YM294_YEAST Loading...

Putative uncharacterized protein YMR294W-A

AlphaFold DB , UniProt , Accession A0A023PZL7, Species YEAST (Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Baker's yeast), Gene n/a, Length 119 aa.

						>YM294_YEAST|A0A023PZL7
MKYEISKIRAENRNYHKKEKNKVSKGYQALISSSFYQTIPSSSSFAFPQSVRVVVADTLLVHHTFDWKHHPLAVAYRSHRKSQQHQTQGNQVLRGTRKLESPTVGPRPGLRRQHTRNFL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.7	Low	62.2	Low	197 Å²	197	133.6 Å²	133.6	97%	0.97	63%	0.632	S	S	*	*				0	-43.7	0	-109.3	-179.8	-179.8	0	0	115.9	Y3 E4	M1-Y3 VanDerWaalsContact C-N 3.31Å; M1-Y3 PolarHBondContact O-N 3.28Å; M1-E4 PolarHBondContact O-N 3.1Å
2	K	60.5	Low	62	Low	181 Å²	181	131.1 Å²	131.1	79%	0.787	63%	0.625	S	S	*	*	H	α-helix	trans	-63.3	-28.4	-177.3	-70	-176.2	179	178.5	0	115.2	S6	K2-S6 PolarHBondContact O-OG 3.23Å
3	Y	62.2	Low	61.7	Low	211 Å²	211	134.2 Å²	134.2	83%	0.827	63%	0.627	S	S	*	*	H	α-helix	trans	-71.9	-35.5	-178.7	-74.8	-81.2	0	0	0	113.6	M1 S6 K7	M1-Y3 VanDerWaalsContact C-N 3.31Å; M1-Y3 PolarHBondContact O-N 3.28Å; Y3-S6 PolarHBondContact O-N 3.49Å; Y3-K7 PolarHBondContact O-N 3.42Å; Y3-K7 VanDerWaalsContact O-N 3.16Å
4	E	62.4	Low	61.7	Low	134 Å²	134	131.9 Å²	131.9	63%	0.626	62%	0.621	S	S	*	*	H	α-helix	trans	-72.5	-40.7	-176.9	-67.1	-177.4	163.3	0	0	112.1	M1 S6 K7 I8	M1-E4 PolarHBondContact O-N 3.1Å; E4-S6 VanDerWaalsContact C-N 3.26Å; E4-S6 PolarHBondContact O-N 3.32Å; E4-K7 PolarHBondContact O-N 3.39Å; E4-I8 WeakPolarHBondContact O-CG1 3.46Å; E4-I8 PolarHBondContact O-N 3.07Å
5	I	61.7	Low	61.4	Low	110 Å²	110	132.9 Å²	132.9	56%	0.564	62%	0.618	S	S	*	*	H	α-helix	trans	-62	-37.8	176	-58.7	173.5	0	0	0	110.6	R9	I5-R9 VanDerWaalsContact O-CB 3.32Å; I5-R9 WeakPolarHBondContact O-CB 3.38Å; I5-R9 PolarHBondContact O-N 3.48Å
6	S	61.6	Low	61.2	Low	78 Å²	78	131.4 Å²	131.4	55%	0.545	61%	0.611	S	S	.	*	H	α-helix	trans	-67.7	-38.2	178.7	-58.7	0	0	0	0	111.9	K2 Y3 E4 R9 A10	K2-S6 PolarHBondContact O-OG 3.23Å; Y3-S6 PolarHBondContact O-N 3.49Å; E4-S6 VanDerWaalsContact C-N 3.26Å; E4-S6 PolarHBondContact O-N 3.32Å; S6-R9 PolarHBondContact O-N 3.44Å; S6-A10 PolarHBondContact O-N 3.26Å; S6-A10 VanDerWaalsContact O-N 3.09Å
7	K	69.2	Low	61	Low	138 Å²	138	133.1 Å²	133.1	60%	0.6	62%	0.616	S	S	*	*	H	α-helix	trans	-67	-47.4	176.6	-167.8	179.4	178.1	-173.9	0	111.9	Y3 E4 R9 A10 E11	Y3-K7 PolarHBondContact O-N 3.42Å; Y3-K7 VanDerWaalsContact O-N 3.16Å; E4-K7 PolarHBondContact O-N 3.39Å; K7-R9 VanDerWaalsContact C-N 3.28Å; K7-R9 PolarHBondContact O-N 3.38Å; K7-A10 PolarHBondContact O-N 3.5Å; K7-A10 VanDerWaalsContact O-N 3.08Å; K7-E11 VanDerWaalsContact CE-OE1 3.3Å; K7-E11 WeakPolarHBondContact CE-OE1 3.27Å; K7-E11 WeakPolarHBondContact O-CG 3.45Å; K7-E11 PolarHBondContact O-N 2.89Å
8	I	62.3	Low	60.9	Low	96 Å²	96	134.1 Å²	134.1	49%	0.492	62%	0.618	S	S	.	*	H	α-helix	trans	-59.6	-40.8	176.2	-65.2	165	0	0	0	110.8	E4 A10 E11 N12	E4-I8 WeakPolarHBondContact O-CG1 3.46Å; E4-I8 PolarHBondContact O-N 3.07Å; I8-A10 VanDerWaalsContact C-N 3.31Å; I8-A10 PolarHBondContact O-N 3.2Å; I8-E11 PolarHBondContact O-N 3.09Å; I8-N12 WeakPolarHBondContact O-CB 3.42Å; I8-N12 PolarHBondContact O-N 3.2Å
9	R	59.9	Low	60.8	Low	171 Å²	171	131.6 Å²	131.6	65%	0.645	61%	0.607	S	S	*	*	H	α-helix	trans	-68.5	-28.6	178.5	-155.5	172.7	-168.5	165.8	4.1	112.7	I5 S6 K7 R13	I5-R9 VanDerWaalsContact O-CB 3.32Å; I5-R9 WeakPolarHBondContact O-CB 3.38Å; I5-R9 PolarHBondContact O-N 3.48Å; S6-R9 PolarHBondContact O-N 3.44Å; K7-R9 VanDerWaalsContact C-N 3.28Å; K7-R9 PolarHBondContact O-N 3.38Å; R9-R13 WeakPolarHBondContact O-CG 3.47Å
10	A	61.5	Low	60.6	Low	48 Å²	48	131.8 Å²	131.8	40%	0.397	61%	0.606	S	S	.	*	H	α-helix	trans	-77.3	-41.8	174	0	0	0	0	0	111.9	S6 K7 I8 N12 R13 N14	S6-A10 PolarHBondContact O-N 3.26Å; S6-A10 VanDerWaalsContact O-N 3.09Å; K7-A10 PolarHBondContact O-N 3.5Å; K7-A10 VanDerWaalsContact O-N 3.08Å; I8-A10 VanDerWaalsContact C-N 3.31Å; I8-A10 PolarHBondContact O-N 3.2Å; A10-N12 PolarHBondContact O-N 2.84Å; A10-R13 PolarHBondContact O-N 3.5Å; A10-N14 PolarHBondContact O-N 3.14Å
11	E	62.2	Low	60.5	Low	106 Å²	106	129.9 Å²	129.9	50%	0.495	60%	0.6	S	S	.	*	H	α-helix	trans	-61.4	-43.2	176.2	-73.6	173.1	-174.5	0	0	111.7	K7 I8 R13 N14 Y15	K7-E11 VanDerWaalsContact CE-OE1 3.3Å; K7-E11 WeakPolarHBondContact CE-OE1 3.27Å; K7-E11 WeakPolarHBondContact O-CG 3.45Å; K7-E11 PolarHBondContact O-N 2.89Å; I8-E11 PolarHBondContact O-N 3.09Å; E11-R13 VanDerWaalsContact C-N 3.34Å; E11-R13 PolarHBondContact O-N 3.26Å; E11-N14 PolarHBondContact O-N 3.07Å; E11-N14 VanDerWaalsContact O-N 3.16Å; E11-Y15 PolarHBondContact O-N 3.19Å
12	N	60.4	Low	60.2	Low	103 Å²	103	128 Å²	128	55%	0.551	59%	0.587	S	S	*	*	H	α-helix	trans	-63.6	-34.1	176.1	-81.3	-20.8	0	0	0	113.5	I8 A10 Y15 H16	I8-N12 WeakPolarHBondContact O-CB 3.42Å; I8-N12 PolarHBondContact O-N 3.2Å; A10-N12 PolarHBondContact O-N 2.84Å; N12-Y15 PolarHBondContact O-N 3.22Å; N12-H16 WeakPolarHBondContact O-CB 3.46Å; N12-H16 PolarHBondContact O-N 3.03Å; N12-H16 VanDerWaalsContact O-N 3.09Å
13	R	58	Low	59.9	Low	172 Å²	172	123.1 Å²	123.1	65%	0.649	57%	0.572	S	S	*	*	H	α-helix	trans	-67	-39.8	174.1	-71.6	179.9	-144.6	-173.2	4.4	111.6	R9 A10 E11 H16 K17	R9-R13 WeakPolarHBondContact O-CG 3.47Å; A10-R13 PolarHBondContact O-N 3.5Å; E11-R13 VanDerWaalsContact C-N 3.34Å; E11-R13 PolarHBondContact O-N 3.26Å; R13-H16 PolarHBondContact O-N 3.13Å; R13-K17 WeakPolarHBondContact O-CB 3.45Å; R13-K17 PolarHBondContact O-N 3.46Å
14	N	60.8	Low	59.5	Low	102 Å²	102	115.9 Å²	115.9	55%	0.545	55%	0.552	S	S	.	*	H	α-helix	trans	-68.1	-37.6	178.1	-78.4	-25	0	0	0	111.9	A10 E11 K17 K18	A10-N14 PolarHBondContact O-N 3.14Å; E11-N14 PolarHBondContact O-N 3.07Å; E11-N14 VanDerWaalsContact O-N 3.16Å; N14-K17 PolarHBondContact O-N 3.15Å; N14-K18 WeakPolarHBondContact O-CG 3.4Å; N14-K18 PolarHBondContact O-N 2.99Å
15	Y	57	Low	58.9	Low	147 Å²	147	116 Å²	116	58%	0.576	55%	0.551	S	S	*	*	H	α-helix	trans	-61.1	-49.6	173.2	-175.5	-98.4	0	0	0	111.3	E11 N12 K17 K18 E19	E11-Y15 PolarHBondContact O-N 3.19Å; N12-Y15 PolarHBondContact O-N 3.22Å; Y15-K17 VanDerWaalsContact C-N 3.3Å; Y15-K17 PolarHBondContact O-N 3.47Å; Y15-K18 PolarHBondContact O-N 3.41Å; Y15-K18 VanDerWaalsContact O-N 3.13Å; Y15-E19 HydrophobicContact CD1-CG 4.17Å; Y15-E19 HydrophobicContact CE1-CG 3.75Å; Y15-E19 PolarHBondContact O-N 3.27Å
16	H	58.3	Low	58.4	Low	108 Å²	108	112.4 Å²	112.4	50%	0.5	54%	0.541	S	S	.	.	H	α-helix	trans	-65.7	-31.7	-178.7	-152.1	69.5	0	0	0	113.1	N12 R13 K20	N12-H16 WeakPolarHBondContact O-CB 3.46Å; N12-H16 PolarHBondContact O-N 3.03Å; N12-H16 VanDerWaalsContact O-N 3.09Å; R13-H16 PolarHBondContact O-N 3.13Å; H16-K20 VanDerWaalsContact CD2-CE 3.5Å; H16-K20 WeakPolarHBondContact CD2-CE 3.35Å; H16-K20 WeakPolarHBondContact NE2-CE 3.3Å; H16-K20 PolarHBondContact NE2-NZ 3.1Å; H16-K20 WeakPolarHBondContact O-CG 3.34Å; H16-K20 PolarHBondContact O-N 3.49Å; H16-K20 VanDerWaalsContact O-N 3.16Å
17	K	59.2	Low	57.8	Low	161 Å²	161	116.3 Å²	116.3	70%	0.7	55%	0.545	S	S	*	.	H	α-helix	trans	-70.7	-37.8	173.6	-166.8	175	-178	-179.8	0	112.2	R13 N14 Y15 N21	R13-K17 WeakPolarHBondContact O-CB 3.45Å; R13-K17 PolarHBondContact O-N 3.46Å; N14-K17 PolarHBondContact O-N 3.15Å; Y15-K17 VanDerWaalsContact C-N 3.3Å; Y15-K17 PolarHBondContact O-N 3.47Å; K17-N21 WeakPolarHBondContact O-CB 3.46Å; K17-N21 PolarHBondContact O-N 2.94Å
18	K	58.5	Low	56.7	Low	151 Å²	151	116 Å²	116	66%	0.657	55%	0.545	S	S	*	.	H	α-helix	trans	-68.7	-42.3	176.5	-75.2	179.5	-179.9	-177.3	0	112	N14 Y15 N21 K22	N14-K18 WeakPolarHBondContact O-CG 3.4Å; N14-K18 PolarHBondContact O-N 2.99Å; Y15-K18 PolarHBondContact O-N 3.41Å; Y15-K18 VanDerWaalsContact O-N 3.13Å; K18-N21 PolarHBondContact O-N 3.32Å; K18-K22 PolarHBondContact O-N 3.42Å
19	E	58.6	Low	56.1	Low	86 Å²	86	114.2 Å²	114.2	40%	0.402	55%	0.546	S	S	.	.	H	α-helix	trans	-60.7	-50.6	175.7	-81.3	-90.6	115.6	0	0	112	Y15 N21 K22 V23	Y15-E19 HydrophobicContact CD1-CG 4.17Å; Y15-E19 HydrophobicContact CE1-CG 3.75Å; Y15-E19 PolarHBondContact O-N 3.27Å; E19-N21 PolarHBondContact O-N 3.05Å; E19-K22 PolarHBondContact O-N 3.27Å; E19-V23 WeakPolarHBondContact O-CG2 3.42Å; E19-V23 PolarHBondContact O-N 3.48Å; E19-V23 VanDerWaalsContact O-N 3.09Å
20	K	57.3	Low	55.5	Low	135 Å²	135	111.7 Å²	111.7	59%	0.587	54%	0.544	S	S	*	.	H	α-helix	trans	-59.5	-32.4	177.6	-75.6	-178.3	175.9	177.5	0	113.2	H16 S24	H16-K20 VanDerWaalsContact CD2-CE 3.5Å; H16-K20 WeakPolarHBondContact CD2-CE 3.35Å; H16-K20 WeakPolarHBondContact NE2-CE 3.3Å; H16-K20 PolarHBondContact NE2-NZ 3.1Å; H16-K20 WeakPolarHBondContact O-CG 3.34Å; H16-K20 PolarHBondContact O-N 3.49Å; H16-K20 VanDerWaalsContact O-N 3.16Å; K20-S24 WeakPolarHBondContact O-CB 3.46Å; K20-S24 PolarHBondContact O-N 2.78Å
21	N	57.4	Low	54.9	Low	92 Å²	92	114 Å²	114	49%	0.492	55%	0.549	S	S	.	.	H	α-helix	trans	-74.9	-29.3	178.5	-151.5	1.9	0	0	0	112.6	K17 K18 E19 K25	K17-N21 WeakPolarHBondContact O-CB 3.46Å; K17-N21 PolarHBondContact O-N 2.94Å; K18-N21 PolarHBondContact O-N 3.32Å; E19-N21 PolarHBondContact O-N 3.05Å; N21-K25 WeakPolarHBondContact O-CG 3.36Å; N21-K25 PolarHBondContact O-N 2.91Å
22	K	54.7	Low	54.3	Low	157 Å²	157	113.2 Å²	113.2	68%	0.683	56%	0.555	S	S	*	*	H	α-helix	trans	-71.4	-43.2	172	-71.9	-177.5	178.7	-177.2	0	111.7	K18 E19 K25 G26	K18-K22 PolarHBondContact O-N 3.42Å; E19-K22 PolarHBondContact O-N 3.27Å; K22-K25 PolarHBondContact O-N 3.41Å; K22-G26 PolarHBondContact O-N 3.46Å
23	V	53.9	Low	53.8	Low	79 Å²	79	112.8 Å²	112.8	48%	0.479	56%	0.56	S	S	.	*	H	α-helix	trans	-64.4	-45.3	178.9	179.3	0	0	0	0	110.7	E19 K25 G26 Y27	E19-V23 WeakPolarHBondContact O-CG2 3.42Å; E19-V23 PolarHBondContact O-N 3.48Å; E19-V23 VanDerWaalsContact O-N 3.09Å; V23-K25 PolarHBondContact O-N 3.42Å; V23-G26 PolarHBondContact O-N 3.34Å; V23-Y27 HydrophobicContact CG1-CD2 3.82Å; V23-Y27 HydrophobicContact CG1-CE2 3.78Å; V23-Y27 WeakPolarHBondContact O-CD2 3.35Å; V23-Y27 PolarHBondContact O-N 2.91Å; V23-Y27 VanDerWaalsContact O-N 3.12Å
24	S	54.3	Low	53.4	Low	59 Å²	59	108.3 Å²	108.3	41%	0.413	56%	0.555	S	S	.	*	H	α-helix	trans	-56.3	-44.5	176	170.9	0	0	0	0	113.2	K20 Q28	K20-S24 WeakPolarHBondContact O-CB 3.46Å; K20-S24 PolarHBondContact O-N 2.78Å; S24-Q28 PolarHBondContact O-N 3.44Å; S24-Q28 VanDerWaalsContact O-N 3.1Å
25	K	51.3	Low	52.9	Low	136 Å²	136	110.6 Å²	110.6	59%	0.591	56%	0.561	S	S	*	*	H	α-helix	trans	-68.6	-37.7	178.4	-72.4	-179.3	-180	-169	0	113	N21 K22 V23 Q28 A29	N21-K25 WeakPolarHBondContact O-CG 3.36Å; N21-K25 PolarHBondContact O-N 2.91Å; K22-K25 PolarHBondContact O-N 3.41Å; V23-K25 PolarHBondContact O-N 3.42Å; K25-Q28 PolarHBondContact O-N 2.88Å; K25-A29 WeakPolarHBondContact O-CB 3.14Å; K25-A29 PolarHBondContact O-N 3.11Å
26	G	50.8	Low	52.2	Low	35 Å²	35	114.2 Å²	114.2	36%	0.361	58%	0.575	S	S	.	*	H	α-helix	trans	-62.5	-42.9	176.4	0	0	0	0	0	112.5	K22 V23 A29 L30	K22-G26 PolarHBondContact O-N 3.46Å; V23-G26 PolarHBondContact O-N 3.34Å; G26-A29 PolarHBondContact O-N 3.32Å; G26-L30 WeakPolarHBondContact O-CG 3.32Å; G26-L30 PolarHBondContact O-N 3.01Å
27	Y	47.5	Very low	51.5	Low	161 Å²	161	117.6 Å²	117.6	63%	0.631	59%	0.591	S	S	*	*	H	α-helix	trans	-69.5	-38.1	176.6	-83.9	-82.6	0	0	0	112.7	V23 L30 I31	V23-Y27 HydrophobicContact CG1-CD2 3.82Å; V23-Y27 HydrophobicContact CG1-CE2 3.78Å; V23-Y27 WeakPolarHBondContact O-CD2 3.35Å; V23-Y27 PolarHBondContact O-N 2.91Å; V23-Y27 VanDerWaalsContact O-N 3.12Å; Y27-L30 PolarHBondContact O-N 2.96Å; Y27-I31 WeakPolarHBondContact O-CD1 3.48Å; Y27-I31 VanDerWaalsContact O-CG1 3.22Å; Y27-I31 WeakPolarHBondContact O-CG1 3.49Å; Y27-I31 PolarHBondContact O-N 2.88Å; Y27-I31 VanDerWaalsContact O-N 3.1Å
28	Q	47.2	Very low	50.6	Low	130 Å²	130	116 Å²	116	61%	0.607	59%	0.594	S	S	*	*	H	α-helix	trans	-65.1	-38.5	174.8	-95.9	-177.7	3	0	0	113.1	S24 K25 I31 S32	S24-Q28 PolarHBondContact O-N 3.44Å; S24-Q28 VanDerWaalsContact O-N 3.1Å; K25-Q28 PolarHBondContact O-N 2.88Å; Q28-I31 PolarHBondContact O-N 3.45Å; Q28-S32 VanDerWaalsContact O-CB 3.28Å; Q28-S32 WeakPolarHBondContact O-CB 2.96Å; Q28-S32 PolarHBondContact O-N 2.88Å; Q28-S32 PolarHBondContact O-OG 3.45Å
29	A	49.2	Very low	50.1	Low	60 Å²	60	115.2 Å²	115.2	50%	0.496	60%	0.596	S	S	.	*	H	α-helix	trans	-65.7	-40	178.3	0	0	0	0	0	112.5	K25 G26 S32 S33	K25-A29 WeakPolarHBondContact O-CB 3.14Å; K25-A29 PolarHBondContact O-N 3.11Å; G26-A29 PolarHBondContact O-N 3.32Å; A29-S32 PolarHBondContact O-N 3.01Å; A29-S33 PolarHBondContact O-N 3.41Å; A29-S33 VanDerWaalsContact O-N 3.11Å; A29-S33 PolarHBondContact O-OG 3.09Å
30	L	48.4	Very low	49.4	Very low	117 Å²	117	115.2 Å²	115.2	61%	0.613	60%	0.604	S	S	*	*	H	α-helix	trans	-70.3	-34.3	177.1	-71.9	168.6	0	0	0	112.8	G26 Y27	G26-L30 WeakPolarHBondContact O-CG 3.32Å; G26-L30 PolarHBondContact O-N 3.01Å; Y27-L30 PolarHBondContact O-N 2.96Å
31	I	48.3	Very low	48.7	Very low	96 Å²	96	114.9 Å²	114.9	49%	0.492	62%	0.619	S	S	.	*	H	α-helix	trans	-75.1	-33.2	176.2	-64.2	165.7	0	0	0	110.8	Y27 Q28 F35	Y27-I31 WeakPolarHBondContact O-CD1 3.48Å; Y27-I31 VanDerWaalsContact O-CG1 3.22Å; Y27-I31 WeakPolarHBondContact O-CG1 3.49Å; Y27-I31 PolarHBondContact O-N 2.88Å; Y27-I31 VanDerWaalsContact O-N 3.1Å; Q28-I31 PolarHBondContact O-N 3.45Å; I31-F35 HydrophobicContact CG2-CD2 4.06Å; I31-F35 HydrophobicContact CG2-CE2 4.42Å; I31-F35 WeakPolarHBondContact O-CB 3.19Å; I31-F35 WeakPolarHBondContact O-CD2 3.21Å
32	S	48.4	Very low	48.3	Very low	90 Å²	90	114.5 Å²	114.5	63%	0.629	62%	0.623	S	S	*	*	H	α-helix	trans	-81.7	-24.7	-176.7	-53.3	0	0	0	0	113.3	Q28 A29	Q28-S32 VanDerWaalsContact O-CB 3.28Å; Q28-S32 WeakPolarHBondContact O-CB 2.96Å; Q28-S32 PolarHBondContact O-N 2.88Å; Q28-S32 PolarHBondContact O-OG 3.45Å; A29-S32 PolarHBondContact O-N 3.01Å
33	S	50.6	Low	47.5	Very low	94 Å²	94	112.3 Å²	112.3	66%	0.657	63%	0.628	S	S	*	*	H	α-helix	trans	-94.3	-11.9	-179.4	79.2	0	0	0	0	115.1	A29	A29-S33 PolarHBondContact O-N 3.41Å; A29-S33 VanDerWaalsContact O-N 3.11Å; A29-S33 PolarHBondContact O-OG 3.09Å
34	S	50.7	Low	46.9	Very low	78 Å²	78	114.2 Å²	114.2	55%	0.545	64%	0.644	S	S	.	*	H	α-helix	trans	-122.5	2.4	-173	-64.2	0	0	0	0	116.1
35	F	48.9	Very low	46.5	Very low	151 Å²	151	119 Å²	119	66%	0.662	66%	0.658	S	S	*	*	S	Bend	trans	-105.6	-1.6	-173.8	-91.9	-90.9	0	0	0	116.8	I31	I31-F35 HydrophobicContact CG2-CD2 4.06Å; I31-F35 HydrophobicContact CG2-CE2 4.42Å; I31-F35 WeakPolarHBondContact O-CB 3.19Å; I31-F35 WeakPolarHBondContact O-CD2 3.21Å
36	Y	42.6	Very low	46.4	Very low	223 Å²	223	116.8 Å²	116.8	88%	0.875	67%	0.665	S	S	*	*			trans	-110.8	23.8	174.1	-74.1	-79.5	0	0	0	113.5	T38	Y36-T38 VanDerWaalsContact C-N 3.28Å; Y36-T38 PolarHBondContact O-N 2.79Å
37	Q	42.7	Very low	46.3	Very low	178 Å²	178	122.6 Å²	122.6	83%	0.832	68%	0.68	S	S	*	*	S	Bend	trans	-70.8	95	160.1	-107	177.1	0.4	0	0	108.2	I39	Q37-I39 PolarHBondContact O-N 3.17Å; Q37-I39 VanDerWaalsContact O-N 3.15Å
38	T	42	Very low	46.6	Very low	127 Å²	127	119.3 Å²	119.3	78%	0.779	68%	0.679	S	S	*	*			trans	-1.2	98	159.3	-42.9	0	0	0	0	113.5	Y36 P40	Y36-T38 VanDerWaalsContact C-N 3.28Å; Y36-T38 PolarHBondContact O-N 2.79Å; T38-P40 WeakPolarHBondContact O-CD 3.5Å; T38-P40 VanDerWaalsContact O-N 3.16Å
39	I	47.3	Very low	46.9	Very low	135 Å²	135	123 Å²	123	69%	0.692	70%	0.696	S	S	*	*			trans	-62.5	113.9	167.1	-61.8	171.1	0	0	0	106.4	Q37 S41 F45	Q37-I39 PolarHBondContact O-N 3.17Å; Q37-I39 VanDerWaalsContact O-N 3.15Å; I39-S41 PolarHBondContact O-N 3.49Å; I39-F45 HydrophobicContact CG2-CE2 4.42Å
40	P	43.7	Very low	46.8	Very low	86 Å²	86	124.5 Å²	124.5	56%	0.558	70%	0.703	S	S	*	*			trans	-68.4	123.1	170.6	-3	19.3	0	0	0	107	T38 S42	T38-P40 WeakPolarHBondContact O-CD 3.5Å; T38-P40 VanDerWaalsContact O-N 3.16Å; P40-S42 PolarHBondContact O-N 3.33Å
41	S	43.6	Very low	46.9	Very low	129 Å²	129	124.8 Å²	124.8	90%	0.902	71%	0.709	S	S	*	*	S	Bend	trans	-73.6	29.4	-176.6	48.5	0	0	0	0	114.1	I39	I39-S41 PolarHBondContact O-N 3.49Å
42	S	47.4	Very low	46.8	Very low	84 Å²	84	131 Å²	131	59%	0.587	73%	0.726	S	S	*	*	S	Bend	trans	-132.5	108.6	179.4	50.3	0	0	0	0	111.2	P40	P40-S42 PolarHBondContact O-N 3.33Å
43	S	38.2	Very low	46.8	Very low	111 Å²	111	132.2 Å²	132.2	78%	0.776	73%	0.73	S	S	*	*	S	Bend	trans	45.9	115.8	145.9	53.6	0	0	0	0	119
44	S	42.6	Very low	46.6	Very low	118 Å²	118	134 Å²	134	83%	0.825	74%	0.736	S	S	*	*			trans	87.2	67.6	163.7	-53.9	0	0	0	0	116.9	A46	S44-A46 VanDerWaalsContact C-N 3.33Å; S44-A46 PolarHBondContact O-N 3.14Å
45	F	46	Very low	46.3	Very low	161 Å²	161	135.3 Å²	135.3	71%	0.706	74%	0.741	S	S	*	*			trans	-71.3	89.8	157.9	-116.3	-92.6	0	0	0	109.6	I39 F47	I39-F45 HydrophobicContact CG2-CE2 4.42Å; F45-F47 PolarHBondContact O-N 3.28Å
46	A	48.8	Very low	45.9	Very low	88 Å²	88	132 Å²	132	73%	0.727	74%	0.741	S	S	*	*			trans	-73.6	113.4	160.3	0	0	0	0	0	107.6	S44	S44-A46 VanDerWaalsContact C-N 3.33Å; S44-A46 PolarHBondContact O-N 3.14Å
47	F	48.6	Very low	45.9	Very low	157 Å²	157	128.6 Å²	128.6	69%	0.689	74%	0.739	S	S	*	*			trans	-59.3	127.2	173.3	-102.3	-96.6	0	0	0	109.2	F45 Q49	F45-F47 PolarHBondContact O-N 3.28Å; F47-Q49 PolarHBondContact O-N 3.34Å
48	P	53.4	Low	45.6	Very low	92 Å²	92	125.8 Å²	125.8	60%	0.597	73%	0.734	S	S	*	*			trans	-63.1	115.4	177.4	24.1	-30.8	0	0	0	108.6	S50	P48-S50 PolarHBondContact O-N 3.48Å
49	Q	54.5	Low	45.5	Very low	208 Å²	208	127.1 Å²	127.1	97%	0.972	74%	0.735	S	S	*	*	S	Bend	trans	-64.7	-6.7	-178.2	-74.1	179.9	-22.9	0	0	113.5	F47	F47-Q49 PolarHBondContact O-N 3.34Å
50	S	45.3	Very low	45.2	Very low	92 Å²	92	129 Å²	129	64%	0.643	75%	0.745	S	S	*	*			trans	-153	122.7	177	59	0	0	0	0	110.4	P48	P48-S50 PolarHBondContact O-N 3.48Å
51	V	50.8	Low	45.2	Very low	122 Å²	122	129.2 Å²	129.2	74%	0.739	75%	0.745	S	S	*	*			trans	-96.7	107.2	164.6	-179.2	0	0	0	0	106.7	V53	V51-V53 HydrophobicContact CG1-CG2 4.43Å; V51-V53 PolarHBondContact O-N 3.02Å
52	R	46.3	Very low	45.4	Very low	226 Å²	226	131 Å²	131	85%	0.853	74%	0.739	S	S	*	*			trans	-76.3	107.9	168.9	-80.8	-173.1	172.5	-162.4	-1.2	108	V54	R52-V54 PolarHBondContact O-N 3.4Å
53	V	49.6	Very low	45.5	Very low	116 Å²	116	134.6 Å²	134.6	70%	0.703	75%	0.746	S	S	*	*			trans	-80.2	106.2	167.1	-176.5	0	0	0	0	107	V51 V55	V51-V53 HydrophobicContact CG1-CG2 4.43Å; V51-V53 PolarHBondContact O-N 3.02Å; V53-V55 HydrophobicContact CG1-CG2 3.84Å; V53-V55 PolarHBondContact O-N 3.34Å
54	V	45.5	Very low	46.3	Very low	132 Å²	132	135.4 Å²	135.4	80%	0.8	75%	0.747	S	S	*	*			trans	-85.5	100	169.7	-177.6	0	0	0	0	106.8	R52	R52-V54 PolarHBondContact O-N 3.4Å
55	V	43.7	Very low	47	Very low	105 Å²	105	136.1 Å²	136.1	64%	0.636	74%	0.735	S	S	*	*			trans	-82.8	120.4	167.9	-176.8	0	0	0	0	106.8	V53 D57	V53-V55 HydrophobicContact CG1-CG2 3.84Å; V53-V55 PolarHBondContact O-N 3.34Å; V55-D57 PolarHBondContact O-N 3.01Å
56	A	41.4	Very low	47.6	Very low	82 Å²	82	132.5 Å²	132.5	68%	0.678	72%	0.723	S	S	*	*	S	Bend	trans	-58.5	130.4	173.9	0	0	0	0	0	109.9
57	D	41.6	Very low	48.1	Very low	152 Å²	152	134.9 Å²	134.9	81%	0.813	71%	0.713	S	S	*	*	S	Bend	trans	42.9	73.8	162.7	-59.3	-24.9	0	0	0	116.3	V55	V55-D57 PolarHBondContact O-N 3.01Å
58	T	37.7	Very low	48.5	Very low	119 Å²	119	133.6 Å²	133.6	73%	0.73	71%	0.707	S	S	*	*	S	Bend	trans	161	120.7	137.4	37.5	0	0	0	0	109.1
59	L	39.1	Very low	48.7	Very low	155 Å²	155	136 Å²	136	81%	0.812	71%	0.711	S	S	*	*			trans	63.7	101.2	171.1	-63.2	157.4	0	0	0	115.2	V61	L59-V61 HydrophobicContact CB-CG2 4.1Å; L59-V61 PolarHBondContact O-N 3.2Å
60	L	40.6	Very low	49	Very low	173 Å²	173	128.9 Å²	128.9	91%	0.906	68%	0.677	S	S	*	*			trans	-67.6	73.6	169.2	-133.4	142.9	0	0	0	109.2	H62	L60-H62 PolarHBondContact O-N 3.45Å; L60-H62 VanDerWaalsContact O-N 3.11Å
61	V	44.2	Very low	49.8	Very low	92 Å²	92	129 Å²	129	56%	0.558	68%	0.676	S	S	*	*			trans	-74.4	104.7	176.6	-173.3	0	0	0	0	107.5	L59 H63	L59-V61 HydrophobicContact CB-CG2 4.1Å; L59-V61 PolarHBondContact O-N 3.2Å; V61-H63 WeakPolarHBondContact CG1-CD2 3.49Å; V61-H63 WeakPolarHBondContact CG1-NE2 3.47Å; V61-H63 PolarHBondContact O-N 3.28Å
62	H	48.2	Very low	50.4	Low	166 Å²	166	129.2 Å²	129.2	77%	0.769	67%	0.672	S	S	*	*			trans	-70.6	76.1	173.2	-152.7	-93.1	0	0	0	109	L60 T64	L60-H62 PolarHBondContact O-N 3.45Å; L60-H62 VanDerWaalsContact O-N 3.11Å; H62-T64 PolarHBondContact O-N 2.93Å; H62-T64 VanDerWaalsContact O-N 3.14Å
63	H	50.3	Low	51.2	Low	159 Å²	159	119.9 Å²	119.9	74%	0.736	64%	0.644	S	S	*	*			trans	-72.1	106.5	173.3	-87.9	-69.2	0	0	0	109.1	V61 F65	V61-H63 WeakPolarHBondContact CG1-CD2 3.49Å; V61-H63 WeakPolarHBondContact CG1-NE2 3.47Å; V61-H63 PolarHBondContact O-N 3.28Å; H63-F65 PolarHBondContact O-N 3.1Å
64	T	54.3	Low	51.9	Low	128 Å²	128	117.8 Å²	117.8	79%	0.785	63%	0.631	S	S	*	*			trans	-63.1	99.2	162.6	37.2	0	0	0	0	108.5	H62 D66	H62-T64 PolarHBondContact O-N 2.93Å; H62-T64 VanDerWaalsContact O-N 3.14Å; T64-D66 PolarHBondContact O-N 3.33Å
65	F	57.3	Low	52.6	Low	133 Å²	133	114.2 Å²	114.2	58%	0.583	62%	0.615	S	S	*	*			trans	-75.6	106.1	179.1	-175.5	-94.7	0	0	0	110	H63 W67 H70	H63-F65 PolarHBondContact O-N 3.1Å; F65-W67 HydrophobicContact CD1-CB 4.25Å; F65-W67 HydrophobicContact CE1-CB 4.29Å; F65-W67 PolarHBondContact O-N 3.37Å; F65-H70 HydrophobicContact CE1-CB 3.87Å; F65-H70 AromaticContact CE1-CG 3.86Å; F65-H70 HydrophobicContact CE2-CB 4.49Å; F65-H70 AromaticContact CE2-CD2 3.19Å; F65-H70 WeakPolarHBondContact CE2-CD2 3.48Å; F65-H70 AromaticContact CE2-CG 3.88Å; F65-H70 AromaticContact CE2-NE2 3.57Å; F65-H70 HydrophobicContact CZ-CB 3.68Å; F65-H70 AromaticContact CZ-CD2 2.96Å; F65-H70 WeakPolarHBondContact CZ-CD2 3.45Å; F65-H70 AromaticContact CZ-CE1 3.81Å; F65-H70 AromaticContact CZ-CG 3.16Å; F65-H70 AromaticContact CZ-ND1 3.7Å; F65-H70 AromaticContact CZ-NE2 3.42Å; F65-H70 WeakPolarHBondContact CZ-NE2 3.48Å
66	D	59	Low	53.8	Low	86 Å²	86	114.9 Å²	114.9	46%	0.46	61%	0.607	S	S	.	*			trans	-76	92.9	172.5	-174.3	6.9	0	0	0	110.5	T64 K68 H69	T64-D66 PolarHBondContact O-N 3.33Å; D66-K68 PolarHBondContact O-N 3.25Å; D66-K68 VanDerWaalsContact O-N 3.14Å; D66-K68 WeakPolarHBondContact OD1-CB 3.33Å; D66-K68 PolarHBondContact OD1-N 3.36Å; D66-H69 PolarHBondContact O-N 3.5Å; D66-H69 IonicContact OD1-ND1 3.99Å; D66-H69 IonicContact OD2-CE1 3.41Å; D66-H69 PolarHBondContact OD2-CE1 2.92Å; D66-H69 IonicContact OD2-ND1 2.79Å; D66-H69 PolarHBondContact OD2-ND1 3.39Å
67	W	58.8	Low	54.8	Low	137 Å²	137	118.3 Å²	118.3	52%	0.519	60%	0.602	S	S	.	*	T	Hydrogen-bonded Turn	trans	-61.2	-18.4	-179.5	58.8	-90.3	0	0	0	113.8	F65 H69 H70 A73	F65-W67 HydrophobicContact CD1-CB 4.25Å; F65-W67 HydrophobicContact CE1-CB 4.29Å; F65-W67 PolarHBondContact O-N 3.37Å; W67-H69 PolarHBondContact O-N 3.09Å; W67-H70 PolarHBondContact O-N 3.49Å; W67-A73 WeakPolarHBondContact O-CB 3.38Å
68	K	57.1	Low	55.9	Low	130 Å²	130	114.4 Å²	114.4	57%	0.565	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.8	-26.9	179.9	-67.6	-179.4	-179.4	175.6	0	112.4	D66	D66-K68 PolarHBondContact O-N 3.25Å; D66-K68 VanDerWaalsContact O-N 3.14Å; D66-K68 WeakPolarHBondContact OD1-CB 3.33Å; D66-K68 PolarHBondContact OD1-N 3.36Å
69	H	56.5	Low	57.2	Low	143 Å²	143	113.6 Å²	113.6	66%	0.662	58%	0.575	S	S	*	*	S	Bend	trans	-110.2	0.8	-175.9	-59.9	100.7	0	0	0	113	D66 W67	D66-H69 PolarHBondContact O-N 3.5Å; D66-H69 IonicContact OD1-ND1 3.99Å; D66-H69 IonicContact OD2-CE1 3.41Å; D66-H69 PolarHBondContact OD2-CE1 2.92Å; D66-H69 IonicContact OD2-ND1 2.79Å; D66-H69 PolarHBondContact OD2-ND1 3.39Å; W67-H69 PolarHBondContact O-N 3.09Å
70	H	61.5	Low	58.5	Low	58 Å²	58	112.9 Å²	112.9	27%	0.269	56%	0.561	S	S	.	*			trans	-71.3	130.4	-178.9	-166.3	-102.8	0	0	0	111.5	F65 W67 L72 A73 V74	F65-H70 HydrophobicContact CE1-CB 3.87Å; F65-H70 AromaticContact CE1-CG 3.86Å; F65-H70 HydrophobicContact CE2-CB 4.49Å; F65-H70 AromaticContact CE2-CD2 3.19Å; F65-H70 WeakPolarHBondContact CE2-CD2 3.48Å; F65-H70 AromaticContact CE2-CG 3.88Å; F65-H70 AromaticContact CE2-NE2 3.57Å; F65-H70 HydrophobicContact CZ-CB 3.68Å; F65-H70 AromaticContact CZ-CD2 2.96Å; F65-H70 WeakPolarHBondContact CZ-CD2 3.45Å; F65-H70 AromaticContact CZ-CE1 3.81Å; F65-H70 AromaticContact CZ-CG 3.16Å; F65-H70 AromaticContact CZ-ND1 3.7Å; F65-H70 AromaticContact CZ-NE2 3.42Å; F65-H70 WeakPolarHBondContact CZ-NE2 3.48Å; W67-H70 PolarHBondContact O-N 3.49Å; H70-L72 WeakPolarHBondContact ND1-CB 3.4Å; H70-L72 PolarHBondContact ND1-N 3.41Å; H70-L72 PolarHBondContact O-N 3.18Å; H70-L72 VanDerWaalsContact O-N 3.1Å; H70-A73 HydrophobicContact CB-CB 4.24Å; H70-A73 WeakPolarHBondContact O-CB 3.44Å; H70-A73 PolarHBondContact O-N 3.08Å; H70-V74 PolarHBondContact O-N 3.09Å
71	P	62.3	Low	59.5	Low	96 Å²	96	111 Å²	111	62%	0.623	55%	0.546	S	S	*	.	H	α-helix	trans	-53.7	-37.2	-176.9	-27.6	34	0	0	0	113.8	A75	P71-A75 VanDerWaalsContact O-CB 3.3Å; P71-A75 WeakPolarHBondContact O-CB 3.22Å; P71-A75 PolarHBondContact O-N 3.2Å
72	L	63.6	Low	60.2	Low	126 Å²	126	109.6 Å²	109.6	66%	0.66	54%	0.54	S	S	*	.	H	α-helix	trans	-69.6	-36.5	177.2	-61.8	178.5	0	0	0	112.9	H70 A75 Y76	H70-L72 WeakPolarHBondContact ND1-CB 3.4Å; H70-L72 PolarHBondContact ND1-N 3.41Å; H70-L72 PolarHBondContact O-N 3.18Å; H70-L72 VanDerWaalsContact O-N 3.1Å; L72-A75 PolarHBondContact O-N 3.34Å; L72-Y76 WeakPolarHBondContact O-CB 3.42Å; L72-Y76 PolarHBondContact O-N 3.28Å
73	A	62.8	Low	60.9	Low	30 Å²	30	106.3 Å²	106.3	25%	0.248	53%	0.525	C	S	.	.	H	α-helix	trans	-70.8	-37.9	177.6	0	0	0	0	0	111	W67 H70 R77	W67-A73 WeakPolarHBondContact O-CB 3.38Å; H70-A73 HydrophobicContact CB-CB 4.24Å; H70-A73 WeakPolarHBondContact O-CB 3.44Å; H70-A73 PolarHBondContact O-N 3.08Å; A73-R77 WeakPolarHBondContact O-CB 3.3Å; A73-R77 PolarHBondContact O-N 3.48Å
74	V	63.4	Low	61.4	Low	72 Å²	72	104.3 Å²	104.3	44%	0.436	52%	0.516	S	S	.	.	H	α-helix	trans	-63.8	-46.8	172	178.2	0	0	0	0	110.4	H70 Y76 R77 S78	H70-V74 PolarHBondContact O-N 3.09Å; V74-Y76 PolarHBondContact O-N 2.99Å; V74-R77 PolarHBondContact O-N 3.16Å; V74-S78 WeakPolarHBondContact O-CB 3.34Å; V74-S78 PolarHBondContact O-N 3.16Å; V74-S78 PolarHBondContact O-OG 3.28Å; V74-S78 VanDerWaalsContact O-OG 3.11Å
75	A	61.5	Low	61.4	Low	57 Å²	57	104.3 Å²	104.3	47%	0.471	51%	0.507	S	S	.	.	H	α-helix	trans	-60.9	-43.3	177	0	0	0	0	0	112.2	P71 L72 S78 H79	P71-A75 VanDerWaalsContact O-CB 3.3Å; P71-A75 WeakPolarHBondContact O-CB 3.22Å; P71-A75 PolarHBondContact O-N 3.2Å; L72-A75 PolarHBondContact O-N 3.34Å; A75-S78 PolarHBondContact O-N 3.1Å; A75-H79 WeakPolarHBondContact O-CB 3.48Å; A75-H79 PolarHBondContact O-N 2.71Å
76	Y	67.6	Low	61.2	Low	119 Å²	119	104.4 Å²	104.4	47%	0.467	51%	0.509	S	S	.	.	H	α-helix	trans	-64.1	-43.4	176.6	-174	-97.8	0	0	0	112.2	L72 V74 H79 R80	L72-Y76 WeakPolarHBondContact O-CB 3.42Å; L72-Y76 PolarHBondContact O-N 3.28Å; V74-Y76 PolarHBondContact O-N 2.99Å; Y76-H79 PolarHBondContact O-N 3.04Å; Y76-R80 HydrophobicContact CD1-CG 4.46Å; Y76-R80 HydrophobicContact CE1-CG 3.95Å; Y76-R80 WeakPolarHBondContact O-CB 3.38Å; Y76-R80 PolarHBondContact O-N 3.32Å; Y76-R80 PolarHBondContact OH-NE 3.45Å
77	R	64.2	Low	61	Low	153 Å²	153	104.4 Å²	104.4	58%	0.577	51%	0.513	S	S	*	.	H	α-helix	trans	-61.6	-43.6	174.4	-83.9	-175.5	172.3	-158.2	-3.2	111.8	A73 V74 R80 K81	A73-R77 WeakPolarHBondContact O-CB 3.3Å; A73-R77 PolarHBondContact O-N 3.48Å; V74-R77 PolarHBondContact O-N 3.16Å; R77-R80 PolarHBondContact O-N 3.02Å; R77-K81 WeakPolarHBondContact O-CG 3.41Å; R77-K81 PolarHBondContact O-N 2.98Å
78	S	64.5	Low	60.6	Low	71 Å²	71	104.3 Å²	104.3	50%	0.497	52%	0.518	S	S	.	.	H	α-helix	trans	-64.4	-43	177.7	-65.7	0	0	0	0	112	V74 A75 K81 S82	V74-S78 WeakPolarHBondContact O-CB 3.34Å; V74-S78 PolarHBondContact O-N 3.16Å; V74-S78 PolarHBondContact O-OG 3.28Å; V74-S78 VanDerWaalsContact O-OG 3.11Å; A75-S78 PolarHBondContact O-N 3.1Å; S78-K81 PolarHBondContact O-N 3.16Å; S78-S82 PolarHBondContact O-N 3.12Å; S78-S82 PolarHBondContact O-OG 2.92Å
79	H	65	Low	60.3	Low	101 Å²	101	99.8 Å²	99.8	47%	0.468	51%	0.508	S	S	.	.	H	α-helix	trans	-64.4	-41.6	176.1	-177.4	-67.5	0	0	0	112.4	A75 Y76 K81 S82 Q83	A75-H79 WeakPolarHBondContact O-CB 3.48Å; A75-H79 PolarHBondContact O-N 2.71Å; Y76-H79 PolarHBondContact O-N 3.04Å; H79-K81 VanDerWaalsContact C-N 3.34Å; H79-K81 PolarHBondContact O-N 3.01Å; H79-S82 PolarHBondContact O-N 3.09Å; H79-S82 PolarHBondContact O-OG 3.06Å; H79-Q83 PolarHBondContact CE1-NE2 2.97Å; H79-Q83 WeakPolarHBondContact O-CG 3.46Å; H79-Q83 PolarHBondContact O-N 3.2Å; H79-Q83 VanDerWaalsContact O-N 3.1Å
80	R	65.1	Low	60	Low	140 Å²	140	98.3 Å²	98.3	53%	0.528	51%	0.505	S	S	.	.	H	α-helix	trans	-61.4	-42.4	174.6	-94.4	-112.6	-178.7	168.6	-3.5	112	Y76 R77 Q83 Q84	Y76-R80 HydrophobicContact CD1-CG 4.46Å; Y76-R80 HydrophobicContact CE1-CG 3.95Å; Y76-R80 WeakPolarHBondContact O-CB 3.38Å; Y76-R80 PolarHBondContact O-N 3.32Å; Y76-R80 PolarHBondContact OH-NE 3.45Å; R77-R80 PolarHBondContact O-N 3.02Å; R80-Q83 PolarHBondContact O-N 3.06Å; R80-Q84 WeakPolarHBondContact O-CG 3.49Å; R80-Q84 PolarHBondContact O-N 3.05Å; R80-Q84 VanDerWaalsContact O-N 3.15Å
81	K	62.9	Low	59.4	Low	135 Å²	135	102.2 Å²	102.2	59%	0.587	52%	0.523	S	S	*	.	H	α-helix	trans	-65.1	-43	177.4	-74	-177	176.6	-171	0	111.9	R77 S78 H79 Q83 Q84 H85	R77-K81 WeakPolarHBondContact O-CG 3.41Å; R77-K81 PolarHBondContact O-N 2.98Å; S78-K81 PolarHBondContact O-N 3.16Å; H79-K81 VanDerWaalsContact C-N 3.34Å; H79-K81 PolarHBondContact O-N 3.01Å; K81-Q83 VanDerWaalsContact C-N 3.33Å; K81-Q83 PolarHBondContact O-N 3.42Å; K81-Q84 PolarHBondContact O-N 3.25Å; K81-H85 PolarHBondContact O-CD2 3.44Å; K81-H85 PolarHBondContact O-N 3.38Å
82	S	59	Low	58.7	Low	62 Å²	62	102.6 Å²	102.6	43%	0.434	52%	0.523	S	S	.	.	H	α-helix	trans	-65.2	-35	178.4	62.7	0	0	0	0	112.8	S78 H79 H85 Q86	S78-S82 PolarHBondContact O-N 3.12Å; S78-S82 PolarHBondContact O-OG 2.92Å; H79-S82 PolarHBondContact O-N 3.09Å; H79-S82 PolarHBondContact O-OG 3.06Å; S82-H85 PolarHBondContact O-N 3.13Å; S82-Q86 PolarHBondContact O-N 3.1Å; S82-Q86 VanDerWaalsContact O-N 3.13Å
83	Q	62.5	Low	58	Low	96 Å²	96	102.3 Å²	102.3	45%	0.449	52%	0.522	S	S	.	.	H	α-helix	trans	-69.2	-34.7	174.2	-73.5	-168.9	-28	0	0	113.6	H79 R80 K81 H85 Q86 T87	H79-Q83 PolarHBondContact CE1-NE2 2.97Å; H79-Q83 WeakPolarHBondContact O-CG 3.46Å; H79-Q83 PolarHBondContact O-N 3.2Å; H79-Q83 VanDerWaalsContact O-N 3.1Å; R80-Q83 PolarHBondContact O-N 3.06Å; K81-Q83 VanDerWaalsContact C-N 3.33Å; K81-Q83 PolarHBondContact O-N 3.42Å; Q83-H85 VanDerWaalsContact C-N 3.34Å; Q83-H85 PolarHBondContact O-N 3.07Å; Q83-Q86 PolarHBondContact O-N 3.5Å; Q83-T87 PolarHBondContact O-N 3.41Å; Q83-T87 PolarHBondContact O-OG1 3.05Å
84	Q	60.8	Low	57.1	Low	117 Å²	117	112.1 Å²	112.1	55%	0.547	55%	0.553	S	S	.	*	H	α-helix	trans	-63.4	-40.9	174.9	-75.9	-180	-33	0	0	111.7	R80 K81 Q86 T87 Q88	R80-Q84 WeakPolarHBondContact O-CG 3.49Å; R80-Q84 PolarHBondContact O-N 3.05Å; R80-Q84 VanDerWaalsContact O-N 3.15Å; K81-Q84 PolarHBondContact O-N 3.25Å; Q84-Q86 VanDerWaalsContact C-N 3.35Å; Q84-Q86 PolarHBondContact O-N 3.24Å; Q84-T87 PolarHBondContact O-N 3.49Å; Q84-Q88 PolarHBondContact O-N 3.39Å
85	H	53.7	Low	56.5	Low	128 Å²	128	111.8 Å²	111.8	59%	0.593	56%	0.563	S	S	*	*	H	α-helix	trans	-69.1	-30.9	175.1	-66.9	-62.5	0	0	0	113.1	K81 S82 Q83 T87 G89	K81-H85 PolarHBondContact O-CD2 3.44Å; K81-H85 PolarHBondContact O-N 3.38Å; S82-H85 PolarHBondContact O-N 3.13Å; Q83-H85 VanDerWaalsContact C-N 3.34Å; Q83-H85 PolarHBondContact O-N 3.07Å; H85-T87 VanDerWaalsContact C-N 3.32Å; H85-G89 PolarHBondContact O-N 3.11Å
86	Q	52.7	Low	56.2	Low	135 Å²	135	113 Å²	113	63%	0.631	57%	0.565	S	S	*	*	H	α-helix	trans	-68.7	-32.4	172.1	-75.6	-172.5	-8.2	0	0	112.4	S82 Q83 Q84 N90	S82-Q86 PolarHBondContact O-N 3.1Å; S82-Q86 VanDerWaalsContact O-N 3.13Å; Q83-Q86 PolarHBondContact O-N 3.5Å; Q84-Q86 VanDerWaalsContact C-N 3.35Å; Q84-Q86 PolarHBondContact O-N 3.24Å; Q86-N90 VanDerWaalsContact O-CB 3.27Å; Q86-N90 WeakPolarHBondContact O-CB 3.32Å; Q86-N90 PolarHBondContact O-N 2.94Å
87	T	54.5	Low	55.3	Low	87 Å²	87	118.8 Å²	118.8	53%	0.534	59%	0.586	S	S	.	*	H	α-helix	trans	-76.9	-34.7	179.5	-35.6	0	0	0	0	111.6	Q83 Q84 H85 Q91	Q83-T87 PolarHBondContact O-N 3.41Å; Q83-T87 PolarHBondContact O-OG1 3.05Å; Q84-T87 PolarHBondContact O-N 3.49Å; H85-T87 VanDerWaalsContact C-N 3.32Å; T87-Q91 WeakPolarHBondContact O-CG 3.15Å; T87-Q91 PolarHBondContact O-N 3.03Å
88	Q	51.7	Low	54.6	Low	135 Å²	135	120 Å²	120	63%	0.631	60%	0.596	S	S	*	*	H	α-helix	trans	-72.2	-40.3	169.7	-86.3	-176.9	-25.4	0	0	112.6	Q84 N90 Q91 V92	Q84-Q88 PolarHBondContact O-N 3.39Å; Q88-N90 PolarHBondContact O-N 3.34Å; Q88-Q91 PolarHBondContact O-N 3.15Å; Q88-V92 PolarHBondContact O-N 3.23Å
89	G	50.3	Low	53.8	Low	34 Å²	34	123.9 Å²	123.9	35%	0.351	61%	0.61	S	S	.	*	H	α-helix	trans	-65.7	-36.1	176.1	0	0	0	0	0	113.4	H85 V92 L93	H85-G89 PolarHBondContact O-N 3.11Å; G89-V92 PolarHBondContact O-N 3.14Å; G89-L93 PolarHBondContact O-N 3.45Å
90	N	50.1	Low	52.8	Low	112 Å²	112	128.2 Å²	128.2	60%	0.599	63%	0.63	S	S	*	*	H	α-helix	trans	-77	-20.9	174.1	-97.3	-9.9	0	0	0	113.9	Q86 Q88 R94	Q86-N90 VanDerWaalsContact O-CB 3.27Å; Q86-N90 WeakPolarHBondContact O-CB 3.32Å; Q86-N90 PolarHBondContact O-N 2.94Å; Q88-N90 PolarHBondContact O-N 3.34Å; N90-R94 WeakPolarHBondContact O-CB 3.28Å; N90-R94 PolarHBondContact O-N 3.03Å; N90-R94 VanDerWaalsContact O-N 3.14Å
91	Q	48.9	Very low	52.3	Low	141 Å²	141	126.5 Å²	126.5	66%	0.659	64%	0.64	S	S	*	*	H	α-helix	trans	-75.4	-32.4	170.8	-78.6	-174.4	13.8	0	0	111.9	T87 Q88 R94 G95	T87-Q91 WeakPolarHBondContact O-CG 3.15Å; T87-Q91 PolarHBondContact O-N 3.03Å; Q88-Q91 PolarHBondContact O-N 3.15Å; Q91-R94 PolarHBondContact O-N 3.34Å; Q91-G95 PolarHBondContact O-N 2.96Å
92	V	48.2	Very low	51.6	Low	103 Å²	103	125.9 Å²	125.9	62%	0.624	65%	0.649	S	S	*	*	H	α-helix	trans	-68.5	-40	172.6	179	0	0	0	0	111.1	Q88 G89 R94 G95	Q88-V92 PolarHBondContact O-N 3.23Å; G89-V92 PolarHBondContact O-N 3.14Å; V92-R94 VanDerWaalsContact C-N 3.32Å; V92-R94 PolarHBondContact O-N 2.98Å; V92-G95 PolarHBondContact O-N 3.31Å
93	L	49.5	Very low	51.3	Low	121 Å²	121	128.4 Å²	128.4	63%	0.634	66%	0.663	S	S	*	*	H	α-helix	trans	-75.2	-15.9	177.2	-75.9	161.8	0	0	0	114.6	G89	G89-L93 PolarHBondContact O-N 3.45Å
94	R	44.1	Very low	50.6	Low	236 Å²	236	130.9 Å²	130.9	89%	0.891	68%	0.684	S	S	*	*	H	α-helix	trans	-85	-12.5	171.1	-140.7	173.5	-166.1	-124.7	3.4	112.8	N90 Q91 V92	N90-R94 WeakPolarHBondContact O-CB 3.28Å; N90-R94 PolarHBondContact O-N 3.03Å; N90-R94 VanDerWaalsContact O-N 3.14Å; Q91-R94 PolarHBondContact O-N 3.34Å; V92-R94 VanDerWaalsContact C-N 3.32Å; V92-R94 PolarHBondContact O-N 2.98Å
95	G	50	Low	50.2	Low	64 Å²	64	128.4 Å²	128.4	66%	0.66	69%	0.69	S	S	*	*	S	Bend	trans	-95.2	-4	177.8	0	0	0	0	0	115.5	Q91 V92	Q91-G95 PolarHBondContact O-N 2.96Å; V92-G95 PolarHBondContact O-N 3.31Å
96	T	54.2	Low	50.2	Low	83 Å²	83	128.8 Å²	128.8	51%	0.509	70%	0.704	S	S	.	*			trans	-129.1	36.1	-169.3	64.2	0	0	0	0	115	K98	T96-K98 VanDerWaalsContact C-N 3.33Å; T96-K98 WeakPolarHBondContact O-CG 3.31Å; T96-K98 PolarHBondContact O-N 2.83Å
97	R	48.7	Very low	50.3	Low	241 Å²	241	133.8 Å²	133.8	91%	0.909	72%	0.717	S	S	*	*			trans	-85.3	84.5	155.1	-73	-169.3	-174.6	-166.2	2	107.1
98	K	49.6	Very low	50	Low	179 Å²	179	134.5 Å²	134.5	78%	0.778	72%	0.723	S	S	*	*				71.7	104.7	87.2	-84.2	-168.8	179.3	-174.8	0	111.7	T96	T96-K98 VanDerWaalsContact C-N 3.33Å; T96-K98 WeakPolarHBondContact O-CG 3.31Å; T96-K98 PolarHBondContact O-N 2.83Å
99	L	49	Very low	50.1	Low	152 Å²	152	132.1 Å²	132.1	80%	0.796	74%	0.735	S	S	*	*			trans	65.2	91.6	153.3	-71.8	105.9	0	0	0	115.7	S101	L99-S101 PolarHBondContact O-N 3.11Å; L99-S101 VanDerWaalsContact O-N 3.07Å
100	E	44.5	Very low	50.6	Low	191 Å²	191	138 Å²	138	89%	0.893	76%	0.757	S	S	*	*			trans	-44	107.4	142.3	-60.9	178.4	164.5	0	0	109	P102	E100-P102 WeakPolarHBondContact O-CD 3.36Å
101	S	53.5	Low	50.5	Low	105 Å²	105	143.3 Å²	143.3	73%	0.734	77%	0.769	S	S	*	*			trans	-76.2	119	161.4	33.5	0	0	0	0	107.9	L99 T103	L99-S101 PolarHBondContact O-N 3.11Å; L99-S101 VanDerWaalsContact O-N 3.07Å; S101-T103 PolarHBondContact O-N 3.39Å
102	P	47.9	Very low	50.7	Low	121 Å²	121	147.9 Å²	147.9	79%	0.786	78%	0.78	S	S	*	*			trans	-90.5	87.3	175.5	33.6	-26.7	0	0	0	108.2	E100	E100-P102 WeakPolarHBondContact O-CD 3.36Å
103	T	52.8	Low	51	Low	116 Å²	116	150.5 Å²	150.5	71%	0.712	79%	0.786	S	S	*	*			trans	-151.5	99.6	173.4	-47.4	0	0	0	0	113.1	S101	S101-T103 PolarHBondContact O-N 3.39Å
104	V	47.8	Very low	51.1	Low	147 Å²	147	152.9 Å²	152.9	89%	0.891	79%	0.793	S	S	*	*			trans	51.5	102.7	134	-166.2	0	0	0	0	117.7
105	G	52.8	Low	51.5	Low	66 Å²	66	147.5 Å²	147.5	68%	0.68	79%	0.787	S	S	*	*			trans	-175.7	150.5	165.1	0	0	0	0	0	111.2
106	P	52.9	Low	52	Low	135 Å²	135	154.7 Å²	154.7	88%	0.877	79%	0.794	S	S	*	*	P	Polyproline II helix		-75.7	142.6	-121.2	29.1	-35.1	0	0	0	115.5
107	R	55.2	Low	51.9	Low	240 Å²	240	158.3 Å²	158.3	91%	0.906	81%	0.81	S	S	*	*	P	Polyproline II helix	trans	-55.7	165.3	164.6	-125.4	-171.3	171	-178.2	-3.3	111.4
108	P	48.3	Very low	52.5	Low	102 Å²	102	155.1 Å²	155.1	66%	0.662	80%	0.803	S	S	*	*	P	Polyproline II helix	trans	-74.8	146.7	-134.7	12.8	10.5	0	0	0	114.1	L110	P108-L110 PolarHBondContact O-N 3.36Å; P108-L110 VanDerWaalsContact O-N 3.1Å
109	G	55	Low	52.7	Low	85 Å²	85	158.2 Å²	158.2	88%	0.876	83%	0.827	S	S	*	*			trans	-67.7	103.5	173	0	0	0	0	0	112.3
110	L	59.9	Low	52.9	Low	159 Å²	159	158.6 Å²	158.6	83%	0.832	83%	0.829	S	S	*	*			trans	-53.6	136.1	157.1	-89.1	86	0	0	0	110.6	P108 R112	P108-L110 PolarHBondContact O-N 3.36Å; P108-L110 VanDerWaalsContact O-N 3.1Å; L110-R112 PolarHBondContact O-N 2.76Å
111	R	47.2	Very low	53.4	Low	223 Å²	223	156.8 Å²	156.8	84%	0.842	83%	0.825	S	S	*	*			trans	-32.9	123.1	161.8	-145.9	178.2	-178	-155.7	0.5	112.2
112	R	54.8	Low	53.4	Low	236 Å²	236	159.7 Å²	159.7	89%	0.891	83%	0.83	S	S	*	*			trans	-121.4	98.7	157.2	-82.5	-169.4	172.9	-165.3	-1.5	109.5	L110 H114	L110-R112 PolarHBondContact O-N 2.76Å; R112-H114 PolarHBondContact O-N 3.4Å
113	Q	52.9	Low	53.7	Low	159 Å²	159	162 Å²	162	74%	0.743	83%	0.833	S	S	*	*			trans	-65.3	117.1	156.7	-149.3	175.9	-9.9	0	0	106.4
114	H	53.2	Low	53.8	Low	171 Å²	171	164.9 Å²	164.9	79%	0.792	84%	0.841	S	S	*	*			trans	-151	101.6	158.4	-109.7	-71.4	0	0	0	108.6	R112	R112-H114 PolarHBondContact O-N 3.4Å
115	T	52.2	Low	54.2	Low	123 Å²	123	166.1 Å²	166.1	76%	0.755	84%	0.837	S	S	*	*			trans	-54.5	132.7	160.2	37.1	0	0	0	0	110.8
116	R	59.8	Low	54.3	Low	214 Å²	214	173.2 Å²	173.2	81%	0.808	85%	0.848	S	S	*	*			trans	-143.1	113.7	148.5	-83	-166.9	170.6	177.3	-4.4	109.1	F118	R116-F118 HydrophobicContact CB-CE2 4.44Å
117	N	52.7	Low	54.4	Low	159 Å²	159	176.2 Å²	176.2	85%	0.85	85%	0.846	S	S	*	*			trans	-66.5	141.4	161.2	-69.8	-15.9	0	0	0	108.9
118	F	61.1	Low	54.3	Low	174 Å²	174	170.8 Å²	170.8	76%	0.763	84%	0.841	S	S	*	*			trans	-135.8	109.8	154.7	-86.3	-82.4	0	0	0	107.6	R116	R116-F118 HydrophobicContact CB-CE2 4.44Å
119	L	54.4	Low	54.8	Low	245 Å²	245	177.1 Å²	177.1	100%	1.283	86%	0.858	S	S	*	*			trans	46.1	0	162.1	-68.3	161.4	0	0	0	119

Retrieved 119 of 119 residues in 16.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).