A0A024A3D6_MOUSE Loading...

Echinoderm microtubule associated protein-like protein 1

AlphaFold DB , UniProt , Accession A0A024A3D6, Species MOUSE (Mus musculus, Mouse), Gene Eml1, Length 49 aa.

						>A0A024A3D6_MOUSE|A0A024A3D6|Eml1
GHSSFITHLDWSVNSQFLVSNSGDYEILYCSKPHLQWTQQPRHQRGLPL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	G	78.6	Confident	90.8	Very high	95 Å²	95	96.6 Å²	96.6	98%	0.979	54%	0.536	S	S	*	.				0	162.2	0	0	0	0	0	0	108.2
2	H	85.8	Confident	90.7	Very high	40 Å²	40	90.9 Å²	90.9	19%	0.185	51%	0.507	C	S	.	.			trans	-62.6	145.6	178.1	-72.7	-63.9	0	0	0	112	S20 S22 E26 L28	H2-S20 PolarHBondContact CE1-O 2.82Å; H2-S20 WeakPolarHBondContact NE2-CB 3.41Å; H2-S20 PolarHBondContact NE2-O 3.1Å; H2-S20 PolarHBondContact NE2-OG 3.31Å; H2-S22 WeakPolarHBondContact ND1-CB 3.18Å; H2-S22 PolarHBondContact ND1-OG 2.98Å; H2-S22 VanDerWaalsContact ND1-OG 3.09Å; H2-E26 PolarHBondContact CE1-O 3.47Å; H2-L28 VanDerWaalsContact CE1-CG 3.47Å; H2-L28 WeakPolarHBondContact CE1-CG 3.47Å
3	S	88.8	Confident	90.8	Very high	101 Å²	101	96 Å²	96	71%	0.706	54%	0.542	S	S	*	.	S	Bend	trans	-87.9	-11.6	176.4	92.9	0	0	0	0	113.3	D24	S3-D24 PolarHBondContact OG-OD2 2.84Å
4	S	91.8	Very high	90.7	Very high	42 Å²	42	96.4 Å²	96.4	29%	0.294	54%	0.541	S	S	.	.	S	Bend	trans	-129.1	179.5	178.8	-169.3	0	0	0	0	111.7
5	F	92.7	Very high	90.6	Very high	146 Å²	146	95.3 Å²	95.3	64%	0.64	54%	0.543	S	S	*	.			trans	-67.7	142.4	177.9	56.5	-90.7	0	0	0	111.6	T7 S22 G23	F5-T7 HydrophobicContact CD2-CG2 3.88Å; F5-T7 HydrophobicContact CE2-CG2 3.67Å; F5-S22 CarbonylContact O-C 3.47Å; F5-S22 WeakPolarHBondContact O-CA 3.33Å; F5-G23 PolarHBondContact O-N 3.41Å
6	I	93.2	Very high	90.4	Very high	98 Å²	98	96.6 Å²	96.6	50%	0.503	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	133	175	-63.2	171.3	0	0	0	108.9	H8 N21	I6-H8 WeakPolarHBondContact CG2-O 3.46Å; I6-N21 CarbonylContact C-O 3.59Å; I6-N21 WeakPolarHBondContact CA-O 3.35Å
7	T	95.5	Very high	90.2	Very high	58 Å²	58	96.2 Å²	96.2	36%	0.356	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	-38.1	178	52.7	0	0	0	0	112	F5 N21	F5-T7 HydrophobicContact CD2-CG2 3.88Å; F5-T7 HydrophobicContact CE2-CG2 3.67Å; T7-N21 PolarHBondContact N-O 2.63Å; T7-N21 PolarHBondContact OG1-ND2 3.14Å; T7-N21 PolarHBondContact OG1-O 3.3Å; T7-N21 VanDerWaalsContact OG1-O 3.14Å
8	H	93.9	Very high	90.2	Very high	118 Å²	118	92.8 Å²	92.8	55%	0.546	52%	0.515	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.8	148.6	-179.5	-58.1	-86.4	0	0	0	111.2	I6 S20 N21	I6-H8 WeakPolarHBondContact CG2-O 3.46Å; H8-S20 WeakPolarHBondContact O-CA 3.33Å; H8-N21 HydrophobicContact CB-CB 4.21Å; H8-N21 PolarHBondContact N-O 3.09Å; H8-N21 PolarHBondContact O-N 3.17Å
9	L	93.8	Very high	90.4	Very high	95 Å²	95	89.8 Å²	89.8	50%	0.497	50%	0.499	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.5	127	175.3	179.5	159	0	0	0	109.2	L18 V19	L9-L18 HydrophobicContact CD1-CD1 4.34Å; L9-L18 HydrophobicContact CD2-CD1 3.64Å; L9-L18 HydrophobicContact CG-CD1 3.93Å; L9-V19 WeakPolarHBondContact CA-O 3.39Å
10	D	94.1	Very high	90.5	Very high	105 Å²	105	85.6 Å²	85.6	56%	0.561	48%	0.476	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-133.8	151.1	-177.2	-67	-59.2	0	0	0	111.9	V19	D10-V19 PolarHBondContact N-O 2.86Å; D10-V19 PolarHBondContact O-N 3.29Å
11	W	90.2	Very high	90.7	Very high	165 Å²	165	83.5 Å²	83.5	63%	0.625	46%	0.464	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.8	140.8	172.6	-83.5	81	0	0	0	110.6	L18	W11-L18 HydrophobicContact CD2-CD1 4.09Å; W11-L18 HydrophobicContact CG-CD1 4.12Å; W11-L18 HydrophobicContact CZ2-CD1 4.17Å; W11-L18 VanDerWaalsContact NE1-CD1 3.33Å
12	S	90.3	Very high	91.4	Very high	28 Å²	28	79.1 Å²	79.1	20%	0.196	42%	0.418	C	S	.	.			trans	-65.6	147.6	168.3	69.4	0	0	0	0	110.5	N14 S15 Q16 F17	S12-N14 WeakPolarHBondContact CB-OD1 3.36Å; S12-N14 PolarHBondContact O-N 2.89Å; S12-N14 VanDerWaalsContact O-N 3.09Å; S12-N14 PolarHBondContact OG-OD1 3.49Å; S12-S15 PolarHBondContact O-N 3.22Å; S12-S15 PolarHBondContact OG-N 3.33Å; S12-Q16 PolarHBondContact OG-N 2.97Å; S12-F17 PolarHBondContact N-O 3.43Å; S12-F17 PolarHBondContact OG-N 3.02Å; S12-F17 PolarHBondContact OG-O 3.14Å
13	V	91.3	Very high	91.7	Very high	157 Å²	157	78.6 Å²	78.6	95%	0.952	42%	0.423	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.5	-30.8	-178.9	178.7	0	0	0	0	112.5
14	N	89.9	Confident	91.9	Very high	101 Å²	101	76.3 Å²	76.3	54%	0.54	40%	0.403	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.4	7.1	178.1	64.6	0.4	0	0	0	114.1	S12 Q16	S12-N14 WeakPolarHBondContact CB-OD1 3.36Å; S12-N14 PolarHBondContact O-N 2.89Å; S12-N14 VanDerWaalsContact O-N 3.09Å; S12-N14 PolarHBondContact OG-OD1 3.49Å; N14-Q16 HydrophobicContact CB-CG 4.33Å; N14-Q16 PolarHBondContact O-N 2.97Å; N14-Q16 VanDerWaalsContact O-N 3.14Å; N14-Q16 WeakPolarHBondContact OD1-CB 3.42Å; N14-Q16 PolarHBondContact OD1-N 2.95Å
15	S	89.1	Confident	91.7	Very high	81 Å²	81	84.2 Å²	84.2	57%	0.566	43%	0.428	S	S	*	.	S	Bend	trans	60.1	18.3	179.6	-54.4	0	0	0	0	116.3	S12	S12-S15 PolarHBondContact O-N 3.22Å; S12-S15 PolarHBondContact OG-N 3.33Å
16	Q	87.8	Confident	91.5	Very high	115 Å²	115	79.5 Å²	79.5	54%	0.537	41%	0.408	S	S	.	.	S	Bend	trans	-86.8	-24.3	-178.9	-65.9	-68.7	81.9	0	0	113.5	S12 N14	S12-Q16 PolarHBondContact OG-N 2.97Å; N14-Q16 HydrophobicContact CB-CG 4.33Å; N14-Q16 PolarHBondContact O-N 2.97Å; N14-Q16 VanDerWaalsContact O-N 3.14Å; N14-Q16 WeakPolarHBondContact OD1-CB 3.42Å; N14-Q16 PolarHBondContact OD1-N 2.95Å
17	F	86.9	Confident	91.4	Very high	90 Å²	90	77.3 Å²	77.3	40%	0.395	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	142.6	-173.9	-53.7	-84	0	0	0	111.9	S12 C30	S12-F17 PolarHBondContact N-O 3.43Å; S12-F17 PolarHBondContact OG-N 3.02Å; S12-F17 PolarHBondContact OG-O 3.14Å; F17-C30 WeakPolarHBondContact CA-O 3.4Å
18	L	90.8	Very high	91.1	Very high	36 Å²	36	75 Å²	75	19%	0.188	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.7	130.9	165.2	-173.6	74.2	0	0	0	108.5	L9 W11 Y29 C30 W37	L9-L18 HydrophobicContact CD1-CD1 4.34Å; L9-L18 HydrophobicContact CD2-CD1 3.64Å; L9-L18 HydrophobicContact CG-CD1 3.93Å; W11-L18 HydrophobicContact CD2-CD1 4.09Å; W11-L18 HydrophobicContact CG-CD1 4.12Å; W11-L18 HydrophobicContact CZ2-CD1 4.17Å; W11-L18 VanDerWaalsContact NE1-CD1 3.33Å; L18-Y29 CarbonylContact O-C 3.57Å; L18-Y29 WeakPolarHBondContact O-CA 3.47Å; L18-C30 HydrophobicContact CB-CB 4.32Å; L18-C30 PolarHBondContact N-O 3.09Å; L18-C30 PolarHBondContact O-N 3.19Å; L18-W37 HydrophobicContact CD2-CH2 3.89Å
19	V	92.6	Very high	90.8	Very high	35 Å²	35	73 Å²	73	21%	0.212	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	139	176.9	-171.2	0	0	0	0	108.9	L9 D10 I27 L28 Y29	L9-V19 WeakPolarHBondContact CA-O 3.39Å; D10-V19 PolarHBondContact N-O 2.86Å; D10-V19 PolarHBondContact O-N 3.29Å; V19-I27 HydrophobicContact CG1-CG2 3.89Å; V19-L28 WeakPolarHBondContact CA-O 3.42Å; V19-Y29 HydrophobicContact CB-CD1 4.49Å; V19-Y29 HydrophobicContact CB-CE1 4.44Å; V19-Y29 HydrophobicContact CG1-CD1 4.38Å; V19-Y29 HydrophobicContact CG1-CE1 4.05Å; V19-Y29 HydrophobicContact CG2-CD1 3.53Å; V19-Y29 HydrophobicContact CG2-CE1 3.51Å; V19-Y29 HydrophobicContact CG2-CG 4.5Å
20	S	93.4	Very high	90.4	Very high	5 Å²	5	69.4 Å²	69.4	4%	0.035	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138	136.1	174.3	52	0	0	0	0	111.1	H2 H8 L28	H2-S20 PolarHBondContact CE1-O 2.82Å; H2-S20 WeakPolarHBondContact NE2-CB 3.41Å; H2-S20 PolarHBondContact NE2-O 3.1Å; H2-S20 PolarHBondContact NE2-OG 3.31Å; H8-S20 WeakPolarHBondContact O-CA 3.33Å; S20-L28 PolarHBondContact N-O 3.39Å; S20-L28 PolarHBondContact O-N 3.31Å
21	N	94.4	Very high	89.9	Confident	43 Å²	43	66.4 Å²	66.4	23%	0.23	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	143.8	173.8	-174.9	31.5	0	0	0	109.6	I6 T7 H8 E26	I6-N21 CarbonylContact C-O 3.59Å; I6-N21 WeakPolarHBondContact CA-O 3.35Å; T7-N21 PolarHBondContact N-O 2.63Å; T7-N21 PolarHBondContact OG1-ND2 3.14Å; T7-N21 PolarHBondContact OG1-O 3.3Å; T7-N21 VanDerWaalsContact OG1-O 3.14Å; H8-N21 HydrophobicContact CB-CB 4.21Å; H8-N21 PolarHBondContact N-O 3.09Å; H8-N21 PolarHBondContact O-N 3.17Å; N21-E26 WeakPolarHBondContact CA-O 3.21Å; N21-E26 PolarHBondContact OD1-O 2.99Å
22	S	93.9	Very high	89.2	Confident	2 Å²	2	66 Å²	66	1%	0.014	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	165.8	180	50.1	0	0	0	0	113	H2 F5 D24 Y25 E26	H2-S22 WeakPolarHBondContact ND1-CB 3.18Å; H2-S22 PolarHBondContact ND1-OG 2.98Å; H2-S22 VanDerWaalsContact ND1-OG 3.09Å; F5-S22 CarbonylContact O-C 3.47Å; F5-S22 WeakPolarHBondContact O-CA 3.33Å; S22-D24 WeakPolarHBondContact CB-OD1 3.39Å; S22-D24 PolarHBondContact O-N 3.41Å; S22-D24 PolarHBondContact OG-OD1 2.95Å; S22-Y25 PolarHBondContact O-N 2.99Å; S22-E26 PolarHBondContact N-O 3.45Å; S22-E26 VanDerWaalsContact N-O 3.13Å; S22-E26 WeakPolarHBondContact OG-CB 3.45Å; S22-E26 PolarHBondContact OG-N 3.44Å; S22-E26 PolarHBondContact OG-O 3Å; S22-E26 VanDerWaalsContact OG-O 3.1Å
23	G	91.9	Very high	87.6	Confident	29 Å²	29	70.3 Å²	70.3	30%	0.299	37%	0.371	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.9	-10	-177.3	0	0	0	0	0	115.1	F5	F5-G23 PolarHBondContact O-N 3.41Å
24	D	91.8	Very high	86.1	Confident	53 Å²	53	70 Å²	70	28%	0.283	36%	0.358	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.6	10.7	171.1	59	-6.7	0	0	0	112.7	S3 S22 E26	S3-D24 PolarHBondContact OG-OD2 2.84Å; S22-D24 WeakPolarHBondContact CB-OD1 3.39Å; S22-D24 PolarHBondContact O-N 3.41Å; S22-D24 PolarHBondContact OG-OD1 2.95Å; D24-E26 VanDerWaalsContact C-N 3.29Å; D24-E26 PolarHBondContact O-N 2.91Å; D24-E26 PolarHBondContact OD1-N 2.83Å
25	Y	88.2	Confident	84.9	Confident	209 Å²	209	70.6 Å²	70.6	82%	0.82	36%	0.361	S	S	*	.			trans	65.2	24.2	-179.8	-54.4	-89.8	0	0	0	114.4	S22	S22-Y25 PolarHBondContact O-N 2.99Å
26	E	88.9	Confident	83.9	Confident	47 Å²	47	72.8 Å²	72.8	22%	0.22	36%	0.362	C	S	.	.			trans	-82.2	134.6	168.5	-62.5	-165.5	148.7	0	0	111.3	H2 N21 S22 D24	H2-E26 PolarHBondContact CE1-O 3.47Å; N21-E26 WeakPolarHBondContact CA-O 3.21Å; N21-E26 PolarHBondContact OD1-O 2.99Å; S22-E26 PolarHBondContact N-O 3.45Å; S22-E26 VanDerWaalsContact N-O 3.13Å; S22-E26 WeakPolarHBondContact OG-CB 3.45Å; S22-E26 PolarHBondContact OG-N 3.44Å; S22-E26 PolarHBondContact OG-O 3Å; S22-E26 VanDerWaalsContact OG-O 3.1Å; D24-E26 VanDerWaalsContact C-N 3.29Å; D24-E26 PolarHBondContact O-N 2.91Å; D24-E26 PolarHBondContact OD1-N 2.83Å
27	I	90.1	Very high	83	Confident	52 Å²	52	72.3 Å²	72.3	27%	0.267	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	122.8	174.2	-61.2	170.7	0	0	0	108.5	V19 Y29 Q40	V19-I27 HydrophobicContact CG1-CG2 3.89Å; I27-Y29 HydrophobicContact CG2-CD2 4.42Å; I27-Y29 HydrophobicContact CG2-CE2 3.72Å; I27-Q40 HydrophobicContact CB-CB 4.37Å; I27-Q40 PolarHBondContact O-N 2.83Å; I27-Q40 VanDerWaalsContact O-N 3.17Å
28	L	89.1	Confident	82.5	Confident	8 Å²	8	71.6 Å²	71.6	4%	0.042	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	137.4	178.9	-65	-178.3	0	0	0	111.7	H2 V19 S20 W37 T38 Q39	H2-L28 VanDerWaalsContact CE1-CG 3.47Å; H2-L28 WeakPolarHBondContact CE1-CG 3.47Å; V19-L28 WeakPolarHBondContact CA-O 3.42Å; S20-L28 PolarHBondContact N-O 3.39Å; S20-L28 PolarHBondContact O-N 3.31Å; L28-W37 HydrophobicContact CB-CE3 3.72Å; L28-W37 HydrophobicContact CB-CZ3 4.3Å; L28-W37 HydrophobicContact CD1-CB 4.41Å; L28-T38 WeakPolarHBondContact CA-O 3.45Å; L28-Q39 HydrophobicContact CD2-CB 4.18Å; L28-Q39 HydrophobicContact CD2-CG 3.28Å
29	Y	88.8	Confident	81.8	Confident	77 Å²	77	75 Å²	75	30%	0.302	37%	0.374	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	132.9	173.7	-62.7	-98.3	0	0	0	109.9	L18 V19 I27 W37 T38 Q40	L18-Y29 CarbonylContact O-C 3.57Å; L18-Y29 WeakPolarHBondContact O-CA 3.47Å; V19-Y29 HydrophobicContact CB-CD1 4.49Å; V19-Y29 HydrophobicContact CB-CE1 4.44Å; V19-Y29 HydrophobicContact CG1-CD1 4.38Å; V19-Y29 HydrophobicContact CG1-CE1 4.05Å; V19-Y29 HydrophobicContact CG2-CD1 3.53Å; V19-Y29 HydrophobicContact CG2-CE1 3.51Å; V19-Y29 HydrophobicContact CG2-CG 4.5Å; I27-Y29 HydrophobicContact CG2-CD2 4.42Å; I27-Y29 HydrophobicContact CG2-CE2 3.72Å; Y29-W37 CarbonylContact O-C 3.56Å; Y29-W37 VanDerWaalsContact O-CA 3.29Å; Y29-W37 WeakPolarHBondContact O-CA 3.29Å; Y29-T38 PolarHBondContact N-O 2.48Å; Y29-T38 PolarHBondContact O-N 3.46Å; Y29-Q40 HydrophobicContact CE2-CB 4.15Å; Y29-Q40 HydrophobicContact CE2-CG 4.39Å
30	C	85.5	Confident	80.6	Confident	19 Å²	19	77.5 Å²	77.5	13%	0.128	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	127.2	168.7	177.7	0	0	0	0	109.3	F17 L18 W37	F17-C30 WeakPolarHBondContact CA-O 3.4Å; L18-C30 HydrophobicContact CB-CB 4.32Å; L18-C30 PolarHBondContact N-O 3.09Å; L18-C30 PolarHBondContact O-N 3.19Å; C30-W37 HydrophobicContact CB-CD2 3.82Å; C30-W37 HydrophobicContact CB-CE3 3.43Å; C30-W37 VanDerWaalsContact CB-CE3 3.43Å; C30-W37 HydrophobicContact CB-CH2 3.52Å; C30-W37 HydrophobicContact CB-CZ2 3.84Å; C30-W37 HydrophobicContact CB-CZ3 3.28Å
31	S	82.9	Confident	78.9	Confident	43 Å²	43	81.3 Å²	81.3	30%	0.301	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	146.7	169.5	66.8	0	0	0	0	110.7	L35	S31-L35 PolarHBondContact O-N 3.1Å
32	K	74.7	Confident	77.1	Confident	155 Å²	155	88.2 Å²	88.2	67%	0.674	43%	0.431	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.1	141.8	162.4	-68.7	-97.7	-176.2	167.3	0	107.5	L35	K32-L35 HydrophobicContact CD-CD2 4.24Å
33	P	58.6	Low	75	Confident	120 Å²	120	97 Å²	97	78%	0.779	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	cis	-101.8	-5.1	24.9	36.4	-33.7	0	0	0	115.8
34	H	59.3	Low	73	Confident	150 Å²	150	102.2 Å²	102.2	69%	0.694	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.9	0.9	-165.4	-122.5	74.6	0	0	0	116.2	Q36	H34-Q36 PolarHBondContact O-N 3.13Å
35	L	63.9	Low	71	Confident	113 Å²	113	111.1 Å²	111.1	59%	0.592	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	48	31	178.4	-66.2	172.9	0	0	0	113.3	S31 K32	S31-L35 PolarHBondContact O-N 3.1Å; K32-L35 HydrophobicContact CD-CD2 4.24Å
36	Q	68.3	Low	68.8	Low	127 Å²	127	104.1 Å²	104.1	59%	0.593	51%	0.509	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.4	125.4	-178.6	-170.4	172.3	18.6	0	0	109	H34	H34-Q36 PolarHBondContact O-N 3.13Å
37	W	68	Low	66.4	Low	105 Å²	105	108.8 Å²	108.8	40%	0.398	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	124.4	173	-65.6	97.3	0	0	0	109.8	L18 L28 Y29 C30	L18-W37 HydrophobicContact CD2-CH2 3.89Å; L28-W37 HydrophobicContact CB-CE3 3.72Å; L28-W37 HydrophobicContact CB-CZ3 4.3Å; L28-W37 HydrophobicContact CD1-CB 4.41Å; Y29-W37 CarbonylContact O-C 3.56Å; Y29-W37 VanDerWaalsContact O-CA 3.29Å; Y29-W37 WeakPolarHBondContact O-CA 3.29Å; C30-W37 HydrophobicContact CB-CD2 3.82Å; C30-W37 HydrophobicContact CB-CE3 3.43Å; C30-W37 VanDerWaalsContact CB-CE3 3.43Å; C30-W37 HydrophobicContact CB-CH2 3.52Å; C30-W37 HydrophobicContact CB-CZ2 3.84Å; C30-W37 HydrophobicContact CB-CZ3 3.28Å
38	T	78.3	Confident	64.2	Low	76 Å²	76	112 Å²	112	47%	0.466	56%	0.558	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-107.4	131.2	172.4	53.8	0	0	0	0	110.2	L28 Y29	L28-T38 WeakPolarHBondContact CA-O 3.45Å; Y29-T38 PolarHBondContact N-O 2.48Å; Y29-T38 PolarHBondContact O-N 3.46Å
39	Q	74.7	Confident	62.2	Low	108 Å²	108	123.4 Å²	123.4	51%	0.505	62%	0.618	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-75.9	144.3	171.7	-75.1	-179.6	35.6	0	0	109.9	L28	L28-Q39 HydrophobicContact CD2-CB 4.18Å; L28-Q39 HydrophobicContact CD2-CG 3.28Å
40	Q	67.1	Low	60.9	Low	86 Å²	86	125.8 Å²	125.8	40%	0.402	63%	0.634	S	S	.	*	P	Polyproline II helix	trans	-57.9	131.6	169.7	-161.2	-178.7	13.3	0	0	109.9	I27 Y29 R42	I27-Q40 HydrophobicContact CB-CB 4.37Å; I27-Q40 PolarHBondContact O-N 2.83Å; I27-Q40 VanDerWaalsContact O-N 3.17Å; Y29-Q40 HydrophobicContact CE2-CB 4.15Å; Y29-Q40 HydrophobicContact CE2-CG 4.39Å; Q40-R42 PolarHBondContact O-N 2.79Å; Q40-R42 VanDerWaalsContact O-N 3.1Å
41	P	59.1	Low	59.6	Low	85 Å²	85	131.4 Å²	131.4	55%	0.552	66%	0.661	S	S	*	*	P	Polyproline II helix	trans	-62.2	117	175.8	-20	31.1	0	0	0	110	H43 Q44	P41-H43 PolarHBondContact O-N 2.9Å; P41-Q44 PolarHBondContact O-N 2.94Å
42	R	55	Low	58.3	Low	189 Å²	189	136.3 Å²	136.3	71%	0.713	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	-7	-178.4	-65.1	-173.8	-171.3	173	1.2	114.8	Q40	Q40-R42 PolarHBondContact O-N 2.79Å; Q40-R42 VanDerWaalsContact O-N 3.1Å
43	H	51	Low	57.3	Low	185 Å²	185	135.2 Å²	135.2	86%	0.856	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.4	-4.1	-174.7	-75.5	-79.2	0	0	0	115.9	P41 R45	P41-H43 PolarHBondContact O-N 2.9Å; H43-R45 VanDerWaalsContact C-N 3.27Å; H43-R45 PolarHBondContact O-N 3.43Å
44	Q	50	Low	57.2	Low	139 Å²	139	136.1 Å²	136.1	65%	0.65	68%	0.675	S	S	*	*			trans	-90.2	42.3	175.8	-69.7	-167.8	-13.8	0	0	113.5	P41 G46	P41-Q44 PolarHBondContact O-N 2.94Å; Q44-G46 PolarHBondContact O-N 2.62Å
45	R	49.8	Very low	57.1	Low	241 Å²	241	135.2 Å²	135.2	91%	0.909	67%	0.674	S	S	*	*			trans	-84.4	23.9	175.1	-106.4	-165.4	-65.4	173.7	-0.9	113.9	H43	H43-R45 VanDerWaalsContact C-N 3.27Å; H43-R45 PolarHBondContact O-N 3.43Å
46	G	42.6	Very low	56.6	Low	62 Å²	62	136.8 Å²	136.8	64%	0.639	68%	0.68	S	S	*	*	S	Bend	trans	-151.7	16.5	-166.7	0	0	0	0	0	118.4	Q44	Q44-G46 PolarHBondContact O-N 2.62Å
47	L	38.3	Very low	55.7	Low	145 Å²	145	137.5 Å²	137.5	76%	0.759	69%	0.686	S	S	*	*			trans	-114.8	120.3	171	-68.1	173.2	0	0	0	109.6
48	P	42.8	Very low	54.7	Low	119 Å²	119	140.3 Å²	140.3	77%	0.773	71%	0.71	S	S	*	*			trans	-76.9	125.7	168.5	31	-27.6	0	0	0	109
49	L	47.4	Very low	52.5	Low	248 Å²	248	146.1 Å²	146.1	100%	1.298	73%	0.732	S	S	*	*			trans	45.3	0	171.2	-60	176.9	0	0	0	117.3

Retrieved 49 of 49 residues in 44.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).