YM290_YEAST Loading...

Putative uncharacterized membrane protein YMR290W-A

AlphaFold DB , UniProt , Accession A0A023PZH5, Species YEAST (Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Baker's yeast), Gene n/a, Length 115 aa.

						>YM290_YEAST|A0A023PZH5
MAFKVGCDNFSSSNFSTQVVCSPSGAALFCFEVLFSSTTGSSVDSESLERLFDGVAILLLLILLSLSNYYSIQLSNSYVLKYRVYTIKSHLIAKANIEKKKKKKKKKQIKNFQFG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.9	Very low	45.2	Very low	225 Å²	225	146.5 Å²	146.5	100%	1.108	82%	0.815	S	S	*	*				0	94.9	0	-152.8	164.1	-168.3	0	0	107
2	A	37.6	Very low	45	Very low	102 Å²	102	141.1 Å²	141.1	84%	0.843	80%	0.795	S	S	*	*			trans	-97.3	110.1	178.2	0	0	0	0	0	107.8	K4	A2-K4 PolarHBondContact O-N 3.09Å
3	F	46.8	Very low	45	Very low	182 Å²	182	137.9 Å²	137.9	80%	0.798	79%	0.787	S	S	*	*			trans	-68.7	100.9	173.9	-88.7	-92.2	0	0	0	108.8	V5	F3-V5 PolarHBondContact O-N 3.45Å
4	K	52.9	Low	44.7	Very low	195 Å²	195	139.5 Å²	139.5	85%	0.848	79%	0.792	S	S	*	*			trans	-79.5	90.5	168.4	-164.5	180	-175.6	-173.4	0	107.2	A2 G6	A2-K4 PolarHBondContact O-N 3.09Å; K4-G6 PolarHBondContact O-N 3.48Å; K4-G6 VanDerWaalsContact O-N 3.1Å
5	V	53.8	Low	44.2	Very low	128 Å²	128	143.5 Å²	143.5	78%	0.776	80%	0.798	S	S	*	*			trans	-73.5	99.5	169	-178.5	0	0	0	0	106.6	F3	F3-V5 PolarHBondContact O-N 3.45Å
6	G	44.1	Very low	43.4	Very low	52 Å²	52	139.2 Å²	139.2	54%	0.536	78%	0.78	S	S	.	*			trans	-72.4	132.5	-178.6	0	0	0	0	0	111.8	K4	K4-G6 PolarHBondContact O-N 3.48Å; K4-G6 VanDerWaalsContact O-N 3.1Å
7	C	46.5	Very low	43.4	Very low	128 Å²	128	138.5 Å²	138.5	87%	0.865	78%	0.78	S	S	*	*			trans	-105.7	61.5	160.3	-67	0	0	0	0	108.2
8	D	46.9	Very low	43.2	Very low	136 Å²	136	141.4 Å²	141.4	73%	0.727	79%	0.787	S	S	*	*			trans	-106.5	111.4	176.1	-72.9	-40.3	0	0	0	109.9
9	N	42.5	Very low	43.4	Very low	149 Å²	149	140 Å²	140	80%	0.797	78%	0.782	S	S	*	*			trans	48.6	91.9	153.1	-65.2	-25.1	0	0	0	119.1
10	F	43.1	Very low	43.5	Very low	204 Å²	204	139.5 Å²	139.5	90%	0.895	78%	0.782	S	S	*	*			trans	-94.6	93.5	146.6	-137.4	-91.9	0	0	0	109.2
11	S	39.6	Very low	43.9	Very low	111 Å²	111	137.3 Å²	137.3	78%	0.776	78%	0.775	S	S	*	*			trans	-84.2	105.4	167.1	61.5	0	0	0	0	109.5
12	S	42.5	Very low	44.9	Very low	81 Å²	81	129.3 Å²	129.3	57%	0.566	74%	0.741	S	S	*	*			trans	173.2	112	146.5	54.1	0	0	0	0	110.2
13	S	44.5	Very low	45.8	Very low	100 Å²	100	130 Å²	130	70%	0.699	74%	0.737	S	S	*	*			trans	40.7	118.2	141.7	56.7	0	0	0	0	119.9
14	N	41	Very low	46.9	Very low	160 Å²	160	124.9 Å²	124.9	86%	0.856	72%	0.724	S	S	*	*			trans	94.8	114.5	153.7	-57.6	-21.8	0	0	0	118.8
15	F	37.8	Very low	47.5	Very low	199 Å²	199	117.1 Å²	117.1	87%	0.873	70%	0.7	S	S	*	*			trans	79.4	103.3	142.4	-146.2	-111	0	0	0	119.3
16	S	31.6	Very low	48.1	Very low	75 Å²	75	113.4 Å²	113.4	52%	0.524	68%	0.682	S	S	.	*			trans	50	107.5	140	69.4	0	0	0	0	119.9
17	T	43.2	Very low	49.3	Very low	127 Å²	127	113.9 Å²	113.9	78%	0.779	68%	0.681	S	S	*	*				175.5	98.4	112.9	26.7	0	0	0	0	108.1	V19	T17-V19 VanDerWaalsContact C-N 3.33Å; T17-V19 PolarHBondContact O-N 3.3Å
18	Q	39.8	Very low	50.3	Low	191 Å²	191	113.6 Å²	113.6	89%	0.893	67%	0.67	S	S	*	*			trans	-70.5	96.5	164.5	-74.9	179.9	-4.8	0	0	107.2	V20	Q18-V20 PolarHBondContact O-N 3.28Å
19	V	47	Very low	51.4	Low	115 Å²	115	113.8 Å²	113.8	70%	0.697	67%	0.665	S	S	*	*			trans	-66	102.5	165	179.4	0	0	0	0	106.1	T17 C21	T17-V19 VanDerWaalsContact C-N 3.33Å; T17-V19 PolarHBondContact O-N 3.3Å; V19-C21 PolarHBondContact O-N 3.21Å
20	V	45.1	Very low	52.7	Low	130 Å²	130	110 Å²	110	79%	0.788	65%	0.649	S	S	*	*			trans	-67.1	88.1	172.5	-179.5	0	0	0	0	107.1	Q18 S22	Q18-V20 PolarHBondContact O-N 3.28Å; V20-S22 PolarHBondContact O-N 3.43Å; V20-S22 VanDerWaalsContact O-N 3.1Å
21	C	52.2	Low	54	Low	94 Å²	94	105.7 Å²	105.7	64%	0.635	63%	0.63	S	S	*	*			trans	-69.2	104.3	169	-68.2	0	0	0	0	107.7	V19	V19-C21 PolarHBondContact O-N 3.21Å
22	S	64.6	Low	55.4	Low	56 Å²	56	106.2 Å²	106.2	39%	0.392	62%	0.621	S	S	.	*			trans	-61.7	137.1	162.5	56.7	0	0	0	0	107.9	V20 S24 G25 A26	V20-S22 PolarHBondContact O-N 3.43Å; V20-S22 VanDerWaalsContact O-N 3.1Å; S22-S24 PolarHBondContact O-N 3.15Å; S22-S24 VanDerWaalsContact O-N 3.09Å; S22-S24 PolarHBondContact OG-OG 3.42Å; S22-G25 PolarHBondContact O-N 3.41Å; S22-G25 PolarHBondContact OG-N 3.05Å; S22-A26 PolarHBondContact O-N 3.42Å; S22-A26 VanDerWaalsContact O-N 3.11Å
23	P	56.8	Low	56.6	Low	116 Å²	116	105.6 Å²	105.6	75%	0.753	61%	0.613	S	S	*	*	H	α-helix	trans	-57.5	-27.2	178.7	19.8	-30.5	0	0	0	112	A27	P23-A27 WeakPolarHBondContact O-CB 3.49Å; P23-A27 PolarHBondContact O-N 3.39Å; P23-A27 VanDerWaalsContact O-N 3.13Å
24	S	69.6	Low	57.7	Low	75 Å²	75	105.6 Å²	105.6	52%	0.524	61%	0.605	S	S	.	*	H	α-helix	trans	-68.5	-39.6	171.9	51.2	0	0	0	0	113.5	S22 A27 L28	S22-S24 PolarHBondContact O-N 3.15Å; S22-S24 VanDerWaalsContact O-N 3.09Å; S22-S24 PolarHBondContact OG-OG 3.42Å; S24-A27 PolarHBondContact O-N 3.32Å; S24-L28 WeakPolarHBondContact O-CG 3.38Å; S24-L28 PolarHBondContact O-N 3.25Å
25	G	65.8	Low	59	Low	33 Å²	33	100.1 Å²	100.1	34%	0.34	57%	0.573	S	S	.	*	H	α-helix	trans	-68.1	-41.7	177.2	0	0	0	0	0	112.5	S22 A27 L28 F29	S22-G25 PolarHBondContact O-N 3.41Å; S22-G25 PolarHBondContact OG-N 3.05Å; G25-A27 VanDerWaalsContact C-N 3.35Å; G25-A27 PolarHBondContact O-N 3.44Å; G25-L28 PolarHBondContact O-N 3.25Å; G25-F29 WeakPolarHBondContact O-CB 3.44Å; G25-F29 PolarHBondContact O-N 3.47Å
26	A	66.3	Low	60.3	Low	50 Å²	50	94 Å²	94	41%	0.413	56%	0.555	S	S	.	*	H	α-helix	trans	-65.1	-38	175.6	0	0	0	0	0	112.2	S22 C30	S22-A26 PolarHBondContact O-N 3.42Å; S22-A26 VanDerWaalsContact O-N 3.11Å; A26-C30 WeakPolarHBondContact O-CB 3.43Å; A26-C30 PolarHBondContact O-N 3.4Å
27	A	68	Low	61.7	Low	61 Å²	61	94.1 Å²	94.1	50%	0.504	56%	0.556	S	S	.	*	H	α-helix	trans	-67	-43.4	176.4	0	0	0	0	0	112.3	P23 S24 G25 C30 F31	P23-A27 WeakPolarHBondContact O-CB 3.49Å; P23-A27 PolarHBondContact O-N 3.39Å; P23-A27 VanDerWaalsContact O-N 3.13Å; S24-A27 PolarHBondContact O-N 3.32Å; G25-A27 VanDerWaalsContact C-N 3.35Å; G25-A27 PolarHBondContact O-N 3.44Å; A27-C30 PolarHBondContact O-N 3.43Å; A27-F31 WeakPolarHBondContact O-CB 3.45Å; A27-F31 PolarHBondContact O-N 2.99Å
28	L	69	Low	62.7	Low	123 Å²	123	90.6 Å²	90.6	64%	0.644	54%	0.535	S	S	*	.	H	α-helix	trans	-65.6	-45.2	177	-75.1	171.2	0	0	0	111.9	S24 G25 C30 F31 E32	S24-L28 WeakPolarHBondContact O-CG 3.38Å; S24-L28 PolarHBondContact O-N 3.25Å; G25-L28 PolarHBondContact O-N 3.25Å; L28-C30 VanDerWaalsContact C-N 3.35Å; L28-C30 PolarHBondContact O-N 3.46Å; L28-F31 PolarHBondContact O-N 3.44Å; L28-E32 PolarHBondContact O-N 3.22Å
29	F	69.3	Low	63.7	Low	139 Å²	139	85 Å²	85	61%	0.61	51%	0.513	S	S	*	.	H	α-helix	trans	-63.3	-41.1	175.8	-176.6	-102.1	0	0	0	111.7	G25 F31 E32 V33	G25-F29 WeakPolarHBondContact O-CB 3.44Å; G25-F29 PolarHBondContact O-N 3.47Å; F29-F31 VanDerWaalsContact C-N 3.34Å; F29-F31 PolarHBondContact O-N 3.03Å; F29-E32 PolarHBondContact O-N 3.13Å; F29-V33 HydrophobicContact CD1-CG2 4.11Å; F29-V33 HydrophobicContact CE1-CG2 3.74Å; F29-V33 HydrophobicContact CE2-CG2 4.21Å; F29-V33 HydrophobicContact CZ-CG2 3.79Å; F29-V33 WeakPolarHBondContact O-CB 3.29Å; F29-V33 VanDerWaalsContact O-CG2 3.27Å; F29-V33 WeakPolarHBondContact O-CG2 3.44Å; F29-V33 PolarHBondContact O-N 3.13Å
30	C	69.8	Low	64.3	Low	69 Å²	69	83 Å²	83	47%	0.466	52%	0.517	S	S	.	.	H	α-helix	trans	-63.1	-40.8	175.3	-170.9	0	0	0	0	111.6	A26 A27 L28 V33 L34	A26-C30 WeakPolarHBondContact O-CB 3.43Å; A26-C30 PolarHBondContact O-N 3.4Å; A27-C30 PolarHBondContact O-N 3.43Å; L28-C30 VanDerWaalsContact C-N 3.35Å; L28-C30 PolarHBondContact O-N 3.46Å; C30-V33 PolarHBondContact O-N 2.9Å; C30-L34 VanDerWaalsContact O-CB 3.26Å; C30-L34 WeakPolarHBondContact O-CB 3.43Å; C30-L34 WeakPolarHBondContact O-CD1 3.29Å; C30-L34 WeakPolarHBondContact O-CG 3.35Å; C30-L34 PolarHBondContact O-N 3.27Å
31	F	70.3	Confident	64.9	Low	115 Å²	115	80 Å²	80	50%	0.504	50%	0.501	S	S	.	.	H	α-helix	trans	-63.7	-43.1	174.4	-176.3	-95.3	0	0	0	111.8	A27 L28 F29 L34 F35	A27-F31 WeakPolarHBondContact O-CB 3.45Å; A27-F31 PolarHBondContact O-N 2.99Å; L28-F31 PolarHBondContact O-N 3.44Å; F29-F31 VanDerWaalsContact C-N 3.34Å; F29-F31 PolarHBondContact O-N 3.03Å; F31-L34 PolarHBondContact O-N 2.97Å; F31-F35 WeakPolarHBondContact O-CB 3.36Å; F31-F35 PolarHBondContact O-N 3.49Å
32	E	68.4	Low	65.2	Low	122 Å²	122	81.5 Å²	81.5	57%	0.57	51%	0.512	S	S	*	.	H	α-helix	trans	-64.9	-42.2	177.6	-171.8	-179	176.3	0	0	112	L28 F29 F35 S36	L28-E32 PolarHBondContact O-N 3.22Å; F29-E32 PolarHBondContact O-N 3.13Å; E32-F35 PolarHBondContact O-N 2.94Å; E32-S36 VanDerWaalsContact O-CB 3.28Å; E32-S36 WeakPolarHBondContact O-CB 3.42Å; E32-S36 PolarHBondContact O-N 2.87Å; E32-S36 PolarHBondContact O-OG 2.98Å
33	V	68.8	Low	64.9	Low	67 Å²	67	81.6 Å²	81.6	41%	0.406	51%	0.511	S	S	.	.	H	α-helix	trans	-65.5	-45.3	175.3	172.2	0	0	0	0	110.8	F29 C30 F35 S36 S37	F29-V33 HydrophobicContact CD1-CG2 4.11Å; F29-V33 HydrophobicContact CE1-CG2 3.74Å; F29-V33 HydrophobicContact CE2-CG2 4.21Å; F29-V33 HydrophobicContact CZ-CG2 3.79Å; F29-V33 WeakPolarHBondContact O-CB 3.29Å; F29-V33 VanDerWaalsContact O-CG2 3.27Å; F29-V33 WeakPolarHBondContact O-CG2 3.44Å; F29-V33 PolarHBondContact O-N 3.13Å; C30-V33 PolarHBondContact O-N 2.9Å; V33-F35 VanDerWaalsContact C-N 3.35Å; V33-S36 PolarHBondContact O-N 3.32Å; V33-S37 VanDerWaalsContact O-CB 3.32Å; V33-S37 WeakPolarHBondContact O-CB 3.45Å; V33-S37 PolarHBondContact O-N 2.98Å; V33-S37 PolarHBondContact O-OG 3.41Å
34	L	67.9	Low	65.4	Low	101 Å²	101	81.8 Å²	81.8	53%	0.529	51%	0.505	S	S	.	.	H	α-helix	trans	-59.5	-46.6	174.2	-83.2	160.6	0	0	0	110.9	C30 F31 S37 T38	C30-L34 VanDerWaalsContact O-CB 3.26Å; C30-L34 WeakPolarHBondContact O-CB 3.43Å; C30-L34 WeakPolarHBondContact O-CD1 3.29Å; C30-L34 WeakPolarHBondContact O-CG 3.35Å; C30-L34 PolarHBondContact O-N 3.27Å; F31-L34 PolarHBondContact O-N 2.97Å; L34-S37 WeakPolarHBondContact O-CB 3.43Å; L34-S37 PolarHBondContact O-N 3.32Å; L34-T38 VanDerWaalsContact O-CG2 3.26Å; L34-T38 WeakPolarHBondContact O-CG2 3.33Å; L34-T38 PolarHBondContact O-N 2.88Å; L34-T38 PolarHBondContact O-OG1 3.38Å
35	F	66.7	Low	65.4	Low	45 Å²	45	82.3 Å²	82.3	20%	0.197	51%	0.509	C	S	.	.	H	α-helix	trans	-60.5	-48.5	179.7	-172	-90.3	0	0	0	111.5	F31 E32 V33 S37 T38 T39 L48 F52	F31-F35 WeakPolarHBondContact O-CB 3.36Å; F31-F35 PolarHBondContact O-N 3.49Å; E32-F35 PolarHBondContact O-N 2.94Å; V33-F35 VanDerWaalsContact C-N 3.35Å; F35-S37 VanDerWaalsContact C-N 3.27Å; F35-S37 PolarHBondContact O-N 3.5Å; F35-T38 WeakPolarHBondContact CA-OG1 3.37Å; F35-T38 PolarHBondContact O-N 3.37Å; F35-T38 VanDerWaalsContact O-N 3.11Å; F35-T38 PolarHBondContact O-OG1 2.94Å; F35-T39 HydrophobicContact CD1-CG2 4.23Å; F35-T39 HydrophobicContact CE1-CG2 3.63Å; F35-T39 HydrophobicContact CZ-CG2 3.82Å; F35-T39 PolarHBondContact O-N 3.19Å; F35-T39 PolarHBondContact O-OG1 3.37Å; F35-L48 HydrophobicContact CD2-CD1 4.26Å; F35-L48 HydrophobicContact CE2-CD1 3.31Å; F35-L48 HydrophobicContact CE2-CG 3.94Å; F35-L48 HydrophobicContact CZ-CD1 3.47Å; F35-L48 VanDerWaalsContact CZ-CD1 3.47Å; F35-L48 HydrophobicContact CZ-CD2 3.84Å; F35-L48 HydrophobicContact CZ-CG 3.76Å; F35-F52 HydrophobicContact CD1-CZ 4.5Å; F35-F52 HydrophobicContact CD2-CZ 4.4Å; F35-F52 AromaticContact CE1-CE2 3.97Å; F35-F52 HydrophobicContact CE1-CE2 3.97Å; F35-F52 AromaticContact CE1-CZ 3.6Å; F35-F52 HydrophobicContact CE1-CZ 3.6Å; F35-F52 HydrophobicContact CE2-CD2 4.25Å; F35-F52 HydrophobicContact CE2-CE1 4.17Å; F35-F52 AromaticContact CE2-CE2 3.53Å; F35-F52 HydrophobicContact CE2-CE2 3.53Å; F35-F52 AromaticContact CE2-CZ 3.46Å; F35-F52 HydrophobicContact CE2-CZ 3.46Å; F35-F52 VanDerWaalsContact CE2-CZ 3.46Å; F35-F52 HydrophobicContact CZ-CD2 4.12Å; F35-F52 HydrophobicContact CZ-CE1 4.12Å; F35-F52 AromaticContact CZ-CE2 3.06Å; F35-F52 HydrophobicContact CZ-CE2 3.06Å; F35-F52 AromaticContact CZ-CZ 3.03Å; F35-F52 HydrophobicContact CZ-CZ 3.03Å
36	S	65	Low	65.5	Low	69 Å²	69	86 Å²	86	48%	0.483	52%	0.517	S	S	.	.	H	α-helix	trans	-63.9	-32	176.3	-56.8	0	0	0	0	112.7	E32 V33 T39	E32-S36 VanDerWaalsContact O-CB 3.28Å; E32-S36 WeakPolarHBondContact O-CB 3.42Å; E32-S36 PolarHBondContact O-N 2.87Å; E32-S36 PolarHBondContact O-OG 2.98Å; V33-S36 PolarHBondContact O-N 3.32Å; S36-T39 PolarHBondContact O-OG1 3.24Å
37	S	61.7	Low	65.7	Low	79 Å²	79	86.2 Å²	86.2	55%	0.552	52%	0.516	S	S	*	.	H	α-helix	trans	-72.7	-34.6	174.6	-54.5	0	0	0	0	111.5	V33 L34 F35	V33-S37 VanDerWaalsContact O-CB 3.32Å; V33-S37 WeakPolarHBondContact O-CB 3.45Å; V33-S37 PolarHBondContact O-N 2.98Å; V33-S37 PolarHBondContact O-OG 3.41Å; L34-S37 WeakPolarHBondContact O-CB 3.43Å; L34-S37 PolarHBondContact O-N 3.32Å; F35-S37 VanDerWaalsContact C-N 3.27Å; F35-S37 PolarHBondContact O-N 3.5Å
38	T	63.9	Low	65.6	Low	53 Å²	53	84.9 Å²	84.9	33%	0.325	50%	0.5	S	S	.	.	H	α-helix	trans	-76.5	-34.3	-179.8	57.4	0	0	0	0	113.4	L34 F35 G40 S41 V43	L34-T38 VanDerWaalsContact O-CG2 3.26Å; L34-T38 WeakPolarHBondContact O-CG2 3.33Å; L34-T38 PolarHBondContact O-N 2.88Å; L34-T38 PolarHBondContact O-OG1 3.38Å; F35-T38 WeakPolarHBondContact CA-OG1 3.37Å; F35-T38 PolarHBondContact O-N 3.37Å; F35-T38 VanDerWaalsContact O-N 3.11Å; F35-T38 PolarHBondContact O-OG1 2.94Å; T38-G40 PolarHBondContact O-N 3.4Å; T38-S41 PolarHBondContact O-N 2.96Å; T38-S41 VanDerWaalsContact O-O 3.11Å; T38-S41 PolarHBondContact O-OG 2.94Å; T38-V43 VanDerWaalsContact O-CG2 3.3Å; T38-V43 WeakPolarHBondContact O-CG2 3.31Å
39	T	60.9	Low	65.9	Low	73 Å²	73	85.1 Å²	85.1	45%	0.448	50%	0.498	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71.3	-15.3	178.5	48.9	0	0	0	0	114.1	F35 S36 L48	F35-T39 HydrophobicContact CD1-CG2 4.23Å; F35-T39 HydrophobicContact CE1-CG2 3.63Å; F35-T39 HydrophobicContact CZ-CG2 3.82Å; F35-T39 PolarHBondContact O-N 3.19Å; F35-T39 PolarHBondContact O-OG1 3.37Å; S36-T39 PolarHBondContact O-OG1 3.24Å; T39-L48 HydrophobicContact CG2-CD1 4Å; T39-L48 HydrophobicContact CG2-CD2 3.65Å; T39-L48 HydrophobicContact CG2-CG 4.48Å
40	G	59.9	Low	66.2	Low	74 Å²	74	86.4 Å²	86.4	76%	0.763	50%	0.499	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.6	-11.5	173.3	0	0	0	0	0	114.6	T38	T38-G40 PolarHBondContact O-N 3.4Å
41	S	58.3	Low	66.5	Low	65 Å²	65	88.6 Å²	88.6	46%	0.455	51%	0.505	S	S	.	.	S	Bend	trans	-98.8	153.9	169.6	63.9	0	0	0	0	109	T38 V43	T38-S41 PolarHBondContact O-N 2.96Å; T38-S41 VanDerWaalsContact O-O 3.11Å; T38-S41 PolarHBondContact O-OG 2.94Å; S41-V43 PolarHBondContact O-N 2.94Å; S41-V43 WeakPolarHBondContact OG-CG2 3.4Å
42	S	58.2	Low	66.8	Low	126 Å²	126	88 Å²	88	88%	0.881	50%	0.503	S	S	*	.			trans	-63.9	56.7	-179.6	57.6	0	0	0	0	113.3
43	V	59.1	Low	67.3	Low	59 Å²	59	87.1 Å²	87.1	36%	0.358	50%	0.502	S	S	.	.			trans	-78.6	118.3	170.1	177.3	0	0	0	0	105.7	T38 S41 S45	T38-V43 VanDerWaalsContact O-CG2 3.3Å; T38-V43 WeakPolarHBondContact O-CG2 3.31Å; S41-V43 PolarHBondContact O-N 2.94Å; S41-V43 WeakPolarHBondContact OG-CG2 3.4Å; V43-S45 PolarHBondContact O-N 2.95Å; V43-S45 VanDerWaalsContact O-N 3.08Å
44	D	67.5	Low	68	Low	119 Å²	119	85.8 Å²	85.8	64%	0.636	50%	0.502	S	S	*	.			trans	-48.8	119.5	176.6	-64.8	-53.1	0	0	0	109	E46 S47 L48	D44-E46 PolarHBondContact O-N 3.26Å; D44-S47 WeakPolarHBondContact O-CB 3.38Å; D44-S47 PolarHBondContact O-N 2.95Å; D44-L48 PolarHBondContact O-N 3.31Å
45	S	68.2	Low	68.7	Low	86 Å²	86	84.3 Å²	84.3	60%	0.601	50%	0.497	S	S	*	.	H	α-helix	trans	-50.2	-30.2	-178.4	-54	0	0	0	0	112.2	V43 S47 L48 E49	V43-S45 PolarHBondContact O-N 2.95Å; V43-S45 VanDerWaalsContact O-N 3.08Å; S45-S47 VanDerWaalsContact C-N 3.33Å; S45-S47 PolarHBondContact O-N 3.07Å; S45-L48 WeakPolarHBondContact O-CB 3.45Å; S45-L48 PolarHBondContact O-N 2.92Å; S45-E49 WeakPolarHBondContact O-CG 3.37Å; S45-E49 PolarHBondContact O-N 3.36Å
46	E	69.2	Low	69.4	Low	110 Å²	110	84.9 Å²	84.9	51%	0.514	51%	0.51	S	S	.	.	H	α-helix	trans	-59.5	-38	174.4	-170.1	-179.7	176	0	0	113.2	D44 R50	D44-E46 PolarHBondContact O-N 3.26Å; E46-R50 VanDerWaalsContact O-CG 3.28Å; E46-R50 WeakPolarHBondContact O-CG 3.36Å; E46-R50 PolarHBondContact O-N 3.38Å; E46-R50 VanDerWaalsContact O-N 3.13Å; E46-R50 IonicContact OE1-CZ 3.41Å; E46-R50 IonicContact OE1-NE 3.72Å; E46-R50 IonicContact OE1-NH2 2.65Å; E46-R50 PolarHBondContact OE1-NH2 3.2Å
47	S	68.8	Low	70.4	Confident	56 Å²	56	86.5 Å²	86.5	39%	0.392	51%	0.512	S	S	.	.	H	α-helix	trans	-71.3	-35.4	176.9	-64.8	0	0	0	0	111.8	D44 S45 L51	D44-S47 WeakPolarHBondContact O-CB 3.38Å; D44-S47 PolarHBondContact O-N 2.95Å; S45-S47 VanDerWaalsContact C-N 3.33Å; S45-S47 PolarHBondContact O-N 3.07Å; S47-L51 WeakPolarHBondContact O-CG 3.5Å; S47-L51 PolarHBondContact O-N 3.45Å; S47-L51 VanDerWaalsContact O-N 3.09Å
48	L	67.7	Low	71.5	Confident	33 Å²	33	87.7 Å²	87.7	17%	0.173	51%	0.512	C	S	.	.	H	α-helix	trans	-68.5	-43.6	177.4	-160.9	75.1	0	0	0	111.3	F35 T39 D44 S45 L51 F52	F35-L48 HydrophobicContact CD2-CD1 4.26Å; F35-L48 HydrophobicContact CE2-CD1 3.31Å; F35-L48 HydrophobicContact CE2-CG 3.94Å; F35-L48 HydrophobicContact CZ-CD1 3.47Å; F35-L48 VanDerWaalsContact CZ-CD1 3.47Å; F35-L48 HydrophobicContact CZ-CD2 3.84Å; F35-L48 HydrophobicContact CZ-CG 3.76Å; T39-L48 HydrophobicContact CG2-CD1 4Å; T39-L48 HydrophobicContact CG2-CD2 3.65Å; T39-L48 HydrophobicContact CG2-CG 4.48Å; D44-L48 PolarHBondContact O-N 3.31Å; S45-L48 WeakPolarHBondContact O-CB 3.45Å; S45-L48 PolarHBondContact O-N 2.92Å; L48-L51 PolarHBondContact O-N 3.45Å; L48-F52 HydrophobicContact CD2-CE2 4.29Å; L48-F52 HydrophobicContact CG-CD2 4.19Å; L48-F52 HydrophobicContact CG-CE2 4.08Å; L48-F52 WeakPolarHBondContact O-CD2 3.45Å; L48-F52 PolarHBondContact O-N 2.89Å
49	E	73.6	Confident	72.7	Confident	128 Å²	128	90.2 Å²	90.2	60%	0.598	52%	0.523	S	S	*	.	H	α-helix	trans	-59.6	-46.5	175.1	-74.7	178	177.4	0	0	111.1	S45 L51 F52 D53	S45-E49 WeakPolarHBondContact O-CG 3.37Å; S45-E49 PolarHBondContact O-N 3.36Å; E49-L51 VanDerWaalsContact C-N 3.32Å; E49-L51 PolarHBondContact O-N 2.96Å; E49-F52 PolarHBondContact O-N 3.47Å; E49-D53 PolarHBondContact O-N 3.44Å
50	R	76.9	Confident	74.1	Confident	165 Å²	165	92.3 Å²	92.3	62%	0.623	53%	0.53	S	S	*	.	H	α-helix	trans	-61.7	-36.9	176.2	-71.8	174.3	-176.8	-172.4	4	113.3	E46 G54	E46-R50 VanDerWaalsContact O-CG 3.28Å; E46-R50 WeakPolarHBondContact O-CG 3.36Å; E46-R50 PolarHBondContact O-N 3.38Å; E46-R50 VanDerWaalsContact O-N 3.13Å; E46-R50 IonicContact OE1-CZ 3.41Å; E46-R50 IonicContact OE1-NE 3.72Å; E46-R50 IonicContact OE1-NH2 2.65Å; E46-R50 PolarHBondContact OE1-NH2 3.2Å; R50-G54 PolarHBondContact O-N 3.46Å
51	L	74.7	Confident	75.6	Confident	116 Å²	116	93.2 Å²	93.2	61%	0.607	52%	0.518	S	S	*	.	H	α-helix	trans	-67.3	-44.5	176	-80.1	168.5	0	0	0	111.5	S47 L48 E49 G54 V55	S47-L51 WeakPolarHBondContact O-CG 3.5Å; S47-L51 PolarHBondContact O-N 3.45Å; S47-L51 VanDerWaalsContact O-N 3.09Å; L48-L51 PolarHBondContact O-N 3.45Å; E49-L51 VanDerWaalsContact C-N 3.32Å; E49-L51 PolarHBondContact O-N 2.96Å; L51-G54 PolarHBondContact O-N 3.02Å; L51-V55 WeakPolarHBondContact O-CG2 3.44Å; L51-V55 PolarHBondContact O-N 2.93Å
52	F	78	Confident	77.2	Confident	102 Å²	102	94.4 Å²	94.4	45%	0.447	52%	0.518	S	S	.	.	H	α-helix	trans	-62.3	-42.7	175.7	-86.9	-62.7	0	0	0	112.5	F35 L48 E49 G54 V55 A56	F35-F52 HydrophobicContact CD1-CZ 4.5Å; F35-F52 HydrophobicContact CD2-CZ 4.4Å; F35-F52 AromaticContact CE1-CE2 3.97Å; F35-F52 HydrophobicContact CE1-CE2 3.97Å; F35-F52 AromaticContact CE1-CZ 3.6Å; F35-F52 HydrophobicContact CE1-CZ 3.6Å; F35-F52 HydrophobicContact CE2-CD2 4.25Å; F35-F52 HydrophobicContact CE2-CE1 4.17Å; F35-F52 AromaticContact CE2-CE2 3.53Å; F35-F52 HydrophobicContact CE2-CE2 3.53Å; F35-F52 AromaticContact CE2-CZ 3.46Å; F35-F52 HydrophobicContact CE2-CZ 3.46Å; F35-F52 VanDerWaalsContact CE2-CZ 3.46Å; F35-F52 HydrophobicContact CZ-CD2 4.12Å; F35-F52 HydrophobicContact CZ-CE1 4.12Å; F35-F52 AromaticContact CZ-CE2 3.06Å; F35-F52 HydrophobicContact CZ-CE2 3.06Å; F35-F52 AromaticContact CZ-CZ 3.03Å; F35-F52 HydrophobicContact CZ-CZ 3.03Å; L48-F52 HydrophobicContact CD2-CE2 4.29Å; L48-F52 HydrophobicContact CG-CD2 4.19Å; L48-F52 HydrophobicContact CG-CE2 4.08Å; L48-F52 WeakPolarHBondContact O-CD2 3.45Å; L48-F52 PolarHBondContact O-N 2.89Å; E49-F52 PolarHBondContact O-N 3.47Å; F52-G54 VanDerWaalsContact C-N 3.3Å; F52-G54 PolarHBondContact O-N 2.92Å; F52-V55 PolarHBondContact O-N 3.46Å; F52-A56 WeakPolarHBondContact O-CB 3.32Å; F52-A56 PolarHBondContact O-N 3.41Å
53	D	79.3	Confident	78.9	Confident	103 Å²	103	93 Å²	93	55%	0.551	50%	0.5	S	S	*	.	H	α-helix	trans	-59.2	-43.7	174.9	-77.9	-18.5	0	0	0	110.9	E49 V55 A56 I57	E49-D53 PolarHBondContact O-N 3.44Å; D53-V55 PolarHBondContact O-N 3.25Å; D53-A56 PolarHBondContact O-N 2.89Å; D53-I57 WeakPolarHBondContact O-CB 3.15Å; D53-I57 WeakPolarHBondContact O-CD1 3.34Å; D53-I57 WeakPolarHBondContact O-CG1 3.31Å; D53-I57 PolarHBondContact O-N 2.96Å
54	G	82	Confident	80.5	Confident	40 Å²	40	95 Å²	95	41%	0.412	51%	0.508	S	S	.	.	H	α-helix	trans	-59.9	-44.8	175.2	0	0	0	0	0	113.2	R50 L51 F52 I57 L58	R50-G54 PolarHBondContact O-N 3.46Å; L51-G54 PolarHBondContact O-N 3.02Å; F52-G54 VanDerWaalsContact C-N 3.3Å; F52-G54 PolarHBondContact O-N 2.92Å; G54-I57 PolarHBondContact O-N 3.37Å; G54-L58 WeakPolarHBondContact O-CB 3.45Å; G54-L58 PolarHBondContact O-N 3.23Å
55	V	83.4	Confident	81.6	Confident	70 Å²	70	92.9 Å²	92.9	42%	0.424	50%	0.503	S	S	.	.	H	α-helix	trans	-67.2	-40.6	177.9	174.6	0	0	0	0	111.3	L51 F52 D53 L58 L59	L51-V55 WeakPolarHBondContact O-CG2 3.44Å; L51-V55 PolarHBondContact O-N 2.93Å; F52-V55 PolarHBondContact O-N 3.46Å; D53-V55 PolarHBondContact O-N 3.25Å; V55-L58 PolarHBondContact O-N 3.08Å; V55-L59 WeakPolarHBondContact O-CB 3.33Å; V55-L59 PolarHBondContact O-N 2.94Å
56	A	80.3	Confident	82.8	Confident	56 Å²	56	92.6 Å²	92.6	46%	0.463	49%	0.494	S	S	.	.	H	α-helix	trans	-63.6	-42.4	177.2	0	0	0	0	0	111.6	F52 D53 L59 L60	F52-A56 WeakPolarHBondContact O-CB 3.32Å; F52-A56 PolarHBondContact O-N 3.41Å; D53-A56 PolarHBondContact O-N 2.89Å; A56-L59 PolarHBondContact O-N 3.43Å; A56-L60 WeakPolarHBondContact O-CB 3.42Å; A56-L60 PolarHBondContact O-N 3.43Å
57	I	85.8	Confident	83.9	Confident	103 Å²	103	90.6 Å²	90.6	53%	0.528	49%	0.492	S	S	.	.	H	α-helix	trans	-62.1	-45	174.1	-68.4	163.9	0	0	0	110.4	D53 G54 L59 L60 L61	D53-I57 WeakPolarHBondContact O-CB 3.15Å; D53-I57 WeakPolarHBondContact O-CD1 3.34Å; D53-I57 WeakPolarHBondContact O-CG1 3.31Å; D53-I57 PolarHBondContact O-N 2.96Å; G54-I57 PolarHBondContact O-N 3.37Å; I57-L59 VanDerWaalsContact C-N 3.35Å; I57-L59 PolarHBondContact O-N 2.98Å; I57-L60 WeakPolarHBondContact O-CB 3.14Å; I57-L60 PolarHBondContact O-N 3.38Å; I57-L61 HydrophobicContact CG2-CD1 4.19Å; I57-L61 WeakPolarHBondContact O-CG 3.37Å; I57-L61 PolarHBondContact O-N 3.46Å
58	L	85.4	Confident	85.1	Confident	104 Å²	104	92.1 Å²	92.1	55%	0.545	50%	0.496	S	S	.	.	H	α-helix	trans	-61.2	-44.3	177.6	-176.1	64.8	0	0	0	111.6	G54 V55 L60 L61 I62	G54-L58 WeakPolarHBondContact O-CB 3.45Å; G54-L58 PolarHBondContact O-N 3.23Å; V55-L58 PolarHBondContact O-N 3.08Å; L58-L60 VanDerWaalsContact C-N 3.33Å; L58-L60 PolarHBondContact O-N 3.31Å; L58-L61 PolarHBondContact O-N 3.35Å; L58-I62 HydrophobicContact CG-CD1 4.18Å; L58-I62 VanDerWaalsContact O-CG1 3.32Å; L58-I62 WeakPolarHBondContact O-CG1 3.34Å; L58-I62 PolarHBondContact O-N 2.89Å
59	L	89.9	Confident	86.2	Confident	106 Å²	106	96.9 Å²	96.9	56%	0.555	51%	0.512	S	S	*	.	H	α-helix	trans	-60.9	-43.6	176.2	-167.5	102.4	0	0	0	111.2	V55 A56 I57 L61 I62 L63	V55-L59 WeakPolarHBondContact O-CB 3.33Å; V55-L59 PolarHBondContact O-N 2.94Å; A56-L59 PolarHBondContact O-N 3.43Å; I57-L59 VanDerWaalsContact C-N 3.35Å; I57-L59 PolarHBondContact O-N 2.98Å; L59-L61 PolarHBondContact O-N 3.48Å; L59-I62 PolarHBondContact O-N 3.18Å; L59-L63 HydrophobicContact CD2-CD1 4.07Å; L59-L63 HydrophobicContact CG-CD1 4.37Å; L59-L63 WeakPolarHBondContact O-CG 3.16Å; L59-L63 PolarHBondContact O-N 2.93Å
60	L	90	Very high	87	Confident	117 Å²	117	97.6 Å²	97.6	61%	0.613	51%	0.511	S	S	*	.	H	α-helix	trans	-61.5	-42.6	177.3	-174.5	67.4	0	0	0	111.8	A56 I57 L58 L63 L64	A56-L60 WeakPolarHBondContact O-CB 3.42Å; A56-L60 PolarHBondContact O-N 3.43Å; I57-L60 WeakPolarHBondContact O-CB 3.14Å; I57-L60 PolarHBondContact O-N 3.38Å; L58-L60 VanDerWaalsContact C-N 3.33Å; L58-L60 PolarHBondContact O-N 3.31Å; L60-L63 PolarHBondContact O-N 3.48Å; L60-L64 WeakPolarHBondContact O-CB 3.32Å; L60-L64 PolarHBondContact O-N 3.39Å
61	L	90.4	Very high	87.6	Confident	94 Å²	94	92.9 Å²	92.9	49%	0.492	50%	0.503	S	S	.	.	H	α-helix	trans	-64.4	-39.2	176.7	-71.4	173.3	0	0	0	112.3	I57 L58 L59 S65	I57-L61 HydrophobicContact CG2-CD1 4.19Å; I57-L61 WeakPolarHBondContact O-CG 3.37Å; I57-L61 PolarHBondContact O-N 3.46Å; L58-L61 PolarHBondContact O-N 3.35Å; L59-L61 PolarHBondContact O-N 3.48Å; L61-S65 WeakPolarHBondContact O-CB 3.38Å; L61-S65 PolarHBondContact O-N 2.84Å; L61-S65 PolarHBondContact O-OG 2.84Å
62	I	92.7	Very high	88.3	Confident	90 Å²	90	92.4 Å²	92.4	46%	0.462	50%	0.5	S	S	.	.	H	α-helix	trans	-64.5	-47	175.3	-68.5	165.5	0	0	0	110.2	L58 L59 L64 S65 L66	L58-I62 HydrophobicContact CG-CD1 4.18Å; L58-I62 VanDerWaalsContact O-CG1 3.32Å; L58-I62 WeakPolarHBondContact O-CG1 3.34Å; L58-I62 PolarHBondContact O-N 2.89Å; L59-I62 PolarHBondContact O-N 3.18Å; I62-L64 PolarHBondContact O-N 2.86Å; I62-S65 PolarHBondContact O-N 3.33Å; I62-L66 HydrophobicContact CG2-CD1 3.98Å; I62-L66 HydrophobicContact CG2-CG 4.47Å; I62-L66 WeakPolarHBondContact O-CG 3.45Å; I62-L66 PolarHBondContact O-N 3.2Å
63	L	93.8	Very high	88.8	Confident	97 Å²	97	91.7 Å²	91.7	51%	0.508	50%	0.498	S	S	.	.	H	α-helix	trans	-62.2	-42	178.3	-72.4	173.2	0	0	0	112	L59 L60 S65 L66 S67	L59-L63 HydrophobicContact CD2-CD1 4.07Å; L59-L63 HydrophobicContact CG-CD1 4.37Å; L59-L63 WeakPolarHBondContact O-CG 3.16Å; L59-L63 PolarHBondContact O-N 2.93Å; L60-L63 PolarHBondContact O-N 3.48Å; L63-S65 VanDerWaalsContact C-N 3.34Å; L63-S65 PolarHBondContact O-N 3.32Å; L63-L66 PolarHBondContact O-N 3.41Å; L63-S67 WeakPolarHBondContact O-CB 3.37Å; L63-S67 PolarHBondContact O-N 2.97Å
64	L	93.4	Very high	89.1	Confident	99 Å²	99	91.3 Å²	91.3	52%	0.518	50%	0.495	S	S	.	.	H	α-helix	trans	-62.3	-42.8	175.5	-175.1	64.8	0	0	0	111.4	L60 I62 S67 N68	L60-L64 WeakPolarHBondContact O-CB 3.32Å; L60-L64 PolarHBondContact O-N 3.39Å; I62-L64 PolarHBondContact O-N 2.86Å; L64-S67 PolarHBondContact O-N 2.93Å; L64-N68 WeakPolarHBondContact O-CB 3.34Å; L64-N68 PolarHBondContact O-N 3.36Å; L64-N68 PolarHBondContact O-ND2 3.35Å
65	S	91.2	Very high	89.4	Confident	76 Å²	76	92.5 Å²	92.5	53%	0.531	50%	0.497	S	S	.	.	H	α-helix	trans	-63.9	-43.8	177.5	-60	0	0	0	0	111.9	L61 I62 L63 N68 Y69	L61-S65 WeakPolarHBondContact O-CB 3.38Å; L61-S65 PolarHBondContact O-N 2.84Å; L61-S65 PolarHBondContact O-OG 2.84Å; I62-S65 PolarHBondContact O-N 3.33Å; L63-S65 VanDerWaalsContact C-N 3.34Å; L63-S65 PolarHBondContact O-N 3.32Å; S65-N68 PolarHBondContact O-N 2.87Å; S65-Y69 WeakPolarHBondContact O-CB 3.47Å; S65-Y69 PolarHBondContact O-N 2.92Å
66	L	93.3	Very high	89.5	Confident	80 Å²	80	94.1 Å²	94.1	42%	0.419	50%	0.503	S	S	.	.	H	α-helix	trans	-63.3	-45.3	175.1	-73.2	170.1	0	0	0	111.4	I62 L63 N68 Y69 Y70	I62-L66 HydrophobicContact CG2-CD1 3.98Å; I62-L66 HydrophobicContact CG2-CG 4.47Å; I62-L66 WeakPolarHBondContact O-CG 3.45Å; I62-L66 PolarHBondContact O-N 3.2Å; L63-L66 PolarHBondContact O-N 3.41Å; L66-N68 PolarHBondContact O-N 2.82Å; L66-Y69 PolarHBondContact O-N 3.29Å; L66-Y70 HydrophobicContact CD2-CE2 4.42Å; L66-Y70 WeakPolarHBondContact O-CD2 3.35Å; L66-Y70 PolarHBondContact O-N 3.5Å
67	S	92.4	Very high	89.9	Confident	67 Å²	67	93.9 Å²	93.9	47%	0.469	50%	0.498	S	S	.	.	H	α-helix	trans	-59	-46	178.1	-174.9	0	0	0	0	111.8	L63 L64 S71	L63-S67 WeakPolarHBondContact O-CB 3.37Å; L63-S67 PolarHBondContact O-N 2.97Å; L64-S67 PolarHBondContact O-N 2.93Å; S67-S71 WeakPolarHBondContact O-CB 3.49Å; S67-S71 PolarHBondContact O-N 2.91Å; S67-S71 PolarHBondContact O-OG 3.48Å
68	N	93	Very high	90	Very high	88 Å²	88	95.9 Å²	95.9	47%	0.471	50%	0.501	S	S	.	.	H	α-helix	trans	-62.9	-44.6	175.6	-75.9	-22.6	0	0	0	111.9	L64 S65 L66 S71 I72	L64-N68 WeakPolarHBondContact O-CB 3.34Å; L64-N68 PolarHBondContact O-N 3.36Å; L64-N68 PolarHBondContact O-ND2 3.35Å; S65-N68 PolarHBondContact O-N 2.87Å; L66-N68 PolarHBondContact O-N 2.82Å; N68-S71 PolarHBondContact O-N 3.32Å; N68-I72 VanDerWaalsContact O-CG1 3.31Å; N68-I72 WeakPolarHBondContact O-CG1 3.35Å; N68-I72 PolarHBondContact O-N 3.46Å
69	Y	91.1	Very high	89.8	Confident	133 Å²	133	94.2 Å²	94.2	52%	0.522	49%	0.494	S	S	.	.	H	α-helix	trans	-59	-49.6	178	-180	-103.3	0	0	0	112.2	S65 L66 S71 I72 Q73	S65-Y69 WeakPolarHBondContact O-CB 3.47Å; S65-Y69 PolarHBondContact O-N 2.92Å; L66-Y69 PolarHBondContact O-N 3.29Å; Y69-S71 VanDerWaalsContact C-N 3.34Å; Y69-S71 PolarHBondContact O-N 3Å; Y69-I72 PolarHBondContact O-N 3.24Å; Y69-Q73 HydrophobicContact CD1-CG 4.45Å; Y69-Q73 HydrophobicContact CE1-CG 4.19Å; Y69-Q73 WeakPolarHBondContact O-CG 3.42Å; Y69-Q73 PolarHBondContact O-N 2.77Å; Y69-Q73 PolarHBondContact OH-NE2 2.94Å
70	Y	91.2	Very high	89.5	Confident	144 Å²	144	94.6 Å²	94.6	57%	0.565	50%	0.496	S	S	*	.	H	α-helix	trans	-64.8	-37.7	177.6	-78.8	-64.9	0	0	0	112.4	L66 I72 Q73 L74	L66-Y70 HydrophobicContact CD2-CE2 4.42Å; L66-Y70 WeakPolarHBondContact O-CD2 3.35Å; L66-Y70 PolarHBondContact O-N 3.5Å; Y70-I72 VanDerWaalsContact C-N 3.35Å; Y70-I72 PolarHBondContact O-N 3.45Å; Y70-Q73 PolarHBondContact O-N 3.43Å; Y70-L74 WeakPolarHBondContact O-CB 3.42Å; Y70-L74 PolarHBondContact O-N 2.96Å
71	S	89.1	Confident	89.5	Confident	66 Å²	66	95.5 Å²	95.5	46%	0.462	50%	0.495	S	S	.	.	H	α-helix	trans	-63.1	-41.7	177.5	-62	0	0	0	0	111.8	S67 N68 Y69 L74 S75	S67-S71 WeakPolarHBondContact O-CB 3.49Å; S67-S71 PolarHBondContact O-N 2.91Å; S67-S71 PolarHBondContact O-OG 3.48Å; N68-S71 PolarHBondContact O-N 3.32Å; Y69-S71 VanDerWaalsContact C-N 3.34Å; Y69-S71 PolarHBondContact O-N 3Å; S71-L74 PolarHBondContact O-N 3.38Å; S71-S75 WeakPolarHBondContact O-CB 3.38Å; S71-S75 PolarHBondContact O-N 2.95Å
72	I	89.3	Confident	89.4	Confident	105 Å²	105	98.9 Å²	98.9	54%	0.538	50%	0.503	S	S	.	.	H	α-helix	trans	-66.3	-47.1	175.4	-67	164.4	0	0	0	110.8	N68 Y69 Y70 L74 S75 N76	N68-I72 VanDerWaalsContact O-CG1 3.31Å; N68-I72 WeakPolarHBondContact O-CG1 3.35Å; N68-I72 PolarHBondContact O-N 3.46Å; Y69-I72 PolarHBondContact O-N 3.24Å; Y70-I72 VanDerWaalsContact C-N 3.35Å; Y70-I72 PolarHBondContact O-N 3.45Å; I72-L74 VanDerWaalsContact C-N 3.3Å; I72-L74 PolarHBondContact O-N 2.78Å; I72-S75 PolarHBondContact O-N 3.48Å; I72-N76 WeakPolarHBondContact O-CB 3.36Å; I72-N76 PolarHBondContact O-N 3.24Å; I72-N76 PolarHBondContact O-ND2 3.39Å
73	Q	87.4	Confident	89.2	Confident	88 Å²	88	102.5 Å²	102.5	41%	0.411	51%	0.511	S	S	.	.	H	α-helix	trans	-59.1	-43.6	176.9	-75.6	-160.8	-11.4	0	0	112	Y69 Y70 N76 S77	Y69-Q73 HydrophobicContact CD1-CG 4.45Å; Y69-Q73 HydrophobicContact CE1-CG 4.19Å; Y69-Q73 WeakPolarHBondContact O-CG 3.42Å; Y69-Q73 PolarHBondContact O-N 2.77Å; Y69-Q73 PolarHBondContact OH-NE2 2.94Å; Y70-Q73 PolarHBondContact O-N 3.43Å; Q73-N76 PolarHBondContact O-N 3.47Å; Q73-S77 WeakPolarHBondContact O-CB 3.38Å; Q73-S77 PolarHBondContact O-N 2.97Å
74	L	86.6	Confident	89.1	Confident	95 Å²	95	102 Å²	102	50%	0.497	51%	0.512	S	S	.	.	H	α-helix	trans	-64.9	-44.9	179.5	-173.6	64.1	0	0	0	110.6	Y70 S71 I72 N76 S77 Y78	Y70-L74 WeakPolarHBondContact O-CB 3.42Å; Y70-L74 PolarHBondContact O-N 2.96Å; S71-L74 PolarHBondContact O-N 3.38Å; I72-L74 VanDerWaalsContact C-N 3.3Å; I72-L74 PolarHBondContact O-N 2.78Å; L74-N76 PolarHBondContact O-N 2.89Å; L74-S77 WeakPolarHBondContact O-CB 3.38Å; L74-S77 PolarHBondContact O-N 3.5Å; L74-Y78 HydrophobicContact CD1-CD2 3.94Å; L74-Y78 HydrophobicContact CD1-CE2 3.44Å; L74-Y78 VanDerWaalsContact CD1-CE2 3.44Å; L74-Y78 HydrophobicContact CD2-CE2 3.89Å; L74-Y78 HydrophobicContact CG-CD2 3.71Å; L74-Y78 HydrophobicContact CG-CE2 3.41Å; L74-Y78 VanDerWaalsContact CG-CE2 3.41Å; L74-Y78 WeakPolarHBondContact O-CD2 3.19Å; L74-Y78 PolarHBondContact O-N 3.37Å
75	S	87.1	Confident	89	Confident	65 Å²	65	105.1 Å²	105.1	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-56.8	-49	173.9	-177.4	0	0	0	0	111.8	S71 I72 S77 Y78 V79	S71-S75 WeakPolarHBondContact O-CB 3.38Å; S71-S75 PolarHBondContact O-N 2.95Å; I72-S75 PolarHBondContact O-N 3.48Å; S75-S77 VanDerWaalsContact C-N 3.29Å; S75-S77 PolarHBondContact O-N 2.9Å; S75-Y78 PolarHBondContact O-N 2.94Å; S75-V79 WeakPolarHBondContact O-CG2 3.46Å; S75-V79 PolarHBondContact O-N 3.28Å
76	N	86.6	Confident	89.1	Confident	103 Å²	103	103.5 Å²	103.5	55%	0.551	51%	0.505	S	S	*	.	H	α-helix	trans	-60.4	-39.7	177.1	-71.9	-21.4	0	0	0	112.1	I72 Q73 L74 V79 L80	I72-N76 WeakPolarHBondContact O-CB 3.36Å; I72-N76 PolarHBondContact O-N 3.24Å; I72-N76 PolarHBondContact O-ND2 3.39Å; Q73-N76 PolarHBondContact O-N 3.47Å; L74-N76 PolarHBondContact O-N 2.89Å; N76-V79 PolarHBondContact O-N 3.03Å; N76-L80 WeakPolarHBondContact O-CB 3.34Å; N76-L80 PolarHBondContact O-N 3.3Å
77	S	88.2	Confident	89.1	Confident	51 Å²	51	104.7 Å²	104.7	36%	0.357	51%	0.51	S	S	.	.	H	α-helix	trans	-65.7	-43	175.7	-171.4	0	0	0	0	112.2	Q73 L74 S75 L80 K81	Q73-S77 WeakPolarHBondContact O-CB 3.38Å; Q73-S77 PolarHBondContact O-N 2.97Å; L74-S77 WeakPolarHBondContact O-CB 3.38Å; L74-S77 PolarHBondContact O-N 3.5Å; S75-S77 VanDerWaalsContact C-N 3.29Å; S75-S77 PolarHBondContact O-N 2.9Å; S77-L80 PolarHBondContact O-N 2.95Å; S77-K81 WeakPolarHBondContact O-CB 3.15Å; S77-K81 WeakPolarHBondContact O-CG 3.42Å; S77-K81 PolarHBondContact O-N 3.47Å
78	Y	87.3	Confident	89.1	Confident	146 Å²	146	107.9 Å²	107.9	57%	0.573	52%	0.516	S	S	*	.	H	α-helix	trans	-64	-42.9	175.3	-83.4	-69	0	0	0	112.1	L74 S75 L80 K81 Y82	L74-Y78 HydrophobicContact CD1-CD2 3.94Å; L74-Y78 HydrophobicContact CD1-CE2 3.44Å; L74-Y78 VanDerWaalsContact CD1-CE2 3.44Å; L74-Y78 HydrophobicContact CD2-CE2 3.89Å; L74-Y78 HydrophobicContact CG-CD2 3.71Å; L74-Y78 HydrophobicContact CG-CE2 3.41Å; L74-Y78 VanDerWaalsContact CG-CE2 3.41Å; L74-Y78 WeakPolarHBondContact O-CD2 3.19Å; L74-Y78 PolarHBondContact O-N 3.37Å; S75-Y78 PolarHBondContact O-N 2.94Å; Y78-L80 VanDerWaalsContact C-N 3.33Å; Y78-L80 PolarHBondContact O-N 2.87Å; Y78-K81 PolarHBondContact O-N 3.36Å; Y78-Y82 WeakPolarHBondContact O-CB 3.37Å; Y78-Y82 PolarHBondContact O-N 2.87Å
79	V	82.3	Confident	89	Confident	69 Å²	69	106 Å²	106	42%	0.418	51%	0.509	S	S	.	.	H	α-helix	trans	-61.3	-43.2	175.9	172.8	0	0	0	0	110.7	S75 N76 Y82 R83	S75-V79 WeakPolarHBondContact O-CG2 3.46Å; S75-V79 PolarHBondContact O-N 3.28Å; N76-V79 PolarHBondContact O-N 3.03Å; V79-Y82 PolarHBondContact O-N 3.48Å; V79-R83 WeakPolarHBondContact O-CG 3.44Å; V79-R83 PolarHBondContact O-N 3.48Å
80	L	84.5	Confident	89.1	Confident	113 Å²	113	105.9 Å²	105.9	59%	0.592	51%	0.513	S	S	*	.	H	α-helix	trans	-64.4	-46.7	176.4	-172	68.6	0	0	0	111.4	N76 S77 Y78 Y82 R83 V84	N76-L80 WeakPolarHBondContact O-CB 3.34Å; N76-L80 PolarHBondContact O-N 3.3Å; S77-L80 PolarHBondContact O-N 2.95Å; Y78-L80 VanDerWaalsContact C-N 3.33Å; Y78-L80 PolarHBondContact O-N 2.87Å; L80-Y82 VanDerWaalsContact C-N 3.29Å; L80-Y82 PolarHBondContact O-N 3.47Å; L80-R83 PolarHBondContact O-N 2.99Å; L80-V84 VanDerWaalsContact O-CG2 3.31Å; L80-V84 WeakPolarHBondContact O-CG2 3.1Å; L80-V84 PolarHBondContact O-N 3.28Å
81	K	89.3	Confident	89.1	Confident	137 Å²	137	104.2 Å²	104.2	60%	0.596	51%	0.514	S	S	*	.	H	α-helix	trans	-57.5	-42.5	175.6	-77.4	-178.3	-172.4	-179	0	111.5	S77 Y78 V84 Y85	S77-K81 WeakPolarHBondContact O-CB 3.15Å; S77-K81 WeakPolarHBondContact O-CG 3.42Å; S77-K81 PolarHBondContact O-N 3.47Å; Y78-K81 PolarHBondContact O-N 3.36Å; K81-V84 PolarHBondContact O-N 3.25Å; K81-Y85 WeakPolarHBondContact O-CB 3.26Å; K81-Y85 PolarHBondContact O-N 3.1Å
82	Y	88.8	Confident	89.3	Confident	165 Å²	165	105.5 Å²	105.5	65%	0.647	51%	0.514	S	S	*	.	H	α-helix	trans	-64.2	-45.6	177.6	-172.5	-97.8	0	0	0	111.7	Y78 V79 L80 V84 Y85 T86	Y78-Y82 WeakPolarHBondContact O-CB 3.37Å; Y78-Y82 PolarHBondContact O-N 2.87Å; V79-Y82 PolarHBondContact O-N 3.48Å; L80-Y82 VanDerWaalsContact C-N 3.29Å; L80-Y82 PolarHBondContact O-N 3.47Å; Y82-V84 PolarHBondContact O-N 2.9Å; Y82-Y85 PolarHBondContact O-N 3.11Å; Y82-T86 PolarHBondContact O-N 3.09Å; Y82-T86 PolarHBondContact O-OG1 3.13Å; Y82-T86 VanDerWaalsContact O-OG1 3.08Å
83	R	88.6	Confident	89.4	Confident	166 Å²	166	102.6 Å²	102.6	63%	0.626	51%	0.506	S	S	*	.	H	α-helix	trans	-60.5	-45	175.9	-73.9	-177.9	178.8	-163.4	1	112.1	V79 L80 Y85 T86 I87	V79-R83 WeakPolarHBondContact O-CG 3.44Å; V79-R83 PolarHBondContact O-N 3.48Å; L80-R83 PolarHBondContact O-N 2.99Å; R83-Y85 VanDerWaalsContact C-N 3.33Å; R83-Y85 PolarHBondContact O-N 2.91Å; R83-T86 PolarHBondContact O-N 3.35Å; R83-I87 WeakPolarHBondContact O-CG1 3.42Å; R83-I87 PolarHBondContact O-N 3.5Å
84	V	90.3	Very high	89.7	Confident	87 Å²	87	104.6 Å²	104.6	53%	0.527	51%	0.514	S	S	.	.	H	α-helix	trans	-61.2	-43.2	176.8	171.8	0	0	0	0	110.9	L80 K81 Y82 I87 K88	L80-V84 VanDerWaalsContact O-CG2 3.31Å; L80-V84 WeakPolarHBondContact O-CG2 3.1Å; L80-V84 PolarHBondContact O-N 3.28Å; K81-V84 PolarHBondContact O-N 3.25Å; Y82-V84 PolarHBondContact O-N 2.9Å; V84-I87 PolarHBondContact O-N 2.92Å; V84-K88 WeakPolarHBondContact O-CB 3.33Å; V84-K88 PolarHBondContact O-N 3.48Å
85	Y	92.5	Very high	89.9	Confident	163 Å²	163	102 Å²	102	64%	0.639	51%	0.506	S	S	*	.	H	α-helix	trans	-61.5	-44.6	176.9	-177.7	-98.9	0	0	0	112.2	K81 Y82 R83 K88 S89	K81-Y85 WeakPolarHBondContact O-CB 3.26Å; K81-Y85 PolarHBondContact O-N 3.1Å; Y82-Y85 PolarHBondContact O-N 3.11Å; R83-Y85 VanDerWaalsContact C-N 3.33Å; R83-Y85 PolarHBondContact O-N 2.91Å; Y85-K88 PolarHBondContact O-N 3.23Å; Y85-S89 PolarHBondContact O-N 2.83Å; Y85-S89 PolarHBondContact O-OG 3.43Å
86	T	92.2	Very high	90.1	Very high	43 Å²	43	102.7 Å²	102.7	26%	0.264	50%	0.504	S	S	.	.	H	α-helix	trans	-64.5	-40.8	177.8	-60.3	0	0	0	0	112.4	Y82 R83 S89 H90	Y82-T86 PolarHBondContact O-N 3.09Å; Y82-T86 PolarHBondContact O-OG1 3.13Å; Y82-T86 VanDerWaalsContact O-OG1 3.08Å; R83-T86 PolarHBondContact O-N 3.35Å; T86-S89 PolarHBondContact O-N 3.35Å; T86-S89 PolarHBondContact O-OG 3.26Å; T86-H90 PolarHBondContact O-CD2 3Å; T86-H90 PolarHBondContact O-N 3.48Å
87	I	93.2	Very high	90.3	Very high	104 Å²	104	102.2 Å²	102.2	53%	0.533	50%	0.501	S	S	.	.	H	α-helix	trans	-63.4	-44.7	174.2	-67.4	165.6	0	0	0	110.2	R83 V84 S89 H90 L91	R83-I87 WeakPolarHBondContact O-CG1 3.42Å; R83-I87 PolarHBondContact O-N 3.5Å; V84-I87 PolarHBondContact O-N 2.92Å; I87-S89 PolarHBondContact O-N 3.04Å; I87-H90 PolarHBondContact O-N 2.96Å; I87-L91 HydrophobicContact CG2-CD1 4.03Å; I87-L91 HydrophobicContact CG2-CG 4.41Å; I87-L91 WeakPolarHBondContact O-CG 3.41Å; I87-L91 PolarHBondContact O-N 3.03Å
88	K	93.1	Very high	90.4	Very high	135 Å²	135	104.4 Å²	104.4	59%	0.587	51%	0.505	S	S	*	.	H	α-helix	trans	-60.8	-43.5	178.4	-171.9	176.9	-179.5	179.6	0	111.7	V84 Y85 L91 I92	V84-K88 WeakPolarHBondContact O-CB 3.33Å; V84-K88 PolarHBondContact O-N 3.48Å; Y85-K88 PolarHBondContact O-N 3.23Å; K88-L91 PolarHBondContact O-N 2.85Å; K88-I92 HydrophobicContact CG-CD1 4.13Å; K88-I92 VanDerWaalsContact O-CG1 3.29Å; K88-I92 WeakPolarHBondContact O-CG1 3.34Å; K88-I92 PolarHBondContact O-N 3.26Å
89	S	90.9	Very high	90.5	Very high	48 Å²	48	103.8 Å²	103.8	34%	0.336	51%	0.506	S	S	.	.	H	α-helix	trans	-65.8	-41.1	178.2	69.1	0	0	0	0	111.8	Y85 T86 I87 I92 A93	Y85-S89 PolarHBondContact O-N 2.83Å; Y85-S89 PolarHBondContact O-OG 3.43Å; T86-S89 PolarHBondContact O-N 3.35Å; T86-S89 PolarHBondContact O-OG 3.26Å; I87-S89 PolarHBondContact O-N 3.04Å; S89-I92 PolarHBondContact O-N 3.43Å; S89-A93 WeakPolarHBondContact O-CB 3.27Å; S89-A93 PolarHBondContact O-N 3.48Å
90	H	92.1	Very high	90.8	Very high	130 Å²	130	107.8 Å²	107.8	60%	0.602	52%	0.517	S	S	*	.	H	α-helix	trans	-61.9	-42.5	173.9	-86	-64.7	0	0	0	113	T86 I87 A93 K94	T86-H90 PolarHBondContact O-CD2 3Å; T86-H90 PolarHBondContact O-N 3.48Å; I87-H90 PolarHBondContact O-N 2.96Å; H90-A93 PolarHBondContact O-N 3.04Å; H90-K94 WeakPolarHBondContact O-CB 3.28Å; H90-K94 PolarHBondContact O-N 2.9Å
91	L	92.6	Very high	91	Very high	110 Å²	110	109 Å²	109	58%	0.576	52%	0.518	S	S	*	.	H	α-helix	trans	-63.3	-42.4	177.1	-72.1	173.3	0	0	0	111.8	I87 K88 K94 A95	I87-L91 HydrophobicContact CG2-CD1 4.03Å; I87-L91 HydrophobicContact CG2-CG 4.41Å; I87-L91 WeakPolarHBondContact O-CG 3.41Å; I87-L91 PolarHBondContact O-N 3.03Å; K88-L91 PolarHBondContact O-N 2.85Å; L91-K94 PolarHBondContact O-N 3.43Å; L91-A95 WeakPolarHBondContact O-CB 3.44Å; L91-A95 PolarHBondContact O-N 3.25Å
92	I	92.7	Very high	90.8	Very high	92 Å²	92	109.2 Å²	109.2	47%	0.472	52%	0.519	S	S	.	.	H	α-helix	trans	-63.3	-43.9	175.5	-67.3	165.3	0	0	0	110.6	K88 S89 K94 A95 N96	K88-I92 HydrophobicContact CG-CD1 4.13Å; K88-I92 VanDerWaalsContact O-CG1 3.29Å; K88-I92 WeakPolarHBondContact O-CG1 3.34Å; K88-I92 PolarHBondContact O-N 3.26Å; S89-I92 PolarHBondContact O-N 3.43Å; I92-K94 PolarHBondContact O-N 2.89Å; I92-A95 PolarHBondContact O-N 2.86Å; I92-N96 WeakPolarHBondContact O-CB 3.26Å; I92-N96 PolarHBondContact O-N 3.49Å; I92-N96 PolarHBondContact O-ND2 2.91Å
93	A	91.7	Very high	90.7	Very high	45 Å²	45	108.6 Å²	108.6	37%	0.372	52%	0.519	S	S	.	.	H	α-helix	trans	-61	-45.2	176.8	0	0	0	0	0	111.5	S89 H90 N96 I97	S89-A93 WeakPolarHBondContact O-CB 3.27Å; S89-A93 PolarHBondContact O-N 3.48Å; H90-A93 PolarHBondContact O-N 3.04Å; A93-N96 PolarHBondContact O-N 2.91Å; A93-I97 VanDerWaalsContact O-CG1 3.29Å; A93-I97 WeakPolarHBondContact O-CG1 3.46Å; A93-I97 PolarHBondContact O-N 2.95Å
94	K	92.6	Very high	90.4	Very high	130 Å²	130	108 Å²	108	57%	0.565	52%	0.521	S	S	*	.	H	α-helix	trans	-60.4	-47.2	176.5	-171.2	178.1	178.9	-178.2	0	111.6	H90 L91 I92 N96 I97 E98	H90-K94 WeakPolarHBondContact O-CB 3.28Å; H90-K94 PolarHBondContact O-N 2.9Å; L91-K94 PolarHBondContact O-N 3.43Å; I92-K94 PolarHBondContact O-N 2.89Å; K94-N96 VanDerWaalsContact C-N 3.3Å; K94-N96 PolarHBondContact O-N 2.78Å; K94-I97 PolarHBondContact O-N 3.41Å; K94-E98 WeakPolarHBondContact O-CG 3.28Å; K94-E98 PolarHBondContact O-N 3.13Å
95	A	91.5	Very high	89.9	Confident	40 Å²	40	110.7 Å²	110.7	33%	0.331	53%	0.526	S	S	.	.	H	α-helix	trans	-60.5	-39	176.6	0	0	0	0	0	112.3	L91 I92 E98 K99	L91-A95 WeakPolarHBondContact O-CB 3.44Å; L91-A95 PolarHBondContact O-N 3.25Å; I92-A95 PolarHBondContact O-N 2.86Å; A95-E98 PolarHBondContact O-N 3.35Å; A95-K99 WeakPolarHBondContact O-CG 3.42Å; A95-K99 PolarHBondContact O-N 3.1Å
96	N	90.9	Very high	89.2	Confident	80 Å²	80	110.3 Å²	110.3	43%	0.428	53%	0.527	S	S	.	.	H	α-helix	trans	-67.4	-39.3	176	-77.9	-23.4	0	0	0	112.5	I92 A93 K94 K99 K100	I92-N96 WeakPolarHBondContact O-CB 3.26Å; I92-N96 PolarHBondContact O-N 3.49Å; I92-N96 PolarHBondContact O-ND2 2.91Å; A93-N96 PolarHBondContact O-N 2.91Å; K94-N96 VanDerWaalsContact C-N 3.3Å; K94-N96 PolarHBondContact O-N 2.78Å; N96-K99 PolarHBondContact O-N 3.06Å; N96-K100 WeakPolarHBondContact O-CG 3.32Å; N96-K100 PolarHBondContact O-N 2.98Å
97	I	91.5	Very high	88.5	Confident	93 Å²	93	115.6 Å²	115.6	48%	0.477	55%	0.547	S	S	.	.	H	α-helix	trans	-62.7	-45.1	174.6	-68.2	163.4	0	0	0	110.2	A93 K94 K99 K100 K101	A93-I97 VanDerWaalsContact O-CG1 3.29Å; A93-I97 WeakPolarHBondContact O-CG1 3.46Å; A93-I97 PolarHBondContact O-N 2.95Å; K94-I97 PolarHBondContact O-N 3.41Å; I97-K99 PolarHBondContact O-N 3.23Å; I97-K100 PolarHBondContact O-N 3.26Å; I97-K101 HydrophobicContact CG2-CD 4.33Å; I97-K101 HydrophobicContact CG2-CG 4.5Å; I97-K101 WeakPolarHBondContact O-CG 3.4Å; I97-K101 PolarHBondContact O-N 3.09Å
98	E	90.1	Very high	87.7	Confident	96 Å²	96	117.3 Å²	117.3	45%	0.449	55%	0.553	S	S	.	*	H	α-helix	trans	-62.4	-42.9	177	-72.7	179.3	-171.1	0	0	112.1	K94 A95 K100 K101 K102	K94-E98 WeakPolarHBondContact O-CG 3.28Å; K94-E98 PolarHBondContact O-N 3.13Å; A95-E98 PolarHBondContact O-N 3.35Å; E98-K100 PolarHBondContact O-N 2.93Å; E98-K101 PolarHBondContact O-N 2.65Å; E98-K102 WeakPolarHBondContact O-CG 3.49Å; E98-K102 PolarHBondContact O-N 3.21Å
99	K	89.6	Confident	86.8	Confident	134 Å²	134	116.5 Å²	116.5	58%	0.583	55%	0.554	S	S	*	*	H	α-helix	trans	-59.2	-44.1	172.9	-75.6	178.6	-178.7	179.5	0	111.6	A95 N96 I97 K102 K103	A95-K99 WeakPolarHBondContact O-CG 3.42Å; A95-K99 PolarHBondContact O-N 3.1Å; N96-K99 PolarHBondContact O-N 3.06Å; I97-K99 PolarHBondContact O-N 3.23Å; K99-K102 PolarHBondContact O-N 3.48Å; K99-K103 WeakPolarHBondContact O-CG 3.45Å; K99-K103 PolarHBondContact O-N 2.88Å
100	K	88.4	Confident	86	Confident	153 Å²	153	121.7 Å²	121.7	67%	0.665	57%	0.57	S	S	*	*	H	α-helix	trans	-63	-42.9	176	-76	-176.9	179.9	-178.2	0	111.7	N96 I97 E98 K103 K104	N96-K100 WeakPolarHBondContact O-CG 3.32Å; N96-K100 PolarHBondContact O-N 2.98Å; I97-K100 PolarHBondContact O-N 3.26Å; E98-K100 PolarHBondContact O-N 2.93Å; K100-K103 PolarHBondContact O-N 3.18Å; K100-K104 PolarHBondContact O-N 3.41Å
101	K	88.3	Confident	84.9	Confident	137 Å²	137	122.2 Å²	122.2	60%	0.596	58%	0.577	S	S	*	*	H	α-helix	trans	-61.2	-45.6	175.4	-73.8	-177.7	179.9	-176.7	0	111.7	I97 E98 K103 K104 K105	I97-K101 HydrophobicContact CG2-CD 4.33Å; I97-K101 HydrophobicContact CG2-CG 4.5Å; I97-K101 WeakPolarHBondContact O-CG 3.4Å; I97-K101 PolarHBondContact O-N 3.09Å; E98-K101 PolarHBondContact O-N 2.65Å; K101-K103 PolarHBondContact O-N 2.9Å; K101-K104 PolarHBondContact O-N 3.3Å; K101-K105 PolarHBondContact O-N 2.89Å
102	K	85.4	Confident	83.8	Confident	142 Å²	142	126.1 Å²	126.1	62%	0.617	59%	0.59	S	S	*	*	H	α-helix	trans	-60.5	-42.7	175.4	-72.6	-176.6	-178	-177.8	0	112	E98 K99 K105 K106	E98-K102 WeakPolarHBondContact O-CG 3.49Å; E98-K102 PolarHBondContact O-N 3.21Å; K99-K102 PolarHBondContact O-N 3.48Å; K102-K105 PolarHBondContact O-N 3.3Å; K102-K106 PolarHBondContact O-N 2.76Å
103	K	85.6	Confident	82.5	Confident	153 Å²	153	129.1 Å²	129.1	67%	0.665	60%	0.602	S	S	*	*	H	α-helix	trans	-61.8	-42.7	175	-73.9	-175	-179.6	-172.5	0	112.1	K99 K100 K101 K106 K107	K99-K103 WeakPolarHBondContact O-CG 3.45Å; K99-K103 PolarHBondContact O-N 2.88Å; K100-K103 PolarHBondContact O-N 3.18Å; K101-K103 PolarHBondContact O-N 2.9Å; K103-K106 PolarHBondContact O-N 2.85Å; K103-K107 PolarHBondContact O-N 3.22Å; K103-K107 VanDerWaalsContact O-N 3.13Å
104	K	83	Confident	81.1	Confident	153 Å²	153	136.9 Å²	136.9	67%	0.665	63%	0.628	S	S	*	*	H	α-helix	trans	-62	-46.7	175.9	-75.4	-172.3	174.9	-170.5	0	112.1	K100 K101 K106 K107 Q108	K100-K104 PolarHBondContact O-N 3.41Å; K101-K104 PolarHBondContact O-N 3.3Å; K104-K106 VanDerWaalsContact C-N 3.35Å; K104-K106 PolarHBondContact O-N 2.76Å; K104-K107 PolarHBondContact O-N 3.03Å; K104-K107 VanDerWaalsContact O-N 3.13Å; K104-Q108 PolarHBondContact O-N 3.19Å
105	K	79.4	Confident	79.2	Confident	143 Å²	143	137.8 Å²	137.8	62%	0.622	67%	0.674	S	S	*	*	H	α-helix	trans	-58.5	-43.8	176.1	-72.7	-170.5	174.4	-168.3	0	112.2	K101 K102 K107 Q108 I109	K101-K105 PolarHBondContact O-N 2.89Å; K102-K105 PolarHBondContact O-N 3.3Å; K105-K107 VanDerWaalsContact C-N 3.32Å; K105-K107 PolarHBondContact O-N 3.46Å; K105-Q108 PolarHBondContact O-N 2.64Å; K105-I109 WeakPolarHBondContact O-CG1 3.3Å; K105-I109 PolarHBondContact O-N 3.5Å; K105-I109 VanDerWaalsContact O-N 3.09Å
106	K	79	Confident	78.6	Confident	155 Å²	155	142.7 Å²	142.7	67%	0.674	69%	0.692	S	S	*	*	H	α-helix	trans	-61.5	-36.1	175.8	-74.7	-171.1	176.7	-168.3	0	113.1	K102 K103 K104 K110	K102-K106 PolarHBondContact O-N 2.76Å; K103-K106 PolarHBondContact O-N 2.85Å; K104-K106 VanDerWaalsContact C-N 3.35Å; K104-K106 PolarHBondContact O-N 2.76Å; K106-K110 PolarHBondContact O-N 3.11Å
107	K	76.9	Confident	77.9	Confident	155 Å²	155	146 Å²	146	67%	0.674	71%	0.705	S	S	*	*	H	α-helix	trans	-68.8	-41.5	174.8	-71.3	-170.5	176.6	-166.7	0	112.1	K103 K104 K105 I109 K110 N111	K103-K107 PolarHBondContact O-N 3.22Å; K103-K107 VanDerWaalsContact O-N 3.13Å; K104-K107 PolarHBondContact O-N 3.03Å; K104-K107 VanDerWaalsContact O-N 3.13Å; K105-K107 VanDerWaalsContact C-N 3.32Å; K105-K107 PolarHBondContact O-N 3.46Å; K107-I109 PolarHBondContact O-N 3.4Å; K107-K110 PolarHBondContact O-N 2.96Å; K107-N111 PolarHBondContact O-N 2.95Å; K107-N111 VanDerWaalsContact O-N 3.15Å; K107-N111 PolarHBondContact O-OD1 3.32Å
108	Q	75.6	Confident	77.2	Confident	139 Å²	139	148.9 Å²	148.9	65%	0.65	72%	0.718	S	S	*	*	H	α-helix	trans	-62.3	-41.5	177.9	-75.4	179.1	-31.4	0	0	112.5	K104 K105 K110 N111 F112	K104-Q108 PolarHBondContact O-N 3.19Å; K105-Q108 PolarHBondContact O-N 2.64Å; Q108-K110 VanDerWaalsContact C-N 3.33Å; Q108-K110 PolarHBondContact O-N 3.37Å; Q108-N111 PolarHBondContact O-N 3.23Å; Q108-F112 PolarHBondContact O-N 3.2Å
109	I	75	Confident	76.4	Confident	119 Å²	119	152.1 Å²	152.1	61%	0.61	73%	0.734	S	S	*	*	H	α-helix	trans	-62.4	-41.1	177.8	-64.6	164.1	0	0	0	111.1	K105 K107 N111 F112	K105-I109 WeakPolarHBondContact O-CG1 3.3Å; K105-I109 PolarHBondContact O-N 3.5Å; K105-I109 VanDerWaalsContact O-N 3.09Å; K107-I109 PolarHBondContact O-N 3.4Å; I109-N111 VanDerWaalsContact C-N 3.31Å; I109-N111 PolarHBondContact O-N 2.79Å; I109-F112 PolarHBondContact O-N 2.65Å
110	K	74	Confident	75.6	Confident	157 Å²	157	153.2 Å²	153.2	68%	0.683	74%	0.743	S	S	*	*	H	α-helix	trans	-65.8	-32.8	176.9	-71.6	-170.2	174.8	-161.9	0	113.1	K106 K107 Q108 F112	K106-K110 PolarHBondContact O-N 3.11Å; K107-K110 PolarHBondContact O-N 2.96Å; Q108-K110 VanDerWaalsContact C-N 3.33Å; Q108-K110 PolarHBondContact O-N 3.37Å; K110-F112 VanDerWaalsContact C-N 3.27Å; K110-F112 PolarHBondContact O-N 3.08Å
111	N	69.4	Low	74.7	Confident	141 Å²	141	153.2 Å²	153.2	75%	0.754	75%	0.749	S	S	*	*	H	α-helix	trans	-78.2	-8.9	179.1	-71.6	11.7	0	0	0	113.5	K107 Q108 I109	K107-N111 PolarHBondContact O-N 2.95Å; K107-N111 VanDerWaalsContact O-N 3.15Å; K107-N111 PolarHBondContact O-OD1 3.32Å; Q108-N111 PolarHBondContact O-N 3.23Å; I109-N111 VanDerWaalsContact C-N 3.31Å; I109-N111 PolarHBondContact O-N 2.79Å
112	F	69.2	Low	73.8	Confident	192 Å²	192	154.4 Å²	154.4	84%	0.842	76%	0.76	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.6	-10.8	176.4	-166.1	-100.5	0	0	0	113	Q108 I109 K110	Q108-F112 PolarHBondContact O-N 3.2Å; I109-F112 PolarHBondContact O-N 2.65Å; K110-F112 VanDerWaalsContact C-N 3.27Å; K110-F112 PolarHBondContact O-N 3.08Å
113	Q	65.2	Low	72.9	Confident	155 Å²	155	155.3 Å²	155.3	72%	0.724	77%	0.771	S	S	*	*	S	Bend	trans	-95.5	16.8	-167	-152.5	172.2	-11.5	0	0	115.3
114	F	62.8	Low	71.8	Confident	207 Å²	207	155.5 Å²	155.5	91%	0.908	78%	0.779	S	S	*	*			trans	-144.4	63.7	-179.9	-79.3	-81.3	0	0	0	112.9
115	G	52.3	Low	70.8	Confident	150 Å²	150	155.7 Å²	155.7	100%	1.546	79%	0.79	S	S	*	*			trans	-126.2	0	167.3	0	0	0	0	0	110.4

Retrieved 115 of 115 residues in 17.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).