FMP49_YEAST Loading...

Protein FMP49, mitochondrial

AlphaFold DB , UniProt , Accession A0A023PZB3, Species YEAST (Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Baker's yeast), Gene FMP49, Length 126 aa.

						>FMP49_YEAST|A0A023PZB3|FMP49
MYYFSRVAARTFCCCIFFCLATAYSRPDRNPRKIEKKDKKFFGASKNTNPANAMGNLFKAPTIEYVVEEVTRTHQPEQYDIPTDMSPLMTIAASESADKFTDKFFVDQSSIMKEKTSSKGNARTLL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.2	Low	53.5	Low	235 Å²	235	149 Å²	149	100%	1.158	72%	0.716	S	S	*	*				0	58.6	0	-81.1	172.1	142.5	0	0	111.6
2	Y	52.5	Low	53.6	Low	202 Å²	202	149.1 Å²	149.1	79%	0.792	71%	0.711	S	S	*	*			trans	-121.3	-9.6	-177.9	-81.7	-80.4	0	0	0	114.7
3	Y	52.6	Low	53.7	Low	209 Å²	209	142.4 Å²	142.4	82%	0.82	69%	0.689	S	S	*	*	H	α-helix	trans	-82.3	-33.1	-177.1	-83.9	-85.5	0	0	0	113.8	S5 R6	Y3-S5 VanDerWaalsContact C-N 3.34Å; Y3-S5 PolarHBondContact O-N 3.32Å; Y3-R6 PolarHBondContact O-N 3.4Å
4	F	51.2	Low	53.8	Low	193 Å²	193	138.7 Å²	138.7	85%	0.846	68%	0.684	S	S	*	*	H	α-helix	trans	-67.1	-33.2	-178.7	-107.7	-89.9	0	0	0	113.3	R6 V7 A8	F4-R6 PolarHBondContact O-N 3.4Å; F4-V7 PolarHBondContact O-N 2.99Å; F4-A8 PolarHBondContact O-N 2.85Å
5	S	56	Low	54	Low	91 Å²	91	134.8 Å²	134.8	64%	0.636	67%	0.674	S	S	*	*	H	α-helix	trans	-71.2	-31.9	-177.5	-155.8	0	0	0	0	113.2	Y3 A9	Y3-S5 VanDerWaalsContact C-N 3.34Å; Y3-S5 PolarHBondContact O-N 3.32Å; S5-A9 PolarHBondContact O-N 3.33Å
6	R	52.6	Low	54.3	Low	204 Å²	204	131.4 Å²	131.4	77%	0.77	66%	0.658	S	S	*	*	H	α-helix	trans	-75.1	-30.1	178.6	-75.9	-170.6	173.5	-176	-1.2	113	Y3 F4 R10	Y3-R6 PolarHBondContact O-N 3.4Å; F4-R6 PolarHBondContact O-N 3.4Å; R6-R10 PolarHBondContact O-N 3.33Å
7	V	54.5	Low	54.4	Low	96 Å²	96	132.4 Å²	132.4	58%	0.582	66%	0.657	S	S	*	*	H	α-helix	trans	-72.1	-41.8	176.8	-179.9	0	0	0	0	110.6	F4 A9 R10 T11	F4-V7 PolarHBondContact O-N 2.99Å; V7-A9 PolarHBondContact O-N 2.73Å; V7-R10 PolarHBondContact O-N 3.37Å; V7-T11 PolarHBondContact O-N 3.34Å; V7-T11 PolarHBondContact O-OG1 3.1Å
8	A	54.8	Low	54.5	Low	54 Å²	54	133.9 Å²	133.9	45%	0.446	66%	0.66	S	S	.	*	H	α-helix	trans	-65.7	-36	176.6	0	0	0	0	0	113.2	F4 T11 F12	F4-A8 PolarHBondContact O-N 2.85Å; A8-T11 PolarHBondContact O-OG1 2.94Å; A8-F12 PolarHBondContact O-N 3.16Å; A8-F12 VanDerWaalsContact O-N 3.16Å
9	A	54.8	Low	54.7	Low	65 Å²	65	131.3 Å²	131.3	54%	0.537	66%	0.655	S	S	.	*	H	α-helix	trans	-67.1	-36.6	176	0	0	0	0	0	112.5	S5 V7 C13	S5-A9 PolarHBondContact O-N 3.33Å; V7-A9 PolarHBondContact O-N 2.73Å; A9-C13 PolarHBondContact O-N 3.39Å
10	R	53.9	Low	54.7	Low	206 Å²	206	129.2 Å²	129.2	78%	0.777	65%	0.645	S	S	*	*	H	α-helix	trans	-68.7	-39.2	177	-98.4	179.6	162.4	157.8	-4	112.8	R6 V7 C14	R6-R10 PolarHBondContact O-N 3.33Å; V7-R10 PolarHBondContact O-N 3.37Å; R10-C14 PolarHBondContact O-N 2.68Å
11	T	54.8	Low	54.6	Low	84 Å²	84	125.9 Å²	125.9	52%	0.515	64%	0.639	S	S	.	*	H	α-helix	trans	-70.1	-36.5	177.6	47.9	0	0	0	0	112.2	V7 A8 C13 C14 C15	V7-T11 PolarHBondContact O-N 3.34Å; V7-T11 PolarHBondContact O-OG1 3.1Å; A8-T11 PolarHBondContact O-OG1 2.94Å; T11-C13 PolarHBondContact O-N 3.28Å; T11-C14 PolarHBondContact O-N 3.48Å; T11-C15 PolarHBondContact O-N 3.37Å; T11-C15 PolarHBondContact O-SG 3.49Å
12	F	54.5	Low	54.8	Low	150 Å²	150	117.6 Å²	117.6	66%	0.658	60%	0.601	S	S	*	*	H	α-helix	trans	-64	-39.4	175.9	-122.3	-92	0	0	0	112.8	A8 C15 I16	A8-F12 PolarHBondContact O-N 3.16Å; A8-F12 VanDerWaalsContact O-N 3.16Å; F12-C15 PolarHBondContact O-N 3.31Å; F12-I16 HydrophobicContact CD1-CD1 4.36Å; F12-I16 WeakPolarHBondContact O-CG1 3.35Å; F12-I16 PolarHBondContact O-N 3.35Å
13	C	54.5	Low	54.9	Low	62 Å²	62	111 Å²	111	42%	0.419	59%	0.588	S	S	.	*	H	α-helix	trans	-62.1	-45.8	178	-167.5	0	0	0	0	111.6	A9 T11 C15 I16 F17	A9-C13 PolarHBondContact O-N 3.39Å; T11-C13 PolarHBondContact O-N 3.28Å; C13-C15 VanDerWaalsContact C-N 3.33Å; C13-C15 PolarHBondContact O-N 3.45Å; C13-I16 PolarHBondContact O-N 3.09Å; C13-F17 VanDerWaalsContact O-CD2 3.3Å; C13-F17 WeakPolarHBondContact O-CD2 3.35Å; C13-F17 PolarHBondContact O-N 3.42Å
14	C	55.5	Low	54.9	Low	91 Å²	91	110.8 Å²	110.8	62%	0.615	59%	0.588	S	S	*	*	H	α-helix	trans	-61.8	-37	177.4	-69.8	0	0	0	0	113.2	R10 T11 F18	R10-C14 PolarHBondContact O-N 2.68Å; T11-C14 PolarHBondContact O-N 3.48Å; C14-F18 PolarHBondContact O-N 3.18Å; C14-F18 VanDerWaalsContact O-N 3.16Å
15	C	56.8	Low	54.9	Low	80 Å²	80	105.5 Å²	105.5	54%	0.541	58%	0.575	S	S	.	*	H	α-helix	trans	-65.8	-38.9	177.4	-69.7	0	0	0	0	112.4	T11 F12 C13 F18 C19	T11-C15 PolarHBondContact O-N 3.37Å; T11-C15 PolarHBondContact O-SG 3.49Å; F12-C15 PolarHBondContact O-N 3.31Å; C13-C15 VanDerWaalsContact C-N 3.33Å; C13-C15 PolarHBondContact O-N 3.45Å; C15-F18 PolarHBondContact O-N 2.92Å; C15-C19 WeakPolarHBondContact O-CB 3.46Å; C15-C19 PolarHBondContact O-N 3.2Å; C15-C19 PolarHBondContact O-SG 2.91Å
16	I	58.6	Low	54.6	Low	81 Å²	81	110.7 Å²	110.7	42%	0.415	58%	0.58	S	S	.	*	H	α-helix	trans	-67.3	-43.3	179.8	-65.5	166.5	0	0	0	110.9	F12 C13 F18 C19 L20	F12-I16 HydrophobicContact CD1-CD1 4.36Å; F12-I16 WeakPolarHBondContact O-CG1 3.35Å; F12-I16 PolarHBondContact O-N 3.35Å; C13-I16 PolarHBondContact O-N 3.09Å; I16-F18 VanDerWaalsContact C-N 3.32Å; I16-F18 PolarHBondContact O-N 3.06Å; I16-C19 PolarHBondContact O-N 3.49Å; I16-L20 HydrophobicContact CG2-CD1 3.86Å; I16-L20 PolarHBondContact O-N 3.4Å
17	F	56.4	Low	54.6	Low	147 Å²	147	105.4 Å²	105.4	65%	0.645	57%	0.572	S	S	*	*	H	α-helix	trans	-61.9	-39.2	176	-83.8	-75.5	0	0	0	112.2	C13 L20 A21	C13-F17 VanDerWaalsContact O-CD2 3.3Å; C13-F17 WeakPolarHBondContact O-CD2 3.35Å; C13-F17 PolarHBondContact O-N 3.42Å; F17-L20 PolarHBondContact O-N 2.66Å; F17-A21 WeakPolarHBondContact O-CB 3.2Å; F17-A21 PolarHBondContact O-N 2.93Å
18	F	56.3	Low	54.5	Low	160 Å²	160	107.9 Å²	107.9	70%	0.702	58%	0.582	S	S	*	*	H	α-helix	trans	-70.3	-35.7	177.2	-144.7	-91.5	0	0	0	112.6	C14 C15 I16 T22	C14-F18 PolarHBondContact O-N 3.18Å; C14-F18 VanDerWaalsContact O-N 3.16Å; C15-F18 PolarHBondContact O-N 2.92Å; I16-F18 VanDerWaalsContact C-N 3.32Å; I16-F18 PolarHBondContact O-N 3.06Å; F18-T22 HydrophobicContact CD1-CG2 4.32Å; F18-T22 HydrophobicContact CE1-CG2 4.38Å; F18-T22 WeakPolarHBondContact O-CG2 3.19Å; F18-T22 PolarHBondContact O-N 2.89Å; F18-T22 VanDerWaalsContact O-N 3.17Å; F18-T22 PolarHBondContact O-OG1 3.49Å
19	C	57	Low	54.5	Low	85 Å²	85	116.2 Å²	116.2	57%	0.574	60%	0.602	S	S	*	*	H	α-helix	trans	-69	-36.7	174.7	-72.1	0	0	0	0	112.9	C15 I16 T22 A23	C15-C19 WeakPolarHBondContact O-CB 3.46Å; C15-C19 PolarHBondContact O-N 3.2Å; C15-C19 PolarHBondContact O-SG 2.91Å; I16-C19 PolarHBondContact O-N 3.49Å; C19-T22 WeakPolarHBondContact CA-OG1 3.44Å; C19-T22 PolarHBondContact O-OG1 3.31Å; C19-T22 VanDerWaalsContact O-OG1 3.05Å; C19-A23 WeakPolarHBondContact O-CB 3.28Å; C19-A23 PolarHBondContact O-N 2.71Å; C19-A23 VanDerWaalsContact O-N 3.1Å
20	L	56.3	Low	54.2	Low	88 Å²	88	117.8 Å²	117.8	46%	0.461	60%	0.602	S	S	.	*	H	α-helix	trans	-70.8	-43.9	176	-76.3	161.9	0	0	0	111.3	I16 F17 T22 A23 Y24	I16-L20 HydrophobicContact CG2-CD1 3.86Å; I16-L20 PolarHBondContact O-N 3.4Å; F17-L20 PolarHBondContact O-N 2.66Å; L20-T22 PolarHBondContact O-N 3.33Å; L20-A23 PolarHBondContact O-N 3.22Å; L20-A23 VanDerWaalsContact O-N 3.11Å; L20-Y24 HydrophobicContact CD2-CE2 4.37Å; L20-Y24 VanDerWaalsContact O-CD2 3.31Å; L20-Y24 WeakPolarHBondContact O-CD2 3.13Å; L20-Y24 PolarHBondContact O-N 3.5Å; L20-Y24 VanDerWaalsContact O-N 3.14Å
21	A	52.4	Low	54.1	Low	61 Å²	61	113.4 Å²	113.4	50%	0.504	60%	0.6	S	S	.	*	H	α-helix	trans	-59	-36.2	176.5	0	0	0	0	0	112.3	F17 S25	F17-A21 WeakPolarHBondContact O-CB 3.2Å; F17-A21 PolarHBondContact O-N 2.93Å; A21-S25 WeakPolarHBondContact O-CB 3.26Å; A21-S25 PolarHBondContact O-N 3.08Å; A21-S25 PolarHBondContact O-OG 2.78Å
22	T	54.8	Low	54	Low	61 Å²	61	118.9 Å²	118.9	37%	0.374	61%	0.611	S	S	.	*	H	α-helix	trans	-80.6	-20	177.6	52.5	0	0	0	0	114.2	F18 C19 L20 S25 R26	F18-T22 HydrophobicContact CD1-CG2 4.32Å; F18-T22 HydrophobicContact CE1-CG2 4.38Å; F18-T22 WeakPolarHBondContact O-CG2 3.19Å; F18-T22 PolarHBondContact O-N 2.89Å; F18-T22 VanDerWaalsContact O-N 3.17Å; F18-T22 PolarHBondContact O-OG1 3.49Å; C19-T22 WeakPolarHBondContact CA-OG1 3.44Å; C19-T22 PolarHBondContact O-OG1 3.31Å; C19-T22 VanDerWaalsContact O-OG1 3.05Å; L20-T22 PolarHBondContact O-N 3.33Å; T22-S25 WeakPolarHBondContact CA-OG 3.34Å; T22-R26 WeakPolarHBondContact O-CG 3.3Å
23	A	54.7	Low	53.9	Low	63 Å²	63	121.4 Å²	121.4	52%	0.521	62%	0.622	S	S	.	*	H	α-helix	trans	-76.8	-39	173.1	0	0	0	0	0	112	C19 L20	C19-A23 WeakPolarHBondContact O-CB 3.28Å; C19-A23 PolarHBondContact O-N 2.71Å; C19-A23 VanDerWaalsContact O-N 3.1Å; L20-A23 PolarHBondContact O-N 3.22Å; L20-A23 VanDerWaalsContact O-N 3.11Å
24	Y	52.1	Low	53.9	Low	204 Å²	204	125.7 Å²	125.7	80%	0.8	64%	0.639	S	S	*	*	H	α-helix	trans	-79.6	-21.3	178.9	-79	-78.3	0	0	0	114.2	L20	L20-Y24 HydrophobicContact CD2-CE2 4.37Å; L20-Y24 VanDerWaalsContact O-CD2 3.31Å; L20-Y24 WeakPolarHBondContact O-CD2 3.13Å; L20-Y24 PolarHBondContact O-N 3.5Å; L20-Y24 VanDerWaalsContact O-N 3.14Å
25	S	52.4	Low	53.8	Low	83 Å²	83	128.7 Å²	128.7	58%	0.58	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.1	2.5	178.2	48.7	0	0	0	0	113.8	A21 T22 P27	A21-S25 WeakPolarHBondContact O-CB 3.26Å; A21-S25 PolarHBondContact O-N 3.08Å; A21-S25 PolarHBondContact O-OG 2.78Å; T22-S25 WeakPolarHBondContact CA-OG 3.34Å; S25-P27 WeakPolarHBondContact O-CD 3.39Å
26	R	49.6	Very low	53.6	Low	199 Å²	199	133.8 Å²	133.8	75%	0.751	66%	0.657	S	S	*	*	S	Bend	trans	-79.9	110.2	168.3	-78.1	-179.3	-176.6	-165.5	1.8	108.4	T22 D28	T22-R26 WeakPolarHBondContact O-CG 3.3Å; R26-D28 PolarHBondContact O-N 3.13Å
27	P	51.1	Low	53.3	Low	93 Å²	93	137.4 Å²	137.4	60%	0.604	67%	0.67	S	S	*	*			trans	-56.2	136.2	169.2	25.3	-33.1	0	0	0	107.4	S25 R29	S25-P27 WeakPolarHBondContact O-CD 3.39Å; P27-R29 VanDerWaalsContact C-N 3.31Å; P27-R29 WeakPolarHBondContact O-CG 3.29Å; P27-R29 PolarHBondContact O-N 3.44Å
28	D	53.3	Low	53	Low	148 Å²	148	137.5 Å²	137.5	79%	0.791	68%	0.677	S	S	*	*			trans	-55	94.4	179	-165.9	-4.9	0	0	0	109.4	R26 N30	R26-D28 PolarHBondContact O-N 3.13Å; D28-N30 PolarHBondContact O-N 3.13Å; D28-N30 VanDerWaalsContact O-N 3.16Å; D28-N30 WeakPolarHBondContact OD1-CB 3.31Å; D28-N30 PolarHBondContact OD1-N 2.96Å
29	R	54.2	Low	53	Low	229 Å²	229	137.5 Å²	137.5	86%	0.864	68%	0.677	S	S	*	*			trans	-80.1	17.5	-178.5	-78.7	-173.1	-177.6	-175.9	0.8	111.6	P27 P31	P27-R29 VanDerWaalsContact C-N 3.31Å; P27-R29 WeakPolarHBondContact O-CG 3.29Å; P27-R29 PolarHBondContact O-N 3.44Å; R29-P31 WeakPolarHBondContact O-CD 3.42Å
30	N	48.9	Very low	52.6	Low	99 Å²	99	142 Å²	142	53%	0.529	69%	0.687	S	S	.	*			trans	-105.3	90.9	178.1	-136.2	-7.2	0	0	0	110.2	D28 R32	D28-N30 PolarHBondContact O-N 3.13Å; D28-N30 VanDerWaalsContact O-N 3.16Å; D28-N30 WeakPolarHBondContact OD1-CB 3.31Å; D28-N30 PolarHBondContact OD1-N 2.96Å; N30-R32 PolarHBondContact O-N 3.09Å
31	P	52.5	Low	52.5	Low	113 Å²	113	147.1 Å²	147.1	73%	0.734	71%	0.705	S	S	*	*			trans	-70	17.3	178	30.1	-36.4	0	0	0	113.6	R29	R29-P31 WeakPolarHBondContact O-CD 3.42Å
32	R	52.5	Low	52.3	Low	200 Å²	200	153.2 Å²	153.2	76%	0.755	72%	0.721	S	S	*	*	S	Bend	trans	-114.8	73.9	-170.5	-72.8	-171.5	-88.9	-152.9	-8.2	110.5	N30	N30-R32 PolarHBondContact O-N 3.09Å
33	K	50.9	Low	51.7	Low	202 Å²	202	153.6 Å²	153.6	88%	0.878	74%	0.737	S	S	*	*			trans	158	37.5	151.2	-88.4	173.2	179.6	-170.1	0	113.4	E35	K33-E35 VanDerWaalsContact C-N 3.28Å; K33-E35 PolarHBondContact O-N 3.12Å
34	I	54.5	Low	51.4	Low	153 Å²	153	154.6 Å²	154.6	79%	0.785	75%	0.745	S	S	*	*			trans	-71	98.9	156.3	-57.1	174.2	0	0	0	105.1	K36	I34-K36 PolarHBondContact O-N 3.27Å
35	E	55	Low	51.2	Low	153 Å²	153	150.8 Å²	150.8	72%	0.715	75%	0.748	S	S	*	*			trans	-47.3	112	164.6	-82.7	-174.1	155.7	0	0	107.4	K33 K37	K33-E35 VanDerWaalsContact C-N 3.28Å; K33-E35 PolarHBondContact O-N 3.12Å; E35-K37 PolarHBondContact O-N 3.18Å
36	K	52.4	Low	51.2	Low	187 Å²	187	154.9 Å²	154.9	81%	0.813	76%	0.756	S	S	*	*			trans	-65.7	79.3	166	-72.4	-178.2	178.9	-178.2	0	107.2	I34 D38	I34-K36 PolarHBondContact O-N 3.27Å; K36-D38 VanDerWaalsContact C-N 3.31Å; K36-D38 PolarHBondContact O-N 2.76Å; K36-D38 VanDerWaalsContact O-N 3.1Å
37	K	52.3	Low	51.2	Low	158 Å²	158	153.4 Å²	153.4	69%	0.687	76%	0.763	S	S	*	*			trans	-68.8	102.8	155.3	-76.8	-174.6	179.4	176.3	0	104.8	E35 K39	E35-K37 PolarHBondContact O-N 3.18Å; K37-K39 PolarHBondContact O-N 3.28Å
38	D	50.1	Low	51.3	Low	149 Å²	149	154.7 Å²	154.7	80%	0.797	77%	0.769	S	S	*	*			trans	-59.9	74.2	169.2	-70.5	-32.8	0	0	0	109.3	K36 K40	K36-D38 VanDerWaalsContact C-N 3.31Å; K36-D38 PolarHBondContact O-N 2.76Å; K36-D38 VanDerWaalsContact O-N 3.1Å; D38-K40 PolarHBondContact O-N 2.74Å; D38-K40 VanDerWaalsContact O-N 3.09Å
39	K	55.3	Low	51.3	Low	159 Å²	159	152.3 Å²	152.3	69%	0.691	76%	0.756	S	S	*	*			trans	-69.4	104.4	160.8	-74.6	-173.8	178.7	-178.6	0	105	K37 F41	K37-K39 PolarHBondContact O-N 3.28Å; K39-F41 VanDerWaalsContact C-N 3.27Å; K39-F41 HydrophobicContact CB-CE2 4.45Å; K39-F41 VanDerWaalsContact O-CD2 3.27Å; K39-F41 WeakPolarHBondContact O-CD2 3.19Å; K39-F41 PolarHBondContact O-N 3.37Å
40	K	49.9	Very low	51.4	Low	180 Å²	180	146.3 Å²	146.3	78%	0.783	75%	0.747	S	S	*	*			trans	-52	95.6	165.2	-67.1	179.3	179.8	179.8	0	107.6	D38 F42	D38-K40 PolarHBondContact O-N 2.74Å; D38-K40 VanDerWaalsContact O-N 3.09Å; K40-F42 VanDerWaalsContact C-N 3.3Å; K40-F42 HydrophobicContact CB-CD2 4.4Å; K40-F42 HydrophobicContact CB-CE2 4.22Å; K40-F42 PolarHBondContact O-N 3.36Å
41	F	53.3	Low	51.8	Low	195 Å²	195	145 Å²	145	86%	0.855	75%	0.75	S	S	*	*			trans	-69.6	96.5	165.7	-79.5	-87.4	0	0	0	106	K39 G43	K39-F41 VanDerWaalsContact C-N 3.27Å; K39-F41 HydrophobicContact CB-CE2 4.45Å; K39-F41 VanDerWaalsContact O-CD2 3.27Å; K39-F41 WeakPolarHBondContact O-CD2 3.19Å; K39-F41 PolarHBondContact O-N 3.37Å; F41-G43 PolarHBondContact O-N 3.22Å
42	F	49.3	Very low	51.9	Low	190 Å²	190	144.9 Å²	144.9	83%	0.833	74%	0.743	S	S	*	*			trans	-63.3	94.5	160.4	-78.4	-88.3	0	0	0	106.5	K40 A44	K40-F42 VanDerWaalsContact C-N 3.3Å; K40-F42 HydrophobicContact CB-CD2 4.4Å; K40-F42 HydrophobicContact CB-CE2 4.22Å; K40-F42 PolarHBondContact O-N 3.36Å; F42-A44 PolarHBondContact O-N 3.49Å
43	G	42.2	Very low	52	Low	69 Å²	69	137.9 Å²	137.9	71%	0.711	73%	0.728	S	S	*	*			trans	-61.3	98.4	173	0	0	0	0	0	108.6	F41 S45	F41-G43 PolarHBondContact O-N 3.22Å; G43-S45 PolarHBondContact O-N 3.25Å
44	A	48	Very low	52.2	Low	84 Å²	84	133.9 Å²	133.9	69%	0.694	71%	0.714	S	S	*	*			trans	-63.2	98.8	156	0	0	0	0	0	105.6	F42 K46	F42-A44 PolarHBondContact O-N 3.49Å; A44-K46 PolarHBondContact O-N 3.2Å
45	S	47.4	Very low	52.3	Low	123 Å²	123	128.4 Å²	128.4	86%	0.86	70%	0.695	S	S	*	*			trans	-64.9	69.3	169.2	63.3	0	0	0	0	108.7	G43 N47	G43-S45 PolarHBondContact O-N 3.25Å; S45-N47 PolarHBondContact O-N 3.2Å
46	K	52.1	Low	52.3	Low	169 Å²	169	126.6 Å²	126.6	74%	0.735	69%	0.69	S	S	*	*			trans	-74.2	119.8	164.4	-77	-171.2	176.2	-177.6	0	105.5	A44 T48	A44-K46 PolarHBondContact O-N 3.2Å; K46-T48 PolarHBondContact O-N 3.5Å; K46-T48 PolarHBondContact O-OG1 3.18Å
47	N	50.9	Low	52.5	Low	168 Å²	168	123.8 Å²	123.8	90%	0.898	68%	0.683	S	S	*	*			trans	-55.3	78.4	175	-155.1	7	0	0	0	109.7	S45 N49	S45-N47 PolarHBondContact O-N 3.2Å; N47-N49 PolarHBondContact O-N 3.18Å; N47-N49 VanDerWaalsContact O-N 3.09Å
48	T	51.6	Low	52.8	Low	121 Å²	121	124.2 Å²	124.2	74%	0.742	69%	0.686	S	S	*	*			trans	-81.3	91.3	180	29.9	0	0	0	0	108.1	K46	K46-T48 PolarHBondContact O-N 3.5Å; K46-T48 PolarHBondContact O-OG1 3.18Å
49	N	54.4	Low	53.2	Low	98 Å²	98	125.3 Å²	125.3	52%	0.524	68%	0.683	S	S	.	*			trans	-52.4	120.1	168.7	-149.5	-6.4	0	0	0	108.3	N47 A51 N52	N47-N49 PolarHBondContact O-N 3.18Å; N47-N49 VanDerWaalsContact O-N 3.09Å; N49-A51 PolarHBondContact O-N 3.49Å; N49-N52 PolarHBondContact O-N 3.5Å
50	P	55	Low	53.3	Low	102 Å²	102	120.2 Å²	120.2	66%	0.662	67%	0.671	S	S	*	*	H	α-helix	trans	-59.2	-25.1	-172.4	19.6	-31.4	0	0	0	113.2	N52 A53	P50-N52 VanDerWaalsContact C-N 3.27Å; P50-N52 PolarHBondContact O-N 3.08Å; P50-A53 PolarHBondContact O-N 3.47Å
51	A	57.1	Low	53.6	Low	71 Å²	71	116.6 Å²	116.6	59%	0.587	67%	0.666	S	S	*	*	H	α-helix	trans	-61.1	-32.3	172.6	0	0	0	0	0	113.5	N49	N49-A51 PolarHBondContact O-N 3.49Å
52	N	55.4	Low	53.8	Low	111 Å²	111	111.1 Å²	111.1	59%	0.594	65%	0.648	S	S	*	*	H	α-helix	trans	-81	-17	178.9	-74	-8.4	0	0	0	113	N49 P50	N49-N52 PolarHBondContact O-N 3.5Å; P50-N52 VanDerWaalsContact C-N 3.27Å; P50-N52 PolarHBondContact O-N 3.08Å
53	A	54.3	Low	54.1	Low	53 Å²	53	109.1 Å²	109.1	44%	0.438	65%	0.645	S	S	.	*	H	α-helix	trans	-73.8	-39.5	176.5	0	0	0	0	0	111.6	P50 N56 L57	P50-A53 PolarHBondContact O-N 3.47Å; A53-N56 PolarHBondContact O-N 3.17Å; A53-L57 PolarHBondContact O-N 3.13Å; A53-L57 VanDerWaalsContact O-N 3.16Å
54	M	55	Low	54.5	Low	118 Å²	118	113.5 Å²	113.5	58%	0.581	65%	0.647	S	S	*	*	H	α-helix	trans	-64.4	-41.4	176.1	-74.6	-163.9	74.1	0	0	112.3	N56 L57 F58	M54-N56 PolarHBondContact O-N 3.4Å; M54-L57 WeakPolarHBondContact O-CB 3.3Å; M54-L57 PolarHBondContact O-N 3.08Å; M54-L57 VanDerWaalsContact O-N 3.15Å; M54-F58 HydrophobicContact CE-CE2 4.04Å; M54-F58 HydrophobicContact CE-CZ 4.31Å; M54-F58 WeakPolarHBondContact O-CD2 3.48Å; M54-F58 PolarHBondContact O-N 3.38Å
55	G	56.9	Low	54.6	Low	38 Å²	38	116.6 Å²	116.6	39%	0.392	64%	0.642	S	S	.	*	H	α-helix	trans	-62.3	-28.4	177.9	0	0	0	0	0	114.1
56	N	55.5	Low	54.8	Low	115 Å²	115	114.6 Å²	114.6	62%	0.615	62%	0.624	S	S	*	*	H	α-helix	trans	-83.9	-26	175.8	-75.1	-12.2	0	0	0	113.1	A53 M54 K59 A60	A53-N56 PolarHBondContact O-N 3.17Å; M54-N56 PolarHBondContact O-N 3.4Å; N56-K59 PolarHBondContact O-N 3.28Å; N56-A60 PolarHBondContact O-N 3.41Å
57	L	56.1	Low	54.7	Low	128 Å²	128	111 Å²	111	67%	0.67	62%	0.616	S	S	*	*	H	α-helix	trans	-66.3	-36.6	173.2	-95.1	145	0	0	0	112.1	A53 M54 K59 A60	A53-L57 PolarHBondContact O-N 3.13Å; A53-L57 VanDerWaalsContact O-N 3.16Å; M54-L57 WeakPolarHBondContact O-CB 3.3Å; M54-L57 PolarHBondContact O-N 3.08Å; M54-L57 VanDerWaalsContact O-N 3.15Å; L57-K59 VanDerWaalsContact C-N 3.31Å; L57-K59 PolarHBondContact O-N 2.95Å; L57-A60 WeakPolarHBondContact O-CB 3.27Å; L57-A60 PolarHBondContact O-N 3.27Å
58	F	58.5	Low	54.6	Low	167 Å²	167	109.1 Å²	109.1	73%	0.732	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.4	-13.5	175.9	-65.8	-67.9	0	0	0	114.3	M54	M54-F58 HydrophobicContact CE-CE2 4.04Å; M54-F58 HydrophobicContact CE-CZ 4.31Å; M54-F58 WeakPolarHBondContact O-CD2 3.48Å; M54-F58 PolarHBondContact O-N 3.38Å
59	K	59.2	Low	54.6	Low	173 Å²	173	110.3 Å²	110.3	75%	0.752	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.4	-2.5	173.1	-72	-176.3	179.3	-177.5	0	113.1	N56 L57	N56-K59 PolarHBondContact O-N 3.28Å; L57-K59 VanDerWaalsContact C-N 3.31Å; L57-K59 PolarHBondContact O-N 2.95Å
60	A	57.6	Low	54.5	Low	52 Å²	52	109.1 Å²	109.1	43%	0.43	60%	0.595	S	S	.	*	S	Bend	trans	-67.2	134.9	174.3	0	0	0	0	0	108.8	N56 L57 T62	N56-A60 PolarHBondContact O-N 3.41Å; L57-A60 WeakPolarHBondContact O-CB 3.27Å; L57-A60 PolarHBondContact O-N 3.27Å; A60-T62 PolarHBondContact O-N 3.42Å
61	P	55.5	Low	54.4	Low	104 Å²	104	108.6 Å²	108.6	68%	0.675	59%	0.59	S	S	*	*	P	Polyproline II helix	trans	-56	118.2	175	21.8	-30.6	0	0	0	108.7
62	T	57.6	Low	54.2	Low	80 Å²	80	115.1 Å²	115.1	49%	0.491	60%	0.599	S	S	.	*	P	Polyproline II helix	trans	-61.5	148.8	175.6	28.8	0	0	0	0	109.5	A60 E64 Y65	A60-T62 PolarHBondContact O-N 3.42Å; T62-E64 PolarHBondContact O-N 3.21Å; T62-Y65 PolarHBondContact O-N 2.75Å
63	I	55	Low	54.2	Low	148 Å²	148	115 Å²	115	76%	0.759	60%	0.603	S	S	*	*	H	α-helix	trans	-51.6	-24.5	-175.7	-65	167	0	0	0	112.6	Y65 V66	I63-Y65 PolarHBondContact O-N 3.43Å; I63-V66 PolarHBondContact O-N 3.36Å
64	E	51.6	Low	54	Low	160 Å²	160	118.9 Å²	118.9	75%	0.748	61%	0.612	S	S	*	*	H	α-helix	trans	-62.4	-35.3	176.4	-65.9	177.4	167	0	0	113.5	T62 V66	T62-E64 PolarHBondContact O-N 3.21Å; E64-V66 PolarHBondContact O-N 3.23Å
65	Y	50.2	Low	53.7	Low	150 Å²	150	120.6 Å²	120.6	59%	0.588	62%	0.618	S	S	*	*	H	α-helix	trans	-74.5	-24.9	-178.6	-82.2	-87.1	0	0	0	113.7	T62 I63 V67	T62-Y65 PolarHBondContact O-N 2.75Å; I63-Y65 PolarHBondContact O-N 3.43Å; Y65-V67 VanDerWaalsContact C-N 3.31Å; Y65-V67 PolarHBondContact O-N 3.37Å
66	V	51.2	Low	53.4	Low	81 Å²	81	124.1 Å²	124.1	49%	0.491	63%	0.634	S	S	.	*	H	α-helix	trans	-76	-23.2	-178.4	-176.5	0	0	0	0	111.4	I63 E64 V70	I63-V66 PolarHBondContact O-N 3.36Å; E64-V66 PolarHBondContact O-N 3.23Å; V66-V70 HydrophobicContact CG1-CG2 4.43Å; V66-V70 WeakPolarHBondContact O-CG2 3.41Å; V66-V70 PolarHBondContact O-N 3.48Å
67	V	49.6	Very low	53.2	Low	93 Å²	93	125.3 Å²	125.3	56%	0.564	64%	0.636	S	S	*	*	H	α-helix	trans	-79.9	-33.6	-178.4	-176.3	0	0	0	0	111.8	Y65 T71	Y65-V67 VanDerWaalsContact C-N 3.31Å; Y65-V67 PolarHBondContact O-N 3.37Å; V67-T71 WeakPolarHBondContact O-CB 3.46Å; V67-T71 WeakPolarHBondContact O-CG2 3.47Å; V67-T71 PolarHBondContact O-N 3.49Å; V67-T71 VanDerWaalsContact O-N 3.14Å; V67-T71 PolarHBondContact O-OG1 3.33Å
68	E	50.2	Low	52.8	Low	129 Å²	129	127.7 Å²	127.7	60%	0.603	64%	0.644	S	S	*	*	H	α-helix	trans	-71.8	-36.4	176.3	-75.5	-167.4	159.1	0	0	113	T71 R72	E68-T71 WeakPolarHBondContact CA-OG1 3.43Å; E68-T71 PolarHBondContact O-OG1 3.16Å; E68-T71 VanDerWaalsContact O-OG1 3.11Å; E68-R72 PolarHBondContact O-N 2.98Å; E68-R72 VanDerWaalsContact O-N 3.13Å
69	E	51.4	Low	52.3	Low	146 Å²	146	128 Å²	128	68%	0.682	64%	0.641	S	S	*	*	H	α-helix	trans	-71.3	-40.1	177.6	-72.7	-168.8	159.5	0	0	111.9	T71 R72 T73	E69-T71 VanDerWaalsContact C-N 3.31Å; E69-T71 PolarHBondContact O-N 3.23Å; E69-R72 PolarHBondContact O-N 3.34Å; E69-T73 PolarHBondContact O-N 3.13Å; E69-T73 PolarHBondContact O-OG1 3.44Å
70	V	52.1	Low	51.8	Low	73 Å²	73	126.8 Å²	126.8	44%	0.442	64%	0.643	S	S	.	*	H	α-helix	trans	-67.1	-34	177.3	173.7	0	0	0	0	111.2	V66 T73 H74	V66-V70 HydrophobicContact CG1-CG2 4.43Å; V66-V70 WeakPolarHBondContact O-CG2 3.41Å; V66-V70 PolarHBondContact O-N 3.48Å; V70-T73 PolarHBondContact O-OG1 3.14Å; V70-H74 WeakPolarHBondContact O-CB 3.35Å; V70-H74 PolarHBondContact O-N 3.11Å; V70-H74 PolarHBondContact O-ND1 3.2Å
71	T	52.8	Low	51.6	Low	91 Å²	91	130.2 Å²	130.2	56%	0.558	65%	0.653	S	S	*	*	H	α-helix	trans	-77.1	-25.9	177.8	45.6	0	0	0	0	113.5	V67 E68 E69	V67-T71 WeakPolarHBondContact O-CB 3.46Å; V67-T71 WeakPolarHBondContact O-CG2 3.47Å; V67-T71 PolarHBondContact O-N 3.49Å; V67-T71 VanDerWaalsContact O-N 3.14Å; V67-T71 PolarHBondContact O-OG1 3.33Å; E68-T71 WeakPolarHBondContact CA-OG1 3.43Å; E68-T71 PolarHBondContact O-OG1 3.16Å; E68-T71 VanDerWaalsContact O-OG1 3.11Å; E69-T71 VanDerWaalsContact C-N 3.31Å; E69-T71 PolarHBondContact O-N 3.23Å
72	R	51.9	Low	51.5	Low	207 Å²	207	129 Å²	129	78%	0.781	65%	0.645	S	S	*	*	H	α-helix	trans	-74.4	-35.6	171.9	-80.8	-175.8	174.6	179.8	1	113.5	E68 E69	E68-R72 PolarHBondContact O-N 2.98Å; E68-R72 VanDerWaalsContact O-N 3.13Å; E69-R72 PolarHBondContact O-N 3.34Å
73	T	55.1	Low	51.4	Low	109 Å²	109	131.9 Å²	131.9	67%	0.669	66%	0.663	S	S	*	*	H	α-helix	trans	-88.2	-14.7	-177.5	58.3	0	0	0	0	114.3	E69 V70	E69-T73 PolarHBondContact O-N 3.13Å; E69-T73 PolarHBondContact O-OG1 3.44Å; V70-T73 PolarHBondContact O-OG1 3.14Å
74	H	50.2	Low	51.4	Low	134 Å²	134	132.4 Å²	132.4	62%	0.62	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.8	37.7	177.6	-62.9	82.8	0	0	0	112.1	V70 P76	V70-H74 WeakPolarHBondContact O-CB 3.35Å; V70-H74 PolarHBondContact O-N 3.11Å; V70-H74 PolarHBondContact O-ND1 3.2Å; H74-P76 VanDerWaalsContact O-CD 3.29Å; H74-P76 WeakPolarHBondContact O-CD 3.48Å
75	Q	49.3	Very low	51.3	Low	155 Å²	155	129.6 Å²	129.6	72%	0.724	66%	0.655	S	S	*	*			trans	-62.4	119.3	155.9	-70.3	-171.1	6.6	0	0	106	E77	Q75-E77 PolarHBondContact O-N 3.33Å
76	P	51.3	Low	51.6	Low	112 Å²	112	125.6 Å²	125.6	73%	0.727	65%	0.649	S	S	*	*			trans	-53.8	131.1	167.8	25.2	-31.4	0	0	0	105.6	H74 Q78	H74-P76 VanDerWaalsContact O-CD 3.29Å; H74-P76 WeakPolarHBondContact O-CD 3.48Å; P76-Q78 VanDerWaalsContact C-N 3.28Å; P76-Q78 PolarHBondContact O-N 3.32Å
77	E	50.5	Low	51.7	Low	139 Å²	139	126.7 Å²	126.7	65%	0.65	66%	0.658	S	S	*	*			trans	-45.2	106.5	165.5	-70.1	-179.6	163.1	0	0	105.8	Q75 Y79	Q75-E77 PolarHBondContact O-N 3.33Å; E77-Y79 HydrophobicContact CB-CD2 4.29Å; E77-Y79 HydrophobicContact CB-CE2 3.92Å; E77-Y79 WeakPolarHBondContact O-CD2 3.39Å; E77-Y79 PolarHBondContact O-N 3.31Å; E77-Y79 VanDerWaalsContact OE2-CZ 3.25Å; E77-Y79 PolarHBondContact OE2-OH 3.41Å
78	Q	47.6	Very low	51.9	Low	178 Å²	178	128.9 Å²	128.9	83%	0.832	67%	0.666	S	S	*	*			trans	-72.1	86.8	175.7	-172.3	174.3	-20.3	0	0	102.9	P76 D80	P76-Q78 VanDerWaalsContact C-N 3.28Å; P76-Q78 PolarHBondContact O-N 3.32Å; Q78-D80 PolarHBondContact O-N 3.26Å
79	Y	49.1	Very low	52.3	Low	174 Å²	174	128.7 Å²	128.7	68%	0.682	67%	0.666	S	S	*	*			trans	-55.2	109.9	170.7	-72	-83	0	0	0	105.1	E77 I81	E77-Y79 HydrophobicContact CB-CD2 4.29Å; E77-Y79 HydrophobicContact CB-CE2 3.92Å; E77-Y79 WeakPolarHBondContact O-CD2 3.39Å; E77-Y79 PolarHBondContact O-N 3.31Å; E77-Y79 VanDerWaalsContact OE2-CZ 3.25Å; E77-Y79 PolarHBondContact OE2-OH 3.41Å; Y79-I81 PolarHBondContact O-N 3.48Å
80	D	47.6	Very low	52.3	Low	147 Å²	147	126 Å²	126	79%	0.786	66%	0.66	S	S	*	*			trans	-58.7	93	161.9	-80	-33.4	0	0	0	105.6	Q78 P82	Q78-D80 PolarHBondContact O-N 3.26Å; D80-P82 WeakPolarHBondContact O-CD 3.39Å
81	I	53.8	Low	52.4	Low	124 Å²	124	127 Å²	127	64%	0.636	66%	0.662	S	S	*	*			trans	-65.4	116	170.9	-59.3	171.1	0	0	0	104	Y79 T83 M85	Y79-I81 PolarHBondContact O-N 3.48Å; I81-T83 PolarHBondContact O-N 3.32Å; I81-M85 HydrophobicContact CG2-CE 3.99Å
82	P	52.5	Low	52.3	Low	79 Å²	79	125.4 Å²	125.4	51%	0.513	66%	0.658	S	S	.	*			trans	-58.9	113.1	174.7	22.3	-30.1	0	0	0	107.7	D80 D84 M85	D80-P82 WeakPolarHBondContact O-CD 3.39Å; P82-D84 PolarHBondContact O-N 3.19Å; P82-M85 HydrophobicContact CG-CE 4.22Å; P82-M85 HydrophobicContact CG-CG 4.46Å; P82-M85 PolarHBondContact O-N 3.27Å
83	T	56.4	Low	52.3	Low	141 Å²	141	118.4 Å²	118.4	87%	0.865	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.9	-0.3	-178.5	-25.9	0	0	0	0	112.7	I81	I81-T83 PolarHBondContact O-N 3.32Å
84	D	54.7	Low	52	Low	158 Å²	158	116 Å²	116	85%	0.845	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.3	4.1	179	-68.1	-19.6	0	0	0	114	P82 S86	P82-D84 PolarHBondContact O-N 3.19Å; D84-S86 PolarHBondContact O-N 3.44Å
85	M	50.3	Low	52.2	Low	101 Å²	101	115.3 Å²	115.3	50%	0.498	63%	0.629	S	S	.	*			trans	-79.3	118.3	174.2	-70.7	-164	-69.3	0	0	111.4	I81 P82	I81-M85 HydrophobicContact CG2-CE 3.99Å; P82-M85 HydrophobicContact CG-CE 4.22Å; P82-M85 HydrophobicContact CG-CG 4.46Å; P82-M85 PolarHBondContact O-N 3.27Å
86	S	55.7	Low	52.3	Low	66 Å²	66	111.6 Å²	111.6	46%	0.462	62%	0.62	S	S	.	*			trans	-55.9	146.8	176.7	75.7	0	0	0	0	110.9	D84 L88 M89	D84-S86 PolarHBondContact O-N 3.44Å; S86-L88 PolarHBondContact O-N 3.26Å; S86-M89 PolarHBondContact O-N 3.1Å
87	P	53.9	Low	52.3	Low	104 Å²	104	108.7 Å²	108.7	68%	0.675	61%	0.606	S	S	*	*	H	α-helix	trans	-52.8	-20.2	-178.8	-27.3	34.3	0	0	0	114.7	I91	P87-I91 WeakPolarHBondContact O-CD1 3.49Å; P87-I91 WeakPolarHBondContact O-CG1 3.14Å
88	L	54.1	Low	52.2	Low	139 Å²	139	107.2 Å²	107.2	73%	0.728	60%	0.602	S	S	*	*	H	α-helix	trans	-67.7	-36.7	177.5	-117.4	92.6	0	0	0	113.4	S86 T90 I91 A92	S86-L88 PolarHBondContact O-N 3.26Å; L88-T90 VanDerWaalsContact C-N 3.34Å; L88-I91 PolarHBondContact O-N 3.13Å; L88-A92 PolarHBondContact O-N 3.09Å
89	M	57.2	Low	52.5	Low	125 Å²	125	105.9 Å²	105.9	62%	0.616	59%	0.594	S	S	*	*	H	α-helix	trans	-71.6	-32.7	-178.5	-75.5	-63.3	-143.2	0	0	111.9	S86 I91 A92 A93	S86-M89 PolarHBondContact O-N 3.1Å; M89-I91 VanDerWaalsContact C-N 3.31Å; M89-I91 PolarHBondContact O-N 3.46Å; M89-A92 PolarHBondContact O-N 2.8Å; M89-A93 PolarHBondContact O-N 2.69Å
90	T	52.7	Low	52.5	Low	91 Å²	91	104.3 Å²	104.3	56%	0.558	59%	0.591	S	S	*	*	H	α-helix	trans	-67.4	-33.7	176.8	-32	0	0	0	0	111.8	L88 S94	L88-T90 VanDerWaalsContact C-N 3.34Å; T90-S94 PolarHBondContact O-N 2.95Å; T90-S94 PolarHBondContact O-OG 3.16Å
91	I	53.4	Low	52.8	Low	93 Å²	93	100.3 Å²	100.3	48%	0.477	57%	0.572	S	S	.	*	H	α-helix	trans	-71.8	-40.9	178.3	-62.9	164.9	0	0	0	110.9	P87 L88 M89 A93 S94 E95	P87-I91 WeakPolarHBondContact O-CD1 3.49Å; P87-I91 WeakPolarHBondContact O-CG1 3.14Å; L88-I91 PolarHBondContact O-N 3.13Å; M89-I91 VanDerWaalsContact C-N 3.31Å; M89-I91 PolarHBondContact O-N 3.46Å; I91-A93 VanDerWaalsContact C-N 3.31Å; I91-A93 PolarHBondContact O-N 2.76Å; I91-S94 WeakPolarHBondContact CA-OG 3.45Å; I91-S94 PolarHBondContact O-N 2.97Å; I91-S94 VanDerWaalsContact O-N 3.16Å; I91-S94 PolarHBondContact O-OG 3Å; I91-E95 PolarHBondContact O-N 3.29Å; I91-E95 VanDerWaalsContact O-N 3.1Å
92	A	52.1	Low	52.7	Low	57 Å²	57	99.8 Å²	99.8	47%	0.471	57%	0.57	S	S	.	*	H	α-helix	trans	-63.5	-36	177.8	0	0	0	0	0	112.7	L88 M89 S96	L88-A92 PolarHBondContact O-N 3.09Å; M89-A92 PolarHBondContact O-N 2.8Å; A92-S96 PolarHBondContact O-N 3.14Å
93	A	49.9	Very low	52.6	Low	60 Å²	60	103.6 Å²	103.6	50%	0.496	58%	0.579	S	S	.	*	H	α-helix	trans	-66.5	-38.8	174.2	0	0	0	0	0	111.9	M89 I91 S96 A97	M89-A93 PolarHBondContact O-N 2.69Å; I91-A93 VanDerWaalsContact C-N 3.31Å; I91-A93 PolarHBondContact O-N 2.76Å; A93-S96 PolarHBondContact O-N 3.11Å; A93-S96 PolarHBondContact O-OG 3.05Å; A93-A97 PolarHBondContact O-N 3.27Å
94	S	50.8	Low	52.3	Low	60 Å²	60	103 Å²	103	42%	0.42	56%	0.564	S	S	.	*	H	α-helix	trans	-66.5	-37.2	176.4	47.8	0	0	0	0	113.7	T90 I91 S96 A97 D98	T90-S94 PolarHBondContact O-N 2.95Å; T90-S94 PolarHBondContact O-OG 3.16Å; I91-S94 WeakPolarHBondContact CA-OG 3.45Å; I91-S94 PolarHBondContact O-N 2.97Å; I91-S94 VanDerWaalsContact O-N 3.16Å; I91-S94 PolarHBondContact O-OG 3Å; S94-S96 VanDerWaalsContact C-N 3.26Å; S94-S96 PolarHBondContact O-N 3.1Å; S94-A97 PolarHBondContact O-N 3.17Å; S94-D98 PolarHBondContact O-N 3.02Å
95	E	53.4	Low	52.1	Low	119 Å²	119	102.4 Å²	102.4	56%	0.556	56%	0.555	S	S	*	*	H	α-helix	trans	-67.1	-27.7	176.9	-70.3	-177	176	0	0	112.9	I91	I91-E95 PolarHBondContact O-N 3.29Å; I91-E95 VanDerWaalsContact O-N 3.1Å
96	S	52.2	Low	52.1	Low	76 Å²	76	102.3 Å²	102.3	53%	0.531	56%	0.56	S	S	.	*	H	α-helix	trans	-74.8	-30.8	175.3	76.2	0	0	0	0	112.8	A92 A93 S94 F100	A92-S96 PolarHBondContact O-N 3.14Å; A93-S96 PolarHBondContact O-N 3.11Å; A93-S96 PolarHBondContact O-OG 3.05Å; S94-S96 VanDerWaalsContact C-N 3.26Å; S94-S96 PolarHBondContact O-N 3.1Å; S96-F100 PolarHBondContact O-N 2.89Å
97	A	50.4	Low	51.9	Low	52 Å²	52	104.2 Å²	104.2	43%	0.43	57%	0.565	S	S	.	*	H	α-helix	trans	-72.9	-38.8	176.7	0	0	0	0	0	112	A93 S94 K99 F100 T101	A93-A97 PolarHBondContact O-N 3.27Å; S94-A97 PolarHBondContact O-N 3.17Å; A97-K99 VanDerWaalsContact C-N 3.32Å; A97-K99 PolarHBondContact O-N 2.97Å; A97-F100 WeakPolarHBondContact O-CB 3.47Å; A97-F100 PolarHBondContact O-N 3.29Å; A97-T101 PolarHBondContact O-N 3.37Å; A97-T101 VanDerWaalsContact O-N 3.12Å; A97-T101 PolarHBondContact O-OG1 2.61Å
98	D	49.4	Very low	51.6	Low	107 Å²	107	104.6 Å²	104.6	57%	0.572	56%	0.557	S	S	*	*	H	α-helix	trans	-64.9	-33.9	177.2	-79.3	-18.7	0	0	0	112.5	S94 F100 T101 D102	S94-D98 PolarHBondContact O-N 3.02Å; D98-F100 VanDerWaalsContact C-N 3.26Å; D98-F100 PolarHBondContact O-N 3.24Å; D98-T101 PolarHBondContact O-OG1 3.48Å; D98-D102 PolarHBondContact O-N 3.36Å
99	K	52.3	Low	51.6	Low	151 Å²	151	101 Å²	101	66%	0.657	54%	0.543	S	S	*	.	H	α-helix	trans	-69.7	-24.3	173.1	-72.3	177.2	-176.3	170.3	0	113.2	A97	A97-K99 VanDerWaalsContact C-N 3.32Å; A97-K99 PolarHBondContact O-N 2.97Å
100	F	50.3	Low	51.4	Low	141 Å²	141	97.8 Å²	97.8	62%	0.618	53%	0.534	S	S	*	.	H	α-helix	trans	-82	-37.2	-179.8	-146.8	-87.1	0	0	0	111.3	S96 A97 D98 K103 F104	S96-F100 PolarHBondContact O-N 2.89Å; A97-F100 WeakPolarHBondContact O-CB 3.47Å; A97-F100 PolarHBondContact O-N 3.29Å; D98-F100 VanDerWaalsContact C-N 3.26Å; D98-F100 PolarHBondContact O-N 3.24Å; F100-K103 PolarHBondContact O-N 3.16Å; F100-F104 HydrophobicContact CD1-CD2 4.2Å; F100-F104 AromaticContact CE1-CD2 3.97Å; F100-F104 HydrophobicContact CE1-CD2 3.97Å; F100-F104 HydrophobicContact CE1-CE2 4.08Å; F100-F104 PolarHBondContact O-N 3.24Å; F100-F104 VanDerWaalsContact O-N 3.09Å
101	T	53.3	Low	51.5	Low	63 Å²	63	97 Å²	97	39%	0.387	53%	0.525	S	S	.	.	H	α-helix	trans	-67.2	-44.7	176.7	52.6	0	0	0	0	111.1	A97 D98 K103 F104 F105	A97-T101 PolarHBondContact O-N 3.37Å; A97-T101 VanDerWaalsContact O-N 3.12Å; A97-T101 PolarHBondContact O-OG1 2.61Å; D98-T101 PolarHBondContact O-OG1 3.48Å; T101-K103 VanDerWaalsContact C-N 3.31Å; T101-K103 PolarHBondContact O-N 3.27Å; T101-F104 PolarHBondContact O-N 3.3Å; T101-F104 VanDerWaalsContact O-N 3.09Å; T101-F105 WeakPolarHBondContact O-CD2 3.41Å; T101-F105 PolarHBondContact O-N 2.74Å
102	D	51.1	Low	51.4	Low	113 Å²	113	99.4 Å²	99.4	60%	0.604	54%	0.536	S	S	*	.	H	α-helix	trans	-59.2	-40.8	176.7	-88.2	-12.2	0	0	0	112.4	D98 V106	D98-D102 PolarHBondContact O-N 3.36Å; D102-V106 VanDerWaalsContact O-CG2 3.28Å; D102-V106 WeakPolarHBondContact O-CG2 3.45Å; D102-V106 PolarHBondContact O-N 2.89Å; D102-V106 VanDerWaalsContact O-N 3.13Å
103	K	51.4	Low	51.5	Low	159 Å²	159	104.1 Å²	104.1	69%	0.691	55%	0.546	S	S	*	.	H	α-helix	trans	-65	-41.1	174.5	-78.5	-175.2	177.7	-174.4	0	112.2	F100 T101 V106 D107	F100-K103 PolarHBondContact O-N 3.16Å; T101-K103 VanDerWaalsContact C-N 3.31Å; T101-K103 PolarHBondContact O-N 3.27Å; K103-V106 PolarHBondContact O-N 3.45Å; K103-D107 PolarHBondContact O-N 3.16Å; K103-D107 VanDerWaalsContact O-N 3.08Å
104	F	49.9	Very low	51.7	Low	127 Å²	127	108.2 Å²	108.2	56%	0.557	56%	0.555	S	S	*	*	H	α-helix	trans	-67	-37.1	179.9	-124.9	-91	0	0	0	112.7	F100 T101 Q108	F100-F104 HydrophobicContact CD1-CD2 4.2Å; F100-F104 AromaticContact CE1-CD2 3.97Å; F100-F104 HydrophobicContact CE1-CD2 3.97Å; F100-F104 HydrophobicContact CE1-CE2 4.08Å; F100-F104 PolarHBondContact O-N 3.24Å; F100-F104 VanDerWaalsContact O-N 3.09Å; T101-F104 PolarHBondContact O-N 3.3Å; T101-F104 VanDerWaalsContact O-N 3.09Å; F104-Q108 VanDerWaalsContact O-CG 3.26Å; F104-Q108 WeakPolarHBondContact O-CG 3.09Å; F104-Q108 PolarHBondContact O-N 3.48Å; F104-Q108 VanDerWaalsContact O-N 3.13Å
105	F	49.4	Very low	51.8	Low	147 Å²	147	112.5 Å²	112.5	65%	0.645	57%	0.566	S	S	*	*	H	α-helix	trans	-70.5	-38	176.6	-79.7	-70.5	0	0	0	112.6	T101 S109	T101-F105 WeakPolarHBondContact O-CD2 3.41Å; T101-F105 PolarHBondContact O-N 2.74Å; F105-S109 PolarHBondContact O-N 2.73Å
106	V	52.2	Low	51.8	Low	99 Å²	99	111.7 Å²	111.7	60%	0.6	57%	0.569	S	S	*	*	H	α-helix	trans	-63.8	-42.5	174.7	172.5	0	0	0	0	110.8	D102 K103 Q108 S109 S110	D102-V106 VanDerWaalsContact O-CG2 3.28Å; D102-V106 WeakPolarHBondContact O-CG2 3.45Å; D102-V106 PolarHBondContact O-N 2.89Å; D102-V106 VanDerWaalsContact O-N 3.13Å; K103-V106 PolarHBondContact O-N 3.45Å; V106-Q108 PolarHBondContact O-N 2.83Å; V106-S109 PolarHBondContact O-N 2.91Å; V106-S109 PolarHBondContact O-OG 2.93Å; V106-S110 PolarHBondContact O-N 3.39Å
107	D	49.8	Very low	51.9	Low	106 Å²	106	111.5 Å²	111.5	57%	0.567	57%	0.568	S	S	*	*	H	α-helix	trans	-70	-32.7	-178.7	-131.7	23.8	0	0	0	113.1	K103 S109 S110 I111	K103-D107 PolarHBondContact O-N 3.16Å; K103-D107 VanDerWaalsContact O-N 3.08Å; D107-S109 VanDerWaalsContact C-N 3.34Å; D107-S110 PolarHBondContact O-OG 3.44Å; D107-I111 WeakPolarHBondContact O-CD1 3.49Å; D107-I111 VanDerWaalsContact O-CG1 3.3Å; D107-I111 WeakPolarHBondContact O-CG1 3.1Å; D107-I111 PolarHBondContact O-N 2.93Å
108	Q	49.2	Very low	51.9	Low	111 Å²	111	113 Å²	113	52%	0.519	58%	0.575	S	S	.	*	H	α-helix	trans	-69.5	-32.6	173.1	-71.2	-82.9	-32.7	0	0	112.2	F104 V106 M112	F104-Q108 VanDerWaalsContact O-CG 3.26Å; F104-Q108 WeakPolarHBondContact O-CG 3.09Å; F104-Q108 PolarHBondContact O-N 3.48Å; F104-Q108 VanDerWaalsContact O-N 3.13Å; V106-Q108 PolarHBondContact O-N 2.83Å; Q108-M112 PolarHBondContact O-N 2.9Å
109	S	53.1	Low	52.1	Low	63 Å²	63	115.6 Å²	115.6	44%	0.441	58%	0.582	S	S	.	*	H	α-helix	trans	-71.3	-32	-178.7	80.1	0	0	0	0	113.3	F105 V106 D107	F105-S109 PolarHBondContact O-N 2.73Å; V106-S109 PolarHBondContact O-N 2.91Å; V106-S109 PolarHBondContact O-OG 2.93Å; D107-S109 VanDerWaalsContact C-N 3.34Å
110	S	53.8	Low	52.1	Low	59 Å²	59	110.2 Å²	110.2	41%	0.413	57%	0.569	S	S	.	*	H	α-helix	trans	-71.8	-43.9	176.9	62.6	0	0	0	0	111	V106 D107 M112 K113 E114	V106-S110 PolarHBondContact O-N 3.39Å; D107-S110 PolarHBondContact O-OG 3.44Å; S110-M112 VanDerWaalsContact C-N 3.32Å; S110-M112 PolarHBondContact O-N 3.31Å; S110-K113 PolarHBondContact O-N 3.47Å; S110-E114 PolarHBondContact O-N 2.71Å
111	I	53.9	Low	52.2	Low	75 Å²	75	108.7 Å²	108.7	39%	0.385	57%	0.567	S	S	.	*	H	α-helix	trans	-64.8	-33.9	-179.9	-62.7	167.1	0	0	0	111.8	D107 K115	D107-I111 WeakPolarHBondContact O-CD1 3.49Å; D107-I111 VanDerWaalsContact O-CG1 3.3Å; D107-I111 WeakPolarHBondContact O-CG1 3.1Å; D107-I111 PolarHBondContact O-N 2.93Å; I111-K115 PolarHBondContact O-N 3.45Å
112	M	51.5	Low	52.1	Low	142 Å²	142	108.6 Å²	108.6	70%	0.7	57%	0.573	S	S	*	*	H	α-helix	trans	-69.9	-35.9	176.1	-80.5	-159.8	86.3	0	0	113.3	Q108 S110 E114 T116	Q108-M112 PolarHBondContact O-N 2.9Å; S110-M112 VanDerWaalsContact C-N 3.32Å; S110-M112 PolarHBondContact O-N 3.31Å; M112-E114 VanDerWaalsContact C-N 3.33Å; M112-T116 PolarHBondContact O-N 3.15Å; M112-T116 PolarHBondContact O-OG1 3.38Å; M112-T116 VanDerWaalsContact O-OG1 3.13Å
113	K	55.1	Low	52.1	Low	156 Å²	156	113.7 Å²	113.7	68%	0.678	58%	0.583	S	S	*	*	H	α-helix	trans	-68.8	-33.5	177.9	-74.7	-178.6	179	177.7	0	112.3	S110 T116 S117	S110-K113 PolarHBondContact O-N 3.47Å; K113-T116 PolarHBondContact O-OG1 3.16Å; K113-T116 VanDerWaalsContact O-OG1 3.08Å; K113-S117 PolarHBondContact O-N 3.34Å
114	E	53.6	Low	52	Low	147 Å²	147	111.6 Å²	111.6	69%	0.687	58%	0.584	S	S	*	*	H	α-helix	trans	-71.1	-37.9	179.6	-145.9	178.1	-171.2	0	0	111.9	S110 M112 T116 S117 S118	S110-E114 PolarHBondContact O-N 2.71Å; M112-E114 VanDerWaalsContact C-N 3.33Å; E114-T116 PolarHBondContact O-N 3.35Å; E114-S117 PolarHBondContact O-N 2.71Å; E114-S118 PolarHBondContact O-N 3.04Å; E114-S118 VanDerWaalsContact O-N 3.08Å
115	K	52.4	Low	52	Low	150 Å²	150	112.9 Å²	112.9	65%	0.652	60%	0.596	S	S	*	*	H	α-helix	trans	-68.8	-30.3	177.2	-83.2	-179.1	177.5	170.9	0	114.1	I111 K119	I111-K115 PolarHBondContact O-N 3.45Å; K115-K119 PolarHBondContact O-N 3.41Å
116	T	54.3	Low	51.8	Low	101 Å²	101	116.3 Å²	116.3	62%	0.62	62%	0.62	S	S	*	*	H	α-helix	trans	-76.3	-34.8	174.4	34.6	0	0	0	0	112.2	M112 K113 E114 G120	M112-T116 PolarHBondContact O-N 3.15Å; M112-T116 PolarHBondContact O-OG1 3.38Å; M112-T116 VanDerWaalsContact O-OG1 3.13Å; K113-T116 PolarHBondContact O-OG1 3.16Å; K113-T116 VanDerWaalsContact O-OG1 3.08Å; E114-T116 PolarHBondContact O-N 3.35Å; T116-G120 PolarHBondContact O-N 3.09Å; T116-G120 VanDerWaalsContact O-N 3.16Å
117	S	53	Low	51.8	Low	73 Å²	73	117.2 Å²	117.2	51%	0.51	62%	0.621	S	S	.	*	H	α-helix	trans	-66.1	-42.8	174.5	-178.6	0	0	0	0	112.5	K113 E114 K119 G120 N121	K113-S117 PolarHBondContact O-N 3.34Å; E114-S117 PolarHBondContact O-N 2.71Å; S117-K119 PolarHBondContact O-N 3.27Å; S117-G120 PolarHBondContact O-N 3.49Å; S117-N121 PolarHBondContact O-N 3.06Å; S117-N121 VanDerWaalsContact O-N 3.13Å
118	S	51.3	Low	51.9	Low	83 Å²	83	117.7 Å²	117.7	58%	0.58	62%	0.624	S	S	*	*	H	α-helix	trans	-61.1	-39.2	177	165.3	0	0	0	0	113.3	E114 A122	E114-S118 PolarHBondContact O-N 3.04Å; E114-S118 VanDerWaalsContact O-N 3.08Å; S118-A122 PolarHBondContact O-N 2.88Å
119	K	53.3	Low	52.1	Low	162 Å²	162	118.1 Å²	118.1	70%	0.704	63%	0.63	S	S	*	*	H	α-helix	trans	-74.5	-25.9	175.7	-77.5	-176	177.9	179.3	0	113.7	K115 S117	K115-K119 PolarHBondContact O-N 3.41Å; S117-K119 PolarHBondContact O-N 3.27Å
120	G	51.9	Low	52	Low	37 Å²	37	121.4 Å²	121.4	38%	0.381	64%	0.641	S	S	.	*	H	α-helix	trans	-67.8	-49.5	173.5	0	0	0	0	0	111.7	T116 S117 A122 R123 T124	T116-G120 PolarHBondContact O-N 3.09Å; T116-G120 VanDerWaalsContact O-N 3.16Å; S117-G120 PolarHBondContact O-N 3.49Å; G120-A122 PolarHBondContact O-N 3.26Å; G120-R123 PolarHBondContact O-N 3.33Å; G120-T124 PolarHBondContact O-OG1 3.36Å
121	N	52	Low	51.9	Low	109 Å²	109	125.3 Å²	125.3	58%	0.583	66%	0.655	S	S	*	*	H	α-helix	trans	-67.7	-32.4	179.9	-80.3	-4.2	0	0	0	113.5	S117 R123 T124	S117-N121 PolarHBondContact O-N 3.06Å; S117-N121 VanDerWaalsContact O-N 3.13Å; N121-R123 PolarHBondContact O-N 3.31Å; N121-T124 PolarHBondContact O-N 3.21Å
122	A	52.1	Low	51.7	Low	62 Å²	62	128.6 Å²	128.6	51%	0.512	67%	0.673	S	S	.	*	T	Hydrogen-bonded Turn	trans	-69	-18.1	175.9	0	0	0	0	0	113.7	S118 G120	S118-A122 PolarHBondContact O-N 2.88Å; G120-A122 PolarHBondContact O-N 3.26Å
123	R	50.3	Low	51.8	Low	219 Å²	219	127.6 Å²	127.6	83%	0.826	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.3	-10.5	175.1	-95	-176.5	167.8	-176.8	-3.9	113.9	G120 N121	G120-R123 PolarHBondContact O-N 3.33Å; N121-R123 PolarHBondContact O-N 3.31Å
124	T	48.9	Very low	51.5	Low	115 Å²	115	125.5 Å²	125.5	71%	0.706	67%	0.67	S	S	*	*	S	Bend	trans	-100.6	-4.3	-179.5	-38.9	0	0	0	0	112.5	G120 N121	G120-T124 PolarHBondContact O-OG1 3.36Å; N121-T124 PolarHBondContact O-N 3.21Å
125	L	51.8	Low	51.3	Low	154 Å²	154	123.7 Å²	123.7	81%	0.806	67%	0.669	S	S	*	*			trans	-112	9.3	-177.5	-77.7	167.8	0	0	0	114.4
126	L	44.8	Very low	51.2	Low	219 Å²	219	121.3 Å²	121.3	100%	1.147	67%	0.671	S	S	*	*			trans	-122.5	0	171	-77.9	168.9	0	0	0	108.9

Retrieved 126 of 126 residues in 39.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).