-Q92 PolarHBondContact O-N 3.24Å
91	T	42.3	Very low	42.3	Very low	88 Å²	88	130.3 Å²	130.3	54%	0.54	72%	0.718	S	S	.	*			trans	-55.7	116	175.5	20	0	0	0	0	108.1	L89 S93 E94	L89-T91 PolarHBondContact O-N 3.36Å; T91-S93 PolarHBondContact O-N 3.27Å; T91-E94 PolarHBondContact O-N 3.45Å; T91-E94 VanDerWaalsContact O-N 3.11Å
92	Q	44.2	Very low	42.3	Very low	176 Å²	176	132.3 Å²	132.3	82%	0.822	73%	0.732	S	S	*	*	G	3₁₀ helix	trans	-57.6	-10.3	-173.3	-162.6	169	3.5	0	0	113.6	P90 E94	P90-Q92 PolarHBondContact O-N 3.24Å; Q92-E94 VanDerWaalsContact C-N 3.33Å; Q92-E94 PolarHBondContact O-N 3.13Å
93	S	41.9	Very low	42.7	Very low	102 Å²	102	129.5 Å²	129.5	71%	0.713	73%	0.733	S	S	*	*	G	3₁₀ helix	trans	-76.9	-6.2	175.4	52.4	0	0	0	0	115.4	T91	T91-S93 PolarHBondContact O-N 3.27Å
94	E	41.5	Very low	42.6	Very low	139 Å²	139	128.5 Å²	128.5	65%	0.65	73%	0.732	S	S	*	*	G	3₁₀ helix	trans	-111.8	0.5	-178.8	-116.6	175.2	136.5	0	0	115	T91 Q92 E96	T91-E94 PolarHBondContact O-N 3.45Å; T91-E94 VanDerWaalsContact O-N 3.11Å; Q92-E94 VanDerWaalsContact C-N 3.33Å; Q92-E94 PolarHBondContact O-N 3.13Å; E94-E96 PolarHBondContact O-N 3.41Å; E94-E96 VanDerWaalsContact O-N 3.12Å
95	I	46.9	Very low	42.4	Very low	129 Å²	129	129.5 Å²	129.5	66%	0.662	74%	0.737	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.9	-10.3	177.4	-63.8	173.1	0	0	0	111.8
96	E	38.9	Very low	42.3	Very low	173 Å²	173	132.2 Å²	132.2	81%	0.808	74%	0.742	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.4	-4.3	-171.9	-122.1	173.3	129.6	0	0	116.5	E94	E94-E96 PolarHBondContact O-N 3.41Å; E94-E96 VanDerWaalsContact O-N 3.12Å
97	F	40.3	Very low	42.5	Very low	188 Å²	188	129 Å²	129	83%	0.825	74%	0.74	S	S	*	*	S	Bend	trans	-123.9	44.4	-174.3	-81.4	-77.8	0	0	0	115.9
98	Q	40.6	Very low	42.5	Very low	195 Å²	195	131 Å²	131	91%	0.911	75%	0.754	S	S	*	*			trans	-142.4	57.5	153.6	-74	-158.3	5.3	0	0	112
99	S	40.3	Very low	42.6	Very low	109 Å²	109	137 Å²	137	76%	0.762	77%	0.774	S	S	*	*			trans	-74.4	123.4	150.1	178.1	0	0	0	0	108.4
100	K	40.5	Very low	42.5	Very low	199 Å²	199	135.1 Å²	135.1	87%	0.865	77%	0.773	S	S	*	*			trans	76.1	91.1	150.1	-149.3	172.1	-166.3	177.8	0	117.3
101	S	45.4	Very low	42.1	Very low	120 Å²	120	137.5 Å²	137.5	84%	0.839	78%	0.78	S	S	*	*			trans	-133.5	124.9	145.9	68.8	0	0	0	0	110.5
102	S	38.2	Very low	41.8	Very low	103 Å²	103	143.1 Å²	143.1	72%	0.72	80%	0.797	S	S	*	*	P	Polyproline II helix	trans	-73.2	135.9	-177.4	-171.5	0	0	0	0	110	V104	S102-V104 PolarHBondContact O-N 3.24Å
103	P	51.3	Low	41.3	Very low	123 Å²	123	137.8 Å²	137.8	80%	0.799	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-64.2	129.4	170.3	-15.9	29.3	0	0	0	110.4
104	V	41.3	Very low	41.4	Very low	133 Å²	133	140.6 Å²	140.6	81%	0.806	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-75.3	143.1	179.7	170.1	0	0	0	0	110.1	S102	S102-V104 PolarHBondContact O-N 3.24Å
105	P	38.4	Very low	41.6	Very low	109 Å²	109	140.9 Å²	140.9	71%	0.708	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-66.8	155.7	-171.4	23.8	-34.7	0	0	0	115.6
106	P	44.9	Very low	41.2	Very low	126 Å²	126	147.5 Å²	147.5	82%	0.818	83%	0.829	S	S	*	*	P	Polyproline II helix	trans	-66.5	144.9	-173.6	26	-34.2	0	0	0	113.8
107	A	49.6	Very low	41.4	Very low	104 Å²	104	146.2 Å²	146.2	86%	0.86	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-65	133.5	-179.1	0	0	0	0	0	112.1
108	S	41.3	Very low	41.4	Very low	118 Å²	118	144 Å²	144	83%	0.825	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-61.1	137.4	-176.5	-48.1	0	0	0	0	113.4	S110	S108-S110 PolarHBondContact O-N 3.14Å
109	E	41.8	Very low	41.5	Very low	203 Å²	203	141.2 Å²	141.2	95%	0.949	83%	0.826	S	S	*	*	P	Polyproline II helix	trans	-54.5	120.4	171.4	-62.6	171.1	157.2	0	0	110.4
110	S	38	Very low	41.5	Very low	101 Å²	101	143.1 Å²	143.1	71%	0.706	83%	0.829	S	S	*	*			trans	-135.4	107.6	171.9	-162.1	0	0	0	0	110.7	S108	S108-S110 PolarHBondContact O-N 3.14Å
111	N	35.7	Very low	41.6	Very low	149 Å²	149	139.6 Å²	139.6	80%	0.797	83%	0.827	S	S	*	*			trans	63.5	106	146.9	-86.4	-40.5	0	0	0	119.7
112	K	37.4	Very low	41.4	Very low	207 Å²	207	140.9 Å²	140.9	90%	0.9	83%	0.826	S	S	*	*				171.3	108.4	124.1	-99.9	171.5	172.6	-177.3	0	106.1
113	G	33.1	Very low	41.6	Very low	64 Å²	64	143.6 Å²	143.6	66%	0.66	83%	0.834	S	S	*	*				92.6	158.1	76.5	0	0	0	0	0	108.9
114	I	43.4	Very low	40.8	Very low	160 Å²	160	145.2 Å²	145.2	82%	0.821	84%	0.837	S	S	*	*			trans	94	119.4	179.9	-50.6	157.9	0	0	0	111.7
115	N	45.6	Very low	40.8	Very low	146 Å²	146	146.2 Å²	146.2	78%	0.781	84%	0.839	S	S	*	*			cis	-158.5	157.9	-3.4	-98.1	-14.9	0	0	0	106.3
116	E	40.3	Very low	41	Very low	267 Å²	267	149.5 Å²	149.5	100%	1.248	85%	0.851	S	S	*	*			trans	-39.2	0	165.4	-70.8	166.2	104.9	0	0	115.3

Retrieved 116 of 116 residues in 45.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).