A0A024CHX5_HUMAN Loading...

Butyrylcholinesterase p.Ala34Val splice variant

AlphaFold DB , UniProt , Accession A0A024CHX5, Species HUMAN (Homo sapiens, Human), Gene n/a, Length 113 aa.

						>A0A024CHX5_HUMAN|A0A024CHX5
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYVQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIEDCLYLNVWIPAPKPK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.7	Low	72.7	Confident	212 Å²	212	122.6 Å²	122.6	100%	1.044	62%	0.622	S	S	*	*				0	-36.1	0	-133.3	150.8	76.2	0	0	113.1	S3	M1-S3 PolarHBondContact O-N 3.11Å
2	H	56.9	Low	73.8	Confident	169 Å²	169	124.2 Å²	124.2	78%	0.782	62%	0.622	S	S	*	*	H	α-helix	trans	-58.1	-43.6	178.4	-77.1	-75.9	0	0	0	115.8	K4 V5 T6	H2-K4 PolarHBondContact O-N 3.12Å; H2-V5 PolarHBondContact O-N 3.42Å; H2-T6 PolarHBondContact O-N 2.86Å; H2-T6 VanDerWaalsContact O-N 3.12Å; H2-T6 PolarHBondContact O-OG1 2.67Å
3	S	63.7	Low	74.8	Confident	84 Å²	84	123.6 Å²	123.6	59%	0.587	62%	0.621	S	S	*	*	H	α-helix	trans	-65	-35.1	-175	177.6	0	0	0	0	114.3	M1 T6 I7	M1-S3 PolarHBondContact O-N 3.11Å; S3-T6 PolarHBondContact O-N 2.86Å; S3-I7 WeakPolarHBondContact O-CD1 3.09Å; S3-I7 VanDerWaalsContact O-CG1 3.28Å; S3-I7 WeakPolarHBondContact O-CG1 3.43Å; S3-I7 PolarHBondContact O-N 3.32Å
4	K	69.3	Low	75.6	Confident	166 Å²	166	124.7 Å²	124.7	72%	0.722	62%	0.62	S	S	*	*	H	α-helix	trans	-68.7	-37.5	177.7	-68.2	-171.8	177.4	-177	0	112	H2 I7 I8	H2-K4 PolarHBondContact O-N 3.12Å; K4-I7 PolarHBondContact O-N 3.18Å; K4-I8 WeakPolarHBondContact O-CD1 3.25Å; K4-I8 WeakPolarHBondContact O-CG1 3.22Å; K4-I8 PolarHBondContact O-N 2.9Å
5	V	73.3	Confident	76.3	Confident	88 Å²	88	128.9 Å²	128.9	53%	0.533	63%	0.626	S	S	.	*	H	α-helix	trans	-66.4	-43.4	176.1	179.8	0	0	0	0	110.1	H2 I7 I8 C9	H2-V5 PolarHBondContact O-N 3.42Å; V5-I7 PolarHBondContact O-N 3.47Å; V5-I8 PolarHBondContact O-N 2.83Å; V5-C9 WeakPolarHBondContact O-CB 3.33Å; V5-C9 PolarHBondContact O-N 2.99Å; V5-C9 PolarHBondContact O-SG 2.05Å
6	T	74.4	Confident	76.9	Confident	77 Å²	77	129.4 Å²	129.4	47%	0.472	63%	0.625	S	S	.	*	H	α-helix	trans	-61.4	-42.9	176.5	-48.3	0	0	0	0	112.4	H2 S3 C9 I10	H2-T6 PolarHBondContact O-N 2.86Å; H2-T6 VanDerWaalsContact O-N 3.12Å; H2-T6 PolarHBondContact O-OG1 2.67Å; S3-T6 PolarHBondContact O-N 2.86Å; T6-C9 PolarHBondContact O-N 3.11Å; T6-I10 HydrophobicContact CG2-CD1 3.98Å; T6-I10 VanDerWaalsContact O-CG1 3.25Å; T6-I10 WeakPolarHBondContact O-CG1 3.42Å; T6-I10 PolarHBondContact O-N 3.4Å
7	I	78.1	Confident	77.3	Confident	92 Å²	92	127.6 Å²	127.6	47%	0.472	62%	0.619	S	S	.	*	H	α-helix	trans	-65.7	-40.8	177.9	-67.2	164.5	0	0	0	111.4	S3 K4 V5 I10 R11	S3-I7 WeakPolarHBondContact O-CD1 3.09Å; S3-I7 VanDerWaalsContact O-CG1 3.28Å; S3-I7 WeakPolarHBondContact O-CG1 3.43Å; S3-I7 PolarHBondContact O-N 3.32Å; K4-I7 PolarHBondContact O-N 3.18Å; V5-I7 PolarHBondContact O-N 3.47Å; I7-I10 PolarHBondContact O-N 2.86Å; I7-R11 WeakPolarHBondContact O-CG 3.26Å; I7-R11 PolarHBondContact O-N 2.97Å
8	I	80.4	Confident	77.6	Confident	94 Å²	94	125.5 Å²	125.5	48%	0.482	61%	0.61	S	S	.	*	H	α-helix	trans	-63.2	-45.3	176.3	-68.9	163.4	0	0	0	110.1	K4 V5 I10 R11 F12	K4-I8 WeakPolarHBondContact O-CD1 3.25Å; K4-I8 WeakPolarHBondContact O-CG1 3.22Å; K4-I8 PolarHBondContact O-N 2.9Å; V5-I8 PolarHBondContact O-N 2.83Å; I8-I10 PolarHBondContact O-N 3.25Å; I8-R11 PolarHBondContact O-N 3.07Å; I8-F12 HydrophobicContact CG2-CD2 3.75Å; I8-F12 HydrophobicContact CG2-CE2 3.93Å; I8-F12 WeakPolarHBondContact O-CD2 3.35Å; I8-F12 PolarHBondContact O-N 3.2Å
9	C	79.8	Confident	77.9	Confident	72 Å²	72	123.9 Å²	123.9	49%	0.486	60%	0.604	S	S	.	*	H	α-helix	trans	-60.7	-43.8	176.1	-71.2	0	0	0	0	112.3	V5 T6 R11 F12 L13	V5-C9 WeakPolarHBondContact O-CB 3.33Å; V5-C9 PolarHBondContact O-N 2.99Å; V5-C9 PolarHBondContact O-SG 2.05Å; T6-C9 PolarHBondContact O-N 3.11Å; C9-R11 VanDerWaalsContact C-N 3.35Å; C9-R11 PolarHBondContact O-N 2.69Å; C9-F12 PolarHBondContact O-N 3.18Å; C9-L13 WeakPolarHBondContact O-CB 3.43Å; C9-L13 PolarHBondContact O-N 2.89Å
10	I	84.4	Confident	78	Confident	110 Å²	110	120.8 Å²	120.8	56%	0.564	60%	0.595	S	S	*	*	H	α-helix	trans	-63.1	-41.4	178	-69.5	165.6	0	0	0	111	T6 I7 I8 L13 F14	T6-I10 HydrophobicContact CG2-CD1 3.98Å; T6-I10 VanDerWaalsContact O-CG1 3.25Å; T6-I10 WeakPolarHBondContact O-CG1 3.42Å; T6-I10 PolarHBondContact O-N 3.4Å; I7-I10 PolarHBondContact O-N 2.86Å; I8-I10 PolarHBondContact O-N 3.25Å; I10-L13 PolarHBondContact O-N 3.25Å; I10-F14 WeakPolarHBondContact O-CB 3.43Å; I10-F14 PolarHBondContact O-N 2.95Å
11	R	86.8	Confident	78	Confident	185 Å²	185	122.9 Å²	122.9	70%	0.698	61%	0.605	S	S	*	*	H	α-helix	trans	-66.7	-41.2	177.2	-70.8	-179.9	75.3	121.3	3.1	112.2	I7 I8 C9 F14 W15	I7-R11 WeakPolarHBondContact O-CG 3.26Å; I7-R11 PolarHBondContact O-N 2.97Å; I8-R11 PolarHBondContact O-N 3.07Å; C9-R11 VanDerWaalsContact C-N 3.35Å; C9-R11 PolarHBondContact O-N 2.69Å; R11-F14 PolarHBondContact O-N 3.12Å; R11-W15 WeakPolarHBondContact O-CB 3.43Å; R11-W15 PolarHBondContact O-N 2.84Å
12	F	86.3	Confident	78.9	Confident	141 Å²	141	119.4 Å²	119.4	62%	0.618	59%	0.59	S	S	*	*	H	α-helix	trans	-63.9	-42.6	174.1	-95.9	-77.3	0	0	0	111.9	I8 C9 W15 F16	I8-F12 HydrophobicContact CG2-CD2 3.75Å; I8-F12 HydrophobicContact CG2-CE2 3.93Å; I8-F12 WeakPolarHBondContact O-CD2 3.35Å; I8-F12 PolarHBondContact O-N 3.2Å; C9-F12 PolarHBondContact O-N 3.18Å; F12-W15 PolarHBondContact O-N 2.83Å; F12-F16 VanDerWaalsContact O-CB 3.27Å; F12-F16 WeakPolarHBondContact O-CB 3.18Å; F12-F16 PolarHBondContact O-N 2.82Å
13	L	86.9	Confident	79.7	Confident	117 Å²	117	117.1 Å²	117.1	61%	0.613	58%	0.582	S	S	*	*	H	α-helix	trans	-64.6	-42.5	178.4	-149.4	107.8	0	0	0	111.2	C9 I10 F16 L17	C9-L13 WeakPolarHBondContact O-CB 3.43Å; C9-L13 PolarHBondContact O-N 2.89Å; I10-L13 PolarHBondContact O-N 3.25Å; L13-F16 PolarHBondContact O-N 3.17Å; L13-L17 HydrophobicContact CD2-CD1 4.1Å; L13-L17 WeakPolarHBondContact O-CB 3.38Å; L13-L17 WeakPolarHBondContact O-CD1 3.04Å; L13-L17 VanDerWaalsContact O-CG 3.28Å; L13-L17 WeakPolarHBondContact O-CG 3.06Å; L13-L17 PolarHBondContact O-N 2.91Å
14	F	86.3	Confident	79.8	Confident	139 Å²	139	116.1 Å²	116.1	61%	0.61	59%	0.585	S	S	*	*	H	α-helix	trans	-64.8	-41.4	176	-169.9	-98.3	0	0	0	111.8	I10 R11 L17 L18	I10-F14 WeakPolarHBondContact O-CB 3.43Å; I10-F14 PolarHBondContact O-N 2.95Å; R11-F14 PolarHBondContact O-N 3.12Å; F14-L17 PolarHBondContact O-N 3.23Å; F14-L18 HydrophobicContact CE1-CD1 3.97Å; F14-L18 HydrophobicContact CZ-CD1 4.27Å; F14-L18 WeakPolarHBondContact O-CB 3.31Å; F14-L18 PolarHBondContact O-N 3.44Å
15	W	85.8	Confident	79.3	Confident	187 Å²	187	117.8 Å²	117.8	71%	0.708	59%	0.593	S	S	*	*	H	α-helix	trans	-70.7	-35.6	179	-146.3	0.4	0	0	0	112.2	R11 F12 L18 L19	R11-W15 WeakPolarHBondContact O-CB 3.43Å; R11-W15 PolarHBondContact O-N 2.84Å; F12-W15 PolarHBondContact O-N 2.83Å; W15-L18 PolarHBondContact O-N 2.78Å; W15-L19 VanDerWaalsContact O-CB 3.27Å; W15-L19 WeakPolarHBondContact O-CB 3.28Å; W15-L19 PolarHBondContact O-N 2.99Å
16	F	85.2	Confident	78.6	Confident	137 Å²	137	118.1 Å²	118.1	60%	0.601	60%	0.599	S	S	*	*	H	α-helix	trans	-64.1	-44	171.5	-178	-100.4	0	0	0	111.6	F12 L13 L19 C20	F12-F16 VanDerWaalsContact O-CB 3.27Å; F12-F16 WeakPolarHBondContact O-CB 3.18Å; F12-F16 PolarHBondContact O-N 2.82Å; L13-F16 PolarHBondContact O-N 3.17Å; F16-L19 PolarHBondContact O-N 3.21Å; F16-C20 PolarHBondContact O-N 2.93Å; F16-C20 PolarHBondContact O-SG 2.91Å
17	L	83.7	Confident	77.5	Confident	100 Å²	100	122.2 Å²	122.2	52%	0.524	61%	0.612	S	S	.	*	H	α-helix	trans	-63.3	-41.6	173.9	-75.4	164.6	0	0	0	112	L13 F14 L19 C20 M21	L13-L17 HydrophobicContact CD2-CD1 4.1Å; L13-L17 WeakPolarHBondContact O-CB 3.38Å; L13-L17 WeakPolarHBondContact O-CD1 3.04Å; L13-L17 VanDerWaalsContact O-CG 3.28Å; L13-L17 WeakPolarHBondContact O-CG 3.06Å; L13-L17 PolarHBondContact O-N 2.91Å; F14-L17 PolarHBondContact O-N 3.23Å; L17-L19 VanDerWaalsContact C-N 3.33Å; L17-L19 PolarHBondContact O-N 2.71Å; L17-C20 PolarHBondContact O-N 2.88Å; L17-M21 WeakPolarHBondContact O-CG 3.33Å; L17-M21 PolarHBondContact O-N 3.45Å
18	L	83.3	Confident	76.2	Confident	89 Å²	89	123.3 Å²	123.3	47%	0.466	62%	0.623	S	S	.	*	H	α-helix	trans	-64.5	-38.1	176	-152.5	101.3	0	0	0	111.6	F14 W15 M21 L22	F14-L18 HydrophobicContact CE1-CD1 3.97Å; F14-L18 HydrophobicContact CZ-CD1 4.27Å; F14-L18 WeakPolarHBondContact O-CB 3.31Å; F14-L18 PolarHBondContact O-N 3.44Å; W15-L18 PolarHBondContact O-N 2.78Å; L18-M21 PolarHBondContact O-N 3.49Å; L18-L22 PolarHBondContact O-N 2.83Å
19	L	84.1	Confident	75.3	Confident	95 Å²	95	124.5 Å²	124.5	50%	0.497	63%	0.627	S	S	.	*	H	α-helix	trans	-66.5	-41	175.4	-173.8	67.8	0	0	0	111.6	W15 F16 L17 M21 L22 I23	W15-L19 VanDerWaalsContact O-CB 3.27Å; W15-L19 WeakPolarHBondContact O-CB 3.28Å; W15-L19 PolarHBondContact O-N 2.99Å; F16-L19 PolarHBondContact O-N 3.21Å; L17-L19 VanDerWaalsContact C-N 3.33Å; L17-L19 PolarHBondContact O-N 2.71Å; L19-M21 VanDerWaalsContact C-N 3.29Å; L19-M21 PolarHBondContact O-N 2.79Å; L19-L22 WeakPolarHBondContact O-CB 3.47Å; L19-L22 PolarHBondContact O-N 2.8Å; L19-L22 VanDerWaalsContact O-N 3.13Å; L19-I23 PolarHBondContact O-N 2.94Å
20	C	79.9	Confident	74.9	Confident	61 Å²	61	128 Å²	128	41%	0.412	64%	0.641	S	S	.	*	H	α-helix	trans	-61.8	-34.8	175.4	-73.2	0	0	0	0	112.8	F16 L17 L22 I23	F16-C20 PolarHBondContact O-N 2.93Å; F16-C20 PolarHBondContact O-SG 2.91Å; L17-C20 PolarHBondContact O-N 2.88Å; C20-L22 VanDerWaalsContact C-N 3.28Å; C20-L22 PolarHBondContact O-N 2.86Å; C20-I23 PolarHBondContact O-N 2.88Å
21	M	76.5	Confident	74.9	Confident	166 Å²	166	126.7 Å²	126.7	82%	0.818	64%	0.635	S	S	*	*	H	α-helix	trans	-68.2	-26.1	175.8	-67.2	-74.1	-79.4	0	0	112.9	L17 L18 L19	L17-M21 WeakPolarHBondContact O-CG 3.33Å; L17-M21 PolarHBondContact O-N 3.45Å; L18-M21 PolarHBondContact O-N 3.49Å; L19-M21 VanDerWaalsContact C-N 3.29Å; L19-M21 PolarHBondContact O-N 2.79Å
22	L	71.1	Confident	75.2	Confident	139 Å²	139	119.6 Å²	119.6	73%	0.728	61%	0.61	S	S	*	*	H	α-helix	trans	-78.5	-22.7	174.8	-64.6	172.5	0	0	0	112.4	L18 L19 C20 G24	L18-L22 PolarHBondContact O-N 2.83Å; L19-L22 WeakPolarHBondContact O-CB 3.47Å; L19-L22 PolarHBondContact O-N 2.8Å; L19-L22 VanDerWaalsContact O-N 3.13Å; C20-L22 VanDerWaalsContact C-N 3.28Å; C20-L22 PolarHBondContact O-N 2.86Å; L22-G24 PolarHBondContact O-N 2.81Å
23	I	74.5	Confident	75.7	Confident	120 Å²	120	116.2 Å²	116.2	62%	0.615	60%	0.598	S	S	*	*			trans	-91.2	60	174.1	-47.9	169.5	0	0	0	108.5	L19 C20 K25	L19-I23 PolarHBondContact O-N 2.94Å; C20-I23 PolarHBondContact O-N 2.88Å; I23-K25 PolarHBondContact O-N 3.35Å
24	G	66.6	Low	76.2	Confident	63 Å²	63	114.1 Å²	114.1	65%	0.649	59%	0.587	S	S	*	*			trans	-65	113.4	165.7	0	0	0	0	0	108.9	L22 S26	L22-G24 PolarHBondContact O-N 2.81Å; G24-S26 PolarHBondContact O-N 2.76Å
25	K	57.2	Low	76.7	Confident	202 Å²	202	111.3 Å²	111.3	88%	0.878	59%	0.589	S	S	*	*			trans	-65.1	107	169.7	-83.7	-167.6	174.5	-179.7	0	108.6	I23 H27	I23-K25 PolarHBondContact O-N 3.35Å; K25-H27 PolarHBondContact O-N 2.84Å
26	S	58.8	Low	77.2	Confident	95 Å²	95	105.2 Å²	105.2	66%	0.664	57%	0.573	S	S	*	*			trans	-63.9	110.8	159.7	171.3	0	0	0	0	107.5	G24 T28	G24-S26 PolarHBondContact O-N 2.76Å; S26-T28 VanDerWaalsContact C-N 3.34Å; S26-T28 PolarHBondContact O-N 3.09Å; S26-T28 VanDerWaalsContact O-N 3.08Å
27	H	51.5	Low	77.6	Confident	162 Å²	162	107.7 Å²	107.7	75%	0.75	58%	0.583	S	S	*	*			trans	-73	96.1	165.2	-171.7	-90.7	0	0	0	106.7	K25 E29	K25-H27 PolarHBondContact O-N 2.84Å; H27-E29 PolarHBondContact O-N 2.84Å
28	T	51.8	Low	78.2	Confident	115 Å²	115	105.3 Å²	105.3	71%	0.706	57%	0.571	S	S	*	*			trans	-72.4	83	169.4	52.7	0	0	0	0	107.6	S26 D30	S26-T28 VanDerWaalsContact C-N 3.34Å; S26-T28 PolarHBondContact O-N 3.09Å; S26-T28 VanDerWaalsContact O-N 3.08Å; T28-D30 PolarHBondContact O-N 2.84Å
29	E	61.3	Low	78.8	Confident	120 Å²	120	101.9 Å²	101.9	56%	0.561	56%	0.557	S	S	*	*			trans	-66.4	120.5	158.7	-168.9	169.2	178.7	0	0	106.1	H27 D31	H27-E29 PolarHBondContact O-N 2.84Å; E29-D31 PolarHBondContact O-N 3.07Å; E29-D31 VanDerWaalsContact O-N 3.09Å
30	D	71.1	Confident	79.5	Confident	146 Å²	146	103 Å²	103	78%	0.781	56%	0.558	S	S	*	*			trans	-53.6	119.8	178	-78.1	-33.5	0	0	0	109	T28 I32	T28-D30 PolarHBondContact O-N 2.84Å; D30-I32 PolarHBondContact O-N 3.41Å; D30-I32 VanDerWaalsContact O-N 3.1Å
31	D	84.3	Confident	80.4	Confident	81 Å²	81	100.2 Å²	100.2	43%	0.433	54%	0.539	S	S	.	.			trans	-72.5	108.2	-171.4	-159.6	-3.9	0	0	0	110.1	E29 I33 R42	E29-D31 PolarHBondContact O-N 3.07Å; E29-D31 VanDerWaalsContact O-N 3.09Å; D31-I33 HydrophobicContact CB-CD1 4.1Å; D31-I33 HydrophobicContact CB-CG1 4.36Å; D31-I33 PolarHBondContact O-N 2.84Å; D31-I33 WeakPolarHBondContact OD2-CD1 3.28Å; D31-R42 VanDerWaalsContact CG-NE 3.35Å; D31-R42 VanDerWaalsContact OD1-CD 3.32Å; D31-R42 WeakPolarHBondContact OD1-CD 3.47Å; D31-R42 VanDerWaalsContact OD1-CG 3.3Å; D31-R42 WeakPolarHBondContact OD1-CG 3.18Å; D31-R42 IonicContact OD1-CZ 3.69Å; D31-R42 IonicContact OD1-NE 2.73Å; D31-R42 PolarHBondContact OD1-NE 3.41Å; D31-R42 IonicContact OD1-NH2 3.81Å; D31-R42 IonicContact OD2-CZ 3.37Å; D31-R42 IonicContact OD2-NE 3.18Å; D31-R42 PolarHBondContact OD2-NE 2.91Å; D31-R42 IonicContact OD2-NH2 2.74Å; D31-R42 PolarHBondContact OD2-NH2 3.11Å
32	I	94.3	Very high	81.4	Confident	36 Å²	36	96.1 Å²	96.1	19%	0.185	52%	0.515	C	S	.	.			trans	-82.2	88.3	-177.9	-53.1	178.6	0	0	0	109.5	D30 R42 G43 N45 T54 F56	D30-I32 PolarHBondContact O-N 3.41Å; D30-I32 VanDerWaalsContact O-N 3.1Å; I32-R42 CarbonylContact O-C 3.3Å; I32-R42 WeakPolarHBondContact O-CA 3.38Å; I32-G43 PolarHBondContact O-N 2.92Å; I32-N45 HydrophobicContact CD1-CB 4.26Å; I32-N45 VanDerWaalsContact CD1-CG 3.42Å; I32-N45 VanDerWaalsContact CD1-OD1 3.3Å; I32-N45 WeakPolarHBondContact CD1-OD1 3.45Å; I32-T54 HydrophobicContact CD1-CG2 3.95Å; I32-T54 HydrophobicContact CG2-CG2 3.71Å; I32-F56 HydrophobicContact CG2-CE1 4.31Å; I32-F56 HydrophobicContact CG2-CZ 3.86Å
33	I	96.8	Very high	82.6	Confident	70 Å²	70	89.8 Å²	89.8	36%	0.359	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.5	124.2	-178.8	-59.2	159.3	0	0	0	111.1	D31 K40 V41 I83	D31-I33 HydrophobicContact CB-CD1 4.1Å; D31-I33 HydrophobicContact CB-CG1 4.36Å; D31-I33 PolarHBondContact O-N 2.84Å; D31-I33 WeakPolarHBondContact OD2-CD1 3.28Å; I33-K40 HydrophobicContact CG2-CB 3.97Å; I33-K40 HydrophobicContact CG2-CD 4.14Å; I33-K40 HydrophobicContact CG2-CG 4.38Å; I33-V41 WeakPolarHBondContact CA-O 3.14Å; I33-I83 HydrophobicContact CD1-CD1 3.64Å; I33-I83 HydrophobicContact CG1-CD1 4.26Å; I33-I83 HydrophobicContact CG1-CG2 4.43Å; I33-I83 HydrophobicContact CG2-CD1 4.48Å; I33-I83 HydrophobicContact CG2-CG2 4.48Å
34	I	95.8	Very high	83.6	Confident	74 Å²	74	85.9 Å²	85.9	38%	0.379	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	138.9	175.6	-61.2	-171.5	0	0	0	110.6	K40 V41 F56 I107	I34-K40 WeakPolarHBondContact O-CA 3.29Å; I34-V41 HydrophobicContact CB-CG2 4.33Å; I34-V41 PolarHBondContact N-O 3.4Å; I34-V41 PolarHBondContact O-N 2.87Å; I34-F56 HydrophobicContact CB-CE1 4.28Å; I34-F56 HydrophobicContact CB-CZ 4.34Å; I34-F56 HydrophobicContact CD1-CE1 4.09Å; I34-F56 HydrophobicContact CD1-CE2 3.85Å; I34-F56 HydrophobicContact CD1-CZ 3.29Å; I34-F56 HydrophobicContact CG1-CE1 4.05Å; I34-F56 HydrophobicContact CG1-CZ 3.7Å; I34-I107 HydrophobicContact CD1-CD1 4.48Å
35	A	97	Very high	85	Confident	80 Å²	80	86.7 Å²	86.7	66%	0.661	45%	0.452	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82	133	172.9	0	0	0	0	0	111.4
36	T	96	Very high	86.7	Confident	59 Å²	59	79.9 Å²	79.9	36%	0.362	43%	0.425	S	S	.	.			trans	-116.2	177	172.6	78	0	0	0	0	110.5	N38 G39 V41	T36-N38 PolarHBondContact O-N 3.18Å; T36-N38 PolarHBondContact OG1-N 3.32Å; T36-G39 WeakPolarHBondContact CB-O 3.43Å; T36-G39 PolarHBondContact N-O 2.61Å; T36-G39 PolarHBondContact OG1-N 3.1Å; T36-G39 PolarHBondContact OG1-O 2.74Å; T36-V41 HydrophobicContact CG2-CG1 3.98Å; T36-V41 HydrophobicContact CG2-CG2 3.96Å
37	K	95.1	Very high	88.4	Confident	188 Å²	188	81 Å²	81	82%	0.817	43%	0.428	S	S	*	.	S	Bend	trans	-61.4	-26.5	173.7	-64.7	-178.4	-178.9	178.6	0	113	K79	K37-K79 WeakPolarHBondContact O-CE 3.32Å
38	N	95.6	Very high	90.4	Very high	50 Å²	50	76.3 Å²	76.3	27%	0.267	41%	0.41	S	S	.	.	S	Bend	trans	-105.9	-8.8	-172.3	-66.9	85.9	0	0	0	114.1	T36 K79 W80	T36-N38 PolarHBondContact O-N 3.18Å; T36-N38 PolarHBondContact OG1-N 3.32Å; N38-K79 CarbonylContact O-C 3.54Å; N38-K79 WeakPolarHBondContact O-CA 3.43Å; N38-K79 WeakPolarHBondContact O-CB 3.28Å; N38-W80 HydrophobicContact CB-CE3 3.99Å; N38-W80 HydrophobicContact CB-CH2 3.56Å; N38-W80 HydrophobicContact CB-CZ2 4.3Å; N38-W80 HydrophobicContact CB-CZ3 3.38Å; N38-W80 PolarHBondContact O-N 3.33Å
39	G	96.8	Very high	92.2	Very high	17 Å²	17	81.1 Å²	81.1	18%	0.175	42%	0.422	C	S	.	.			trans	147.6	-176.4	178.7	0	0	0	0	0	112.1	T36	T36-G39 WeakPolarHBondContact CB-O 3.43Å; T36-G39 PolarHBondContact N-O 2.61Å; T36-G39 PolarHBondContact OG1-N 3.1Å; T36-G39 PolarHBondContact OG1-O 2.74Å
40	K	98.1	Very high	93.6	Very high	118 Å²	118	79.2 Å²	79.2	51%	0.513	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	144.1	178.5	-65.4	-178.7	-176	177.6	0	110.7	I33 I34 W80 I83 W84	I33-K40 HydrophobicContact CG2-CB 3.97Å; I33-K40 HydrophobicContact CG2-CD 4.14Å; I33-K40 HydrophobicContact CG2-CG 4.38Å; I34-K40 WeakPolarHBondContact O-CA 3.29Å; K40-W80 PolarHBondContact O-NE1 2.73Å; K40-I83 HydrophobicContact CB-CG1 4.15Å; K40-I83 HydrophobicContact CD-CG1 4.45Å; K40-W84 PolarHBondContact O-N 3.09Å
41	V	98.1	Very high	94.6	Very high	3 Å²	3	74 Å²	74	2%	0.018	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	139.6	175.8	-60.2	0	0	0	0	110.2	I33 I34 T36 F56 I59 W80 W84 A86	I33-V41 WeakPolarHBondContact CA-O 3.14Å; I34-V41 HydrophobicContact CB-CG2 4.33Å; I34-V41 PolarHBondContact N-O 3.4Å; I34-V41 PolarHBondContact O-N 2.87Å; T36-V41 HydrophobicContact CG2-CG1 3.98Å; T36-V41 HydrophobicContact CG2-CG2 3.96Å; V41-F56 HydrophobicContact CB-CD1 4.4Å; V41-F56 HydrophobicContact CG2-CD1 3.68Å; V41-F56 HydrophobicContact CG2-CE1 3.99Å; V41-I59 HydrophobicContact CG1-CG1 4.34Å; V41-I59 HydrophobicContact CG1-CG2 4.35Å; V41-W80 HydrophobicContact CG1-CZ2 3.77Å; V41-W84 CarbonylContact C-O 3.6Å; V41-W84 WeakPolarHBondContact CA-O 3.4Å; V41-W84 HydrophobicContact CG1-CB 4.21Å; V41-A86 HydrophobicContact CB-CB 4.29Å
42	R	97.9	Very high	95.1	Very high	80 Å²	80	72.7 Å²	72.7	30%	0.302	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	121.8	172.6	171.4	-178.3	-65.6	141.2	-1.8	110.1	D31 I32 I83 W84 A86 T87	D31-R42 VanDerWaalsContact CG-NE 3.35Å; D31-R42 VanDerWaalsContact OD1-CD 3.32Å; D31-R42 WeakPolarHBondContact OD1-CD 3.47Å; D31-R42 VanDerWaalsContact OD1-CG 3.3Å; D31-R42 WeakPolarHBondContact OD1-CG 3.18Å; D31-R42 IonicContact OD1-CZ 3.69Å; D31-R42 IonicContact OD1-NE 2.73Å; D31-R42 PolarHBondContact OD1-NE 3.41Å; D31-R42 IonicContact OD1-NH2 3.81Å; D31-R42 IonicContact OD2-CZ 3.37Å; D31-R42 IonicContact OD2-NE 3.18Å; D31-R42 PolarHBondContact OD2-NE 2.91Å; D31-R42 IonicContact OD2-NH2 2.74Å; D31-R42 PolarHBondContact OD2-NH2 3.11Å; I32-R42 CarbonylContact O-C 3.3Å; I32-R42 WeakPolarHBondContact O-CA 3.38Å; R42-I83 HydrophobicContact CB-CG2 3.75Å; R42-W84 PolarHBondContact N-O 2.87Å; R42-A86 CarbonylContact O-C 3.55Å; R42-A86 WeakPolarHBondContact O-CA 3.5Å; R42-A86 WeakPolarHBondContact O-CB 3.41Å; R42-A86 PolarHBondContact O-N 3.35Å; R42-T87 HydrophobicContact CG-CG2 4.17Å
43	G	96.8	Very high	95.1	Very high	6 Å²	6	72.6 Å²	72.6	6%	0.062	41%	0.411	C	S	.	.			trans	-101	-167.7	173.2	0	0	0	0	0	112.9	I32 A55 F56	I32-G43 PolarHBondContact O-N 2.92Å; G43-A55 CarbonylContact C-O 3.47Å; G43-A55 WeakPolarHBondContact CA-O 3.41Å; G43-F56 VanDerWaalsContact CA-CD1 3.47Å
44	M	95.4	Very high	95.1	Very high	38 Å²	38	70.2 Å²	70.2	19%	0.187	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.8	160.3	172	71.3	174.3	82.5	0	0	111	L46 T54 A55 L57 T87	M44-L46 HydrophobicContact CG-CD2 4.13Å; M44-L46 HydrophobicContact CG-CG 4.05Å; M44-L46 HydrophobicContact SD-CD1 4.42Å; M44-L46 HydrophobicContact SD-CD2 3.43Å; M44-L46 WeakPolarHBondContact SD-CD2 3.26Å; M44-L46 HydrophobicContact SD-CG 3.95Å; M44-T54 CarbonylContact O-C 3.18Å; M44-T54 WeakPolarHBondContact O-CA 3.37Å; M44-A55 HydrophobicContact CG-CB 4.38Å; M44-A55 PolarHBondContact N-O 3.44Å; M44-A55 PolarHBondContact O-N 3.13Å; M44-L57 HydrophobicContact CE-CD1 4.43Å; M44-T87 HydrophobicContact CB-CG2 4.35Å; M44-T87 VanDerWaalsContact CE-C 3.41Å; M44-T87 VanDerWaalsContact CE-CB 3.46Å; M44-T87 HydrophobicContact CE-CG2 4.08Å; M44-T87 WeakPolarHBondContact CE-O 3.37Å
45	N	95.3	Very high	95.1	Very high	81 Å²	81	66.7 Å²	66.7	43%	0.433	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92	135.8	166.8	-78.1	-27.7	0	0	0	110.4	I32 T52 V53 T54	I32-N45 HydrophobicContact CD1-CB 4.26Å; I32-N45 VanDerWaalsContact CD1-CG 3.42Å; I32-N45 VanDerWaalsContact CD1-OD1 3.3Å; I32-N45 WeakPolarHBondContact CD1-OD1 3.45Å; N45-T52 HydrophobicContact CB-CG2 3.89Å; N45-V53 CarbonylContact C-O 3.6Å; N45-V53 WeakPolarHBondContact CA-O 3.33Å; N45-T54 PolarHBondContact OD1-OG1 3.33Å
46	L	93.9	Very high	95.2	Very high	59 Å²	59	63.2 Å²	63.2	31%	0.309	35%	0.352	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	133.1	175.5	-65.2	176.3	0	0	0	109.3	M44 V48 T52 V53 A55	M44-L46 HydrophobicContact CG-CD2 4.13Å; M44-L46 HydrophobicContact CG-CG 4.05Å; M44-L46 HydrophobicContact SD-CD1 4.42Å; M44-L46 HydrophobicContact SD-CD2 3.43Å; M44-L46 WeakPolarHBondContact SD-CD2 3.26Å; M44-L46 HydrophobicContact SD-CG 3.95Å; L46-V48 HydrophobicContact CB-CG2 4.3Å; L46-T52 WeakPolarHBondContact O-CA 3.44Å; L46-V53 HydrophobicContact CB-CG2 3.87Å; L46-V53 PolarHBondContact N-O 3.18Å; L46-V53 PolarHBondContact O-N 3.43Å; L46-A55 HydrophobicContact CD1-CB 3.71Å; L46-A55 HydrophobicContact CG-CB 4.28Å
47	T	94.4	Very high	95.3	Very high	118 Å²	118	60.7 Å²	60.7	72%	0.724	34%	0.336	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.8	121.5	171.3	-53.5	0	0	0	0	109.3	G51	T47-G51 CarbonylContact C-O 3.57Å; T47-G51 WeakPolarHBondContact CA-O 3.26Å
48	V	92.4	Very high	95.4	Very high	63 Å²	63	51.9 Å²	51.9	38%	0.382	30%	0.299	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135	119.3	-176.5	-179.4	0	0	0	0	108.8	L46 G50 G51 V53	L46-V48 HydrophobicContact CB-CG2 4.3Å; V48-G50 PolarHBondContact O-N 3.22Å; V48-G50 VanDerWaalsContact O-N 3.11Å; V48-G51 PolarHBondContact N-O 3.08Å; V48-G51 PolarHBondContact O-N 3.02Å; V48-V53 HydrophobicContact CG2-CG2 3.78Å
49	F	90.8	Very high	95.5	Very high	217 Å²	217	50.4 Å²	50.4	95%	0.952	29%	0.291	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.1	37.5	-179.7	-57.3	-65.8	0	0	0	114.7	G51	F49-G51 VanDerWaalsContact C-N 3.27Å; F49-G51 PolarHBondContact O-N 3.19Å
50	G	90.6	Very high	95.6	Very high	79 Å²	79	50.1 Å²	50.1	81%	0.814	29%	0.286	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.7	-2.7	-179.5	0	0	0	0	0	115.2	V48	V48-G50 PolarHBondContact O-N 3.22Å; V48-G50 VanDerWaalsContact O-N 3.11Å
51	G	91.7	Very high	95.4	Very high	36 Å²	36	49.8 Å²	49.8	37%	0.371	28%	0.282	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	176.6	168	0	0	0	0	0	112.4	T47 V48 F49	T47-G51 CarbonylContact C-O 3.57Å; T47-G51 WeakPolarHBondContact CA-O 3.26Å; V48-G51 PolarHBondContact N-O 3.08Å; V48-G51 PolarHBondContact O-N 3.02Å; F49-G51 VanDerWaalsContact C-N 3.27Å; F49-G51 PolarHBondContact O-N 3.19Å
52	T	94.2	Very high	95.3	Very high	55 Å²	55	50.6 Å²	50.6	34%	0.337	29%	0.287	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.7	137.2	175.6	-54.6	0	0	0	0	109.7	N45 L46 A109	N45-T52 HydrophobicContact CB-CG2 3.89Å; L46-T52 WeakPolarHBondContact O-CA 3.44Å; T52-A109 HydrophobicContact CG2-CB 3.92Å; T52-A109 WeakPolarHBondContact O-CB 3.35Å; T52-A109 PolarHBondContact O-N 3.24Å; T52-A109 VanDerWaalsContact O-O 3.09Å
53	V	95.4	Very high	95.3	Very high	34 Å²	34	49.4 Å²	49.4	21%	0.206	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.4	137.9	168.3	-60.1	0	0	0	0	109.2	N45 L46 V48 I107	N45-V53 CarbonylContact C-O 3.6Å; N45-V53 WeakPolarHBondContact CA-O 3.33Å; L46-V53 HydrophobicContact CB-CG2 3.87Å; L46-V53 PolarHBondContact N-O 3.18Å; L46-V53 PolarHBondContact O-N 3.43Å; V48-V53 HydrophobicContact CG2-CG2 3.78Å; V53-I107 CarbonylContact C-O 3.54Å; V53-I107 WeakPolarHBondContact CA-O 3.19Å
54	T	96	Very high	95.1	Very high	20 Å²	20	51.2 Å²	51.2	12%	0.123	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88	119.3	168.7	-55.1	0	0	0	0	108.5	I32 M44 N45 F56 W106 I107	I32-T54 HydrophobicContact CD1-CG2 3.95Å; I32-T54 HydrophobicContact CG2-CG2 3.71Å; M44-T54 CarbonylContact O-C 3.18Å; M44-T54 WeakPolarHBondContact O-CA 3.37Å; N45-T54 PolarHBondContact OD1-OG1 3.33Å; T54-F56 HydrophobicContact CG2-CD2 4.39Å; T54-F56 HydrophobicContact CG2-CE2 3.52Å; T54-F56 HydrophobicContact CG2-CZ 3.76Å; T54-W106 WeakPolarHBondContact O-CA 3.2Å; T54-I107 PolarHBondContact N-O 3.28Å; T54-I107 PolarHBondContact O-N 3.12Å
55	A	96.7	Very high	95.1	Very high	0 Å²	0	51 Å²	51	0%	0	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	138.7	-178.8	0	0	0	0	0	111.4	G43 M44 L46 L57 V105	G43-A55 CarbonylContact C-O 3.47Å; G43-A55 WeakPolarHBondContact CA-O 3.41Å; M44-A55 HydrophobicContact CG-CB 4.38Å; M44-A55 PolarHBondContact N-O 3.44Å; M44-A55 PolarHBondContact O-N 3.13Å; L46-A55 HydrophobicContact CD1-CB 3.71Å; L46-A55 HydrophobicContact CG-CB 4.28Å; A55-L57 HydrophobicContact CB-CD2 4.25Å; A55-L57 HydrophobicContact CB-CG 4.43Å; A55-V105 CarbonylContact C-O 3.53Å; A55-V105 WeakPolarHBondContact CA-O 3.35Å
56	F	97.9	Very high	95	Very high	6 Å²	6	51 Å²	51	3%	0.026	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	113	168.6	-57	-96.1	0	0	0	108	I32 I34 V41 G43 T54 I59 A86 N104 V105 I107	I32-F56 HydrophobicContact CG2-CE1 4.31Å; I32-F56 HydrophobicContact CG2-CZ 3.86Å; I34-F56 HydrophobicContact CB-CE1 4.28Å; I34-F56 HydrophobicContact CB-CZ 4.34Å; I34-F56 HydrophobicContact CD1-CE1 4.09Å; I34-F56 HydrophobicContact CD1-CE2 3.85Å; I34-F56 HydrophobicContact CD1-CZ 3.29Å; I34-F56 HydrophobicContact CG1-CE1 4.05Å; I34-F56 HydrophobicContact CG1-CZ 3.7Å; V41-F56 HydrophobicContact CB-CD1 4.4Å; V41-F56 HydrophobicContact CG2-CD1 3.68Å; V41-F56 HydrophobicContact CG2-CE1 3.99Å; G43-F56 VanDerWaalsContact CA-CD1 3.47Å; T54-F56 HydrophobicContact CG2-CD2 4.39Å; T54-F56 HydrophobicContact CG2-CE2 3.52Å; T54-F56 HydrophobicContact CG2-CZ 3.76Å; F56-I59 HydrophobicContact CB-CD1 3.57Å; F56-I59 HydrophobicContact CB-CG1 4.37Å; F56-A86 CarbonylContact C-O 3.55Å; F56-A86 WeakPolarHBondContact CA-O 3.49Å; F56-A86 HydrophobicContact CB-CB 4.14Å; F56-N104 CarbonylContact O-C 3.58Å; F56-N104 VanDerWaalsContact O-CA 3.26Å; F56-N104 WeakPolarHBondContact O-CA 3.5Å; F56-V105 HydrophobicContact CB-CB 4.39Å; F56-V105 PolarHBondContact N-O 3.41Å; F56-V105 PolarHBondContact O-N 3.48Å; F56-I107 HydrophobicContact CD2-CD1 4.36Å; F56-I107 HydrophobicContact CE2-CD1 3.8Å; F56-I107 HydrophobicContact CE2-CG1 4.47Å
57	L	98.1	Very high	95	Very high	6 Å²	6	51.2 Å²	51.2	3%	0.031	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	144.6	-170.4	-52.5	179.9	0	0	0	110.8	M44 A55 I59 A86 K88 Y89 N104 W106	M44-L57 HydrophobicContact CE-CD1 4.43Å; A55-L57 HydrophobicContact CB-CD2 4.25Å; A55-L57 HydrophobicContact CB-CG 4.43Å; L57-I59 PolarHBondContact O-N 3.38Å; L57-A86 PolarHBondContact N-O 3.48Å; L57-A86 CarbonylContact O-C 3.55Å; L57-A86 VanDerWaalsContact O-C 3.29Å; L57-A86 WeakPolarHBondContact O-CA 3.38Å; L57-A86 VanDerWaalsContact O-CB 3.24Å; L57-A86 WeakPolarHBondContact O-CB 3.47Å; L57-K88 CarbonylContact C-O 3.37Å; L57-K88 VanDerWaalsContact C-O 3.3Å; L57-K88 WeakPolarHBondContact CB-O 3.38Å; L57-Y89 HydrophobicContact CD1-CD1 4.45Å; L57-Y89 HydrophobicContact CD1-CD2 4.07Å; L57-Y89 HydrophobicContact CD1-CE1 4.29Å; L57-Y89 HydrophobicContact CD1-CE2 3.88Å; L57-Y89 HydrophobicContact CD1-CG 4.35Å; L57-Y89 HydrophobicContact CD2-CD1 4.35Å; L57-Y89 HydrophobicContact CD2-CE1 3.81Å; L57-N104 VanDerWaalsContact CA-OD1 3.26Å; L57-N104 WeakPolarHBondContact CA-OD1 3.28Å; L57-N104 HydrophobicContact CD2-CB 3.95Å; L57-W106 HydrophobicContact CD2-CZ2 3.8Å
58	G	97.8	Very high	95.1	Very high	4 Å²	4	56.2 Å²	56.2	4%	0.041	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	65	38.3	172.2	0	0	0	0	0	114	W84 Y102 L103 N104	G58-W84 PolarHBondContact O-NE1 3.31Å; G58-Y102 WeakPolarHBondContact O-CD1 3.41Å; G58-L103 PolarHBondContact N-O 3.03Å; G58-N104 PolarHBondContact N-OD1 3.04Å
59	I	98	Very high	95.2	Very high	19 Å²	19	55 Å²	55	10%	0.097	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.1	122.3	175.9	-59.2	163.9	0	0	0	109	V41 F56 L57 W80 A86 Y102 L103 V105	V41-I59 HydrophobicContact CG1-CG1 4.34Å; V41-I59 HydrophobicContact CG1-CG2 4.35Å; F56-I59 HydrophobicContact CB-CD1 3.57Å; F56-I59 HydrophobicContact CB-CG1 4.37Å; L57-I59 PolarHBondContact O-N 3.38Å; I59-W80 HydrophobicContact CG2-CH2 4.43Å; I59-A86 HydrophobicContact CD1-CB 4.48Å; I59-A86 HydrophobicContact CG1-CB 3.8Å; I59-Y102 CarbonylContact O-C 3.56Å; I59-Y102 VanDerWaalsContact O-CA 3.28Å; I59-Y102 WeakPolarHBondContact O-CA 3.49Å; I59-L103 HydrophobicContact CB-CD1 3.99Å; I59-L103 HydrophobicContact CB-CG 4.31Å; I59-L103 HydrophobicContact CD1-CD1 4.03Å; I59-L103 PolarHBondContact N-O 3.45Å; I59-L103 PolarHBondContact O-N 3.3Å; I59-V105 HydrophobicContact CD1-CG2 4.34Å
60	P	97.1	Very high	95.4	Very high	11 Å²	11	50.4 Å²	50.4	7%	0.071	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.2	135.9	176.2	29.6	-35	0	0	0	109.3	L77 W80 W84 Y102	P60-L77 HydrophobicContact CB-CD1 3.78Å; P60-L77 HydrophobicContact CB-CD2 4.47Å; P60-L77 HydrophobicContact CG-CD1 4.19Å; P60-L77 WeakPolarHBondContact O-CD1 2.8Å; P60-W80 HydrophobicContact CG-CH2 4.42Å; P60-W80 HydrophobicContact CG-CZ3 4Å; P60-W84 HydrophobicContact CG-CD2 4.11Å; P60-W84 HydrophobicContact CG-CE3 4.2Å; P60-W84 HydrophobicContact CG-CH2 3.86Å; P60-W84 HydrophobicContact CG-CZ2 3.75Å; P60-W84 HydrophobicContact CG-CZ3 4.08Å; P60-Y102 HydrophobicContact CB-CD1 3.86Å; P60-Y102 HydrophobicContact CB-CE1 3.73Å; P60-Y102 HydrophobicContact CG-CE1 4.4Å
61	Y	95.9	Very high	95.5	Very high	110 Å²	110	55.1 Å²	55.1	43%	0.431	29%	0.285	S	S	.	.			trans	-114.4	-17.8	177.2	67.4	-89	0	0	0	113.9	L101 L103	Y61-L101 VanDerWaalsContact CD1-O 3.28Å; Y61-L101 WeakPolarHBondContact CD1-O 3.25Å; Y61-L101 HydrophobicContact CE1-CB 3.97Å; Y61-L101 WeakPolarHBondContact CE1-O 3.47Å; Y61-L103 HydrophobicContact CD1-CB 4.39Å; Y61-L103 HydrophobicContact CD1-CD2 4.36Å; Y61-L103 HydrophobicContact CG-CD2 4.38Å
62	V	96	Very high	95.7	Very high	21 Å²	21	59.4 Å²	59.4	13%	0.127	29%	0.293	C	S	.	.	S	Bend	trans	-146.1	165.2	177	-73.6	0	0	0	0	110.1	P74 Q75 L77 L101	V62-P74 HydrophobicContact CB-CB 3.99Å; V62-P74 HydrophobicContact CG1-CB 3.75Å; V62-P74 HydrophobicContact CG2-CB 4.11Å; V62-Q75 WeakPolarHBondContact CA-O 3.18Å; V62-Q75 WeakPolarHBondContact CB-O 3.24Å; V62-L77 VanDerWaalsContact C-CD2 3.43Å; V62-L77 VanDerWaalsContact C-CG 3.42Å; V62-L77 VanDerWaalsContact O-CD2 3.29Å; V62-L77 WeakPolarHBondContact O-CD2 3.02Å; V62-L101 HydrophobicContact CG2-CB 3.59Å; V62-L101 HydrophobicContact CG2-CD1 3.45Å; V62-L101 VanDerWaalsContact CG2-CD1 3.45Å; V62-L101 HydrophobicContact CG2-CG 4.15Å
63	Q	95.9	Very high	95.8	Very high	55 Å²	55	65.8 Å²	65.8	26%	0.257	32%	0.316	S	S	.	.			trans	-61.4	143.6	172.4	-68.7	-166.2	-3.7	0	0	111.2	L69 Q75 S76 L77	Q63-L69 HydrophobicContact CB-CD1 4.12Å; Q63-Q75 HydrophobicContact CB-CB 4.28Å; Q63-Q75 HydrophobicContact CG-CB 4.36Å; Q63-Q75 PolarHBondContact N-O 3.4Å; Q63-S76 WeakPolarHBondContact CG-O 3.3Å; Q63-L77 HydrophobicContact CG-CD2 4.29Å
64	P	94.6	Very high	95.8	Very high	44 Å²	44	68.6 Å²	68.6	29%	0.286	34%	0.335	S	S	.	.			trans	-66.7	138.7	179.8	29.9	-35.9	0	0	0	110	L66 L69 D99	P64-L66 HydrophobicContact CB-CD1 4.15Å; P64-L66 HydrophobicContact CB-CG 4.07Å; P64-L66 HydrophobicContact CG-CD1 4.27Å; P64-L66 PolarHBondContact O-N 3.18Å; P64-L69 WeakPolarHBondContact O-CD1 3.3Å; P64-D99 HydrophobicContact CB-CB 4.37Å; P64-D99 WeakPolarHBondContact CB-OD1 3.35Å
65	P	94.5	Very high	95.8	Very high	33 Å²	33	72 Å²	72	21%	0.214	35%	0.35	C	S	.	.			trans	-80.7	46.3	-171.1	35.6	-37.1	0	0	0	112.1	R70 E98 L101	P65-R70 VanDerWaalsContact O-CA 3.25Å; P65-R70 WeakPolarHBondContact O-CA 3.36Å; P65-R70 PolarHBondContact O-N 3.49Å; P65-E98 WeakPolarHBondContact CD-O 3.35Å; P65-E98 WeakPolarHBondContact CG-O 3.34Å; P65-L101 HydrophobicContact CB-CD1 4.4Å; P65-L101 HydrophobicContact CG-CD1 3.95Å; P65-L101 HydrophobicContact CG-CG 4.27Å
66	L	93.7	Very high	95.7	Very high	80 Å²	80	77.1 Å²	77.1	42%	0.419	39%	0.385	S	S	.	.			trans	-90.1	151.2	-174.4	-57.2	175.6	0	0	0	112	P64 R68 L69 E98 D99	P64-L66 HydrophobicContact CB-CD1 4.15Å; P64-L66 HydrophobicContact CB-CG 4.07Å; P64-L66 HydrophobicContact CG-CD1 4.27Å; P64-L66 PolarHBondContact O-N 3.18Å; L66-R68 PolarHBondContact O-N 2.93Å; L66-R68 VanDerWaalsContact O-N 3.11Å; L66-L69 WeakPolarHBondContact O-CB 3.21Å; L66-L69 PolarHBondContact O-N 3.33Å; L66-E98 HydrophobicContact CD2-CB 3.73Å; L66-D99 HydrophobicContact CD1-CB 4.38Å; L66-D99 HydrophobicContact CD2-CB 4.37Å
67	G	93.4	Very high	95.6	Very high	65 Å²	65	78.4 Å²	78.4	67%	0.67	39%	0.393	S	S	*	.	G	3₁₀ helix	trans	54.8	-116.5	173.6	0	0	0	0	0	112.6	L69 R70	G67-L69 PolarHBondContact O-N 3.31Å; G67-R70 VanDerWaalsContact O-CB 3.22Å; G67-R70 WeakPolarHBondContact O-CB 3.44Å; G67-R70 PolarHBondContact O-N 2.91Å
68	R	95.9	Very high	95.3	Very high	223 Å²	223	83.4 Å²	83.4	84%	0.842	42%	0.423	S	S	*	.	G	3₁₀ helix	trans	-70.4	-11.9	-178.7	-64	-177	-178.3	177.9	0.6	114.3	L66 K72	L66-R68 PolarHBondContact O-N 2.93Å; L66-R68 VanDerWaalsContact O-N 3.11Å; R68-K72 VanDerWaalsContact O-CD 3.26Å; R68-K72 WeakPolarHBondContact O-CD 3.34Å; R68-K72 WeakPolarHBondContact O-CE 3.43Å; R68-K72 PolarHBondContact O-NZ 2.85Å
69	L	95.3	Very high	95.2	Very high	37 Å²	37	90.8 Å²	90.8	19%	0.194	45%	0.454	C	S	.	.	G	3₁₀ helix	trans	-89.9	-11.2	175.9	-61.7	179.8	0	0	0	112.3	Q63 P64 L66 G67 F71 K72 Q75	Q63-L69 HydrophobicContact CB-CD1 4.12Å; P64-L69 WeakPolarHBondContact O-CD1 3.3Å; L66-L69 WeakPolarHBondContact O-CB 3.21Å; L66-L69 PolarHBondContact O-N 3.33Å; G67-L69 PolarHBondContact O-N 3.31Å; L69-F71 PolarHBondContact O-N 2.87Å; L69-K72 WeakPolarHBondContact O-CB 3.15Å; L69-K72 PolarHBondContact O-N 2.86Å; L69-K72 VanDerWaalsContact O-N 3.11Å; L69-Q75 VanDerWaalsContact CD2-CD 3.43Å; L69-Q75 HydrophobicContact CD2-CG 4.13Å
70	R	93.9	Very high	95.1	Very high	120 Å²	120	92 Å²	92	45%	0.453	46%	0.458	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.9	134.9	177.1	-161.8	-175.3	-173.9	-170.2	2.3	110.5	P65 G67 K72 E98	P65-R70 VanDerWaalsContact O-CA 3.25Å; P65-R70 WeakPolarHBondContact O-CA 3.36Å; P65-R70 PolarHBondContact O-N 3.49Å; G67-R70 VanDerWaalsContact O-CB 3.22Å; G67-R70 WeakPolarHBondContact O-CB 3.44Å; G67-R70 PolarHBondContact O-N 2.91Å; R70-K72 PolarHBondContact O-N 3.41Å; R70-K72 VanDerWaalsContact O-N 3.12Å; R70-E98 IonicContact CZ-OE1 3.03Å; R70-E98 IonicContact NE-OE1 2.67Å; R70-E98 PolarHBondContact NE-OE1 3.37Å; R70-E98 IonicContact NE-OE2 3.59Å; R70-E98 IonicContact NH2-OE1 2.86Å; R70-E98 PolarHBondContact NH2-OE1 3.45Å
71	F	93.1	Very high	95	Very high	179 Å²	179	96.9 Å²	96.9	79%	0.785	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.2	14.3	-178.1	-47.1	-61.5	0	0	0	115.5	L69	L69-F71 PolarHBondContact O-N 2.87Å
72	K	95.8	Very high	95	Very high	126 Å²	126	97.6 Å²	97.6	55%	0.548	50%	0.503	S	S	.	.	S	Bend	trans	-98.1	163.4	171.9	-64.5	-171.2	179.9	163.1	0	110.9	R68 L69 R70	R68-K72 VanDerWaalsContact O-CD 3.26Å; R68-K72 WeakPolarHBondContact O-CD 3.34Å; R68-K72 WeakPolarHBondContact O-CE 3.43Å; R68-K72 PolarHBondContact O-NZ 2.85Å; L69-K72 WeakPolarHBondContact O-CB 3.15Å; L69-K72 PolarHBondContact O-N 2.86Å; L69-K72 VanDerWaalsContact O-N 3.11Å; R70-K72 PolarHBondContact O-N 3.41Å; R70-K72 VanDerWaalsContact O-N 3.12Å
73	K	96.9	Very high	95.1	Very high	188 Å²	188	99.6 Å²	99.6	82%	0.817	51%	0.513	S	S	*	.	P	Polyproline II helix	trans	-56.5	141	169.1	-68.7	-174.7	178.6	-178.8	0	109.5	Q75	K73-Q75 PolarHBondContact O-N 2.93Å
74	P	95.3	Very high	95.1	Very high	93 Å²	93	101.2 Å²	101.2	60%	0.604	52%	0.517	S	S	*	.	P	Polyproline II helix	trans	-54.5	138.1	176.9	-25.4	33.7	0	0	0	112.1	V62	V62-P74 HydrophobicContact CB-CB 3.99Å; V62-P74 HydrophobicContact CG1-CB 3.75Å; V62-P74 HydrophobicContact CG2-CB 4.11Å
75	Q	96.3	Very high	95.3	Very high	91 Å²	91	102.9 Å²	102.9	43%	0.425	52%	0.523	S	S	.	.	P	Polyproline II helix	trans	-101.4	149.4	177	-64.9	-166.3	-4.8	0	0	111	V62 Q63 L69 K73	V62-Q75 WeakPolarHBondContact CA-O 3.18Å; V62-Q75 WeakPolarHBondContact CB-O 3.24Å; Q63-Q75 HydrophobicContact CB-CB 4.28Å; Q63-Q75 HydrophobicContact CG-CB 4.36Å; Q63-Q75 PolarHBondContact N-O 3.4Å; L69-Q75 VanDerWaalsContact CD2-CD 3.43Å; L69-Q75 HydrophobicContact CD2-CG 4.13Å; K73-Q75 PolarHBondContact O-N 2.93Å
76	S	95.3	Very high	95.4	Very high	108 Å²	108	101.3 Å²	101.3	76%	0.755	51%	0.513	S	S	*	.	P	Polyproline II helix	trans	-64.6	142.7	178.5	-67.5	0	0	0	0	111.5	Q63	Q63-S76 WeakPolarHBondContact CG-O 3.3Å
77	L	94	Very high	95.6	Very high	34 Å²	34	99 Å²	99	18%	0.178	50%	0.502	C	S	.	.	P	Polyproline II helix	trans	-70.2	144.3	175.9	-78	166.9	0	0	0	112.6	P60 V62 Q63 W80	P60-L77 HydrophobicContact CB-CD1 3.78Å; P60-L77 HydrophobicContact CB-CD2 4.47Å; P60-L77 HydrophobicContact CG-CD1 4.19Å; P60-L77 WeakPolarHBondContact O-CD1 2.8Å; V62-L77 VanDerWaalsContact C-CD2 3.43Å; V62-L77 VanDerWaalsContact C-CG 3.42Å; V62-L77 VanDerWaalsContact O-CD2 3.29Å; V62-L77 WeakPolarHBondContact O-CD2 3.02Å; Q63-L77 HydrophobicContact CG-CD2 4.29Å; L77-W80 HydrophobicContact CD1-CZ3 4.25Å
78	T	92.4	Very high	95.8	Very high	110 Å²	110	103.2 Å²	103.2	68%	0.675	50%	0.502	S	S	*	.	P	Polyproline II helix	trans	-69.6	138.9	158.5	-51.6	0	0	0	0	108.6
79	K	95.3	Very high	95.8	Very high	159 Å²	159	99.7 Å²	99.7	69%	0.691	49%	0.49	S	S	*	.	P	Polyproline II helix	trans	-63.6	139.5	174.6	-58.7	-167.8	179.4	-177.5	0	110	K37 N38	K37-K79 WeakPolarHBondContact O-CE 3.32Å; N38-K79 CarbonylContact O-C 3.54Å; N38-K79 WeakPolarHBondContact O-CA 3.43Å; N38-K79 WeakPolarHBondContact O-CB 3.28Å
80	W	95.8	Very high	95.8	Very high	44 Å²	44	99.6 Å²	99.6	17%	0.167	49%	0.494	C	S	.	.	P	Polyproline II helix	trans	-94.9	143.4	173.7	58.8	86.4	0	0	0	110.2	N38 K40 V41 I59 P60 L77 W84	N38-W80 HydrophobicContact CB-CE3 3.99Å; N38-W80 HydrophobicContact CB-CH2 3.56Å; N38-W80 HydrophobicContact CB-CZ2 4.3Å; N38-W80 HydrophobicContact CB-CZ3 3.38Å; N38-W80 PolarHBondContact O-N 3.33Å; K40-W80 PolarHBondContact O-NE1 2.73Å; V41-W80 HydrophobicContact CG1-CZ2 3.77Å; I59-W80 HydrophobicContact CG2-CH2 4.43Å; P60-W80 HydrophobicContact CG-CH2 4.42Å; P60-W80 HydrophobicContact CG-CZ3 4Å; L77-W80 HydrophobicContact CD1-CZ3 4.25Å; W80-W84 HydrophobicContact CZ2-CB 4.15Å
81	S	94.8	Very high	95.8	Very high	114 Å²	114	97.6 Å²	97.6	80%	0.797	49%	0.493	S	S	*	.	S	Bend	trans	-82	-39.1	-178.1	47.1	0	0	0	0	112.8
82	D	96.5	Very high	95.7	Very high	125 Å²	125	94.2 Å²	94.2	67%	0.668	49%	0.491	S	S	*	.	S	Bend	trans	-84.5	-174.1	-174.1	-59.8	-45.1	0	0	0	112.2
83	I	97.4	Very high	95.3	Very high	63 Å²	63	92 Å²	92	32%	0.323	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.8	118	174.1	-58.6	170.8	0	0	0	108.1	I33 K40 R42 N85	I33-I83 HydrophobicContact CD1-CD1 3.64Å; I33-I83 HydrophobicContact CG1-CD1 4.26Å; I33-I83 HydrophobicContact CG1-CG2 4.43Å; I33-I83 HydrophobicContact CG2-CD1 4.48Å; I33-I83 HydrophobicContact CG2-CG2 4.48Å; K40-I83 HydrophobicContact CB-CG1 4.15Å; K40-I83 HydrophobicContact CD-CG1 4.45Å; R42-I83 HydrophobicContact CB-CG2 3.75Å; I83-N85 PolarHBondContact O-N 3.4Å
84	W	97.4	Very high	94.5	Very high	89 Å²	89	87.1 Å²	87.1	34%	0.337	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.4	124.4	173.6	-174.6	-85.8	0	0	0	110	K40 V41 R42 G58 P60 W80 A86 Y102	K40-W84 PolarHBondContact O-N 3.09Å; V41-W84 CarbonylContact C-O 3.6Å; V41-W84 WeakPolarHBondContact CA-O 3.4Å; V41-W84 HydrophobicContact CG1-CB 4.21Å; R42-W84 PolarHBondContact N-O 2.87Å; G58-W84 PolarHBondContact O-NE1 3.31Å; P60-W84 HydrophobicContact CG-CD2 4.11Å; P60-W84 HydrophobicContact CG-CE3 4.2Å; P60-W84 HydrophobicContact CG-CH2 3.86Å; P60-W84 HydrophobicContact CG-CZ2 3.75Å; P60-W84 HydrophobicContact CG-CZ3 4.08Å; W80-W84 HydrophobicContact CZ2-CB 4.15Å; W84-A86 PolarHBondContact O-N 2.93Å; W84-A86 VanDerWaalsContact O-N 3.09Å; W84-Y102 HydrophobicContact CH2-CE1 4.49Å; W84-Y102 HydrophobicContact CZ2-CE1 4.01Å
85	N	97.5	Very high	93.2	Very high	79 Å²	79	91.2 Å²	91.2	42%	0.422	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.8	95	-179.7	-172.5	13.7	0	0	0	110.9	I83 T87	I83-N85 PolarHBondContact O-N 3.4Å; N85-T87 VanDerWaalsContact C-N 3.3Å; N85-T87 VanDerWaalsContact CG-OG1 3.27Å; N85-T87 PolarHBondContact ND2-OG1 3.01Å; N85-T87 PolarHBondContact O-N 2.9Å; N85-T87 WeakPolarHBondContact OD1-CB 3.27Å; N85-T87 VanDerWaalsContact OD1-CG2 3.28Å; N85-T87 WeakPolarHBondContact OD1-CG2 3.28Å; N85-T87 PolarHBondContact OD1-OG1 3.46Å
86	A	97.8	Very high	92.2	Very high	0 Å²	0	93.9 Å²	93.9	0%	0	51%	0.507	C	S	.	.			trans	-94.8	42.7	-179.9	0	0	0	0	0	112.1	V41 R42 F56 L57 I59 W84	V41-A86 HydrophobicContact CB-CB 4.29Å; R42-A86 CarbonylContact O-C 3.55Å; R42-A86 WeakPolarHBondContact O-CA 3.5Å; R42-A86 WeakPolarHBondContact O-CB 3.41Å; R42-A86 PolarHBondContact O-N 3.35Å; F56-A86 CarbonylContact C-O 3.55Å; F56-A86 WeakPolarHBondContact CA-O 3.49Å; F56-A86 HydrophobicContact CB-CB 4.14Å; L57-A86 PolarHBondContact N-O 3.48Å; L57-A86 CarbonylContact O-C 3.55Å; L57-A86 VanDerWaalsContact O-C 3.29Å; L57-A86 WeakPolarHBondContact O-CA 3.38Å; L57-A86 VanDerWaalsContact O-CB 3.24Å; L57-A86 WeakPolarHBondContact O-CB 3.47Å; I59-A86 HydrophobicContact CD1-CB 4.48Å; I59-A86 HydrophobicContact CG1-CB 3.8Å; W84-A86 PolarHBondContact O-N 2.93Å; W84-A86 VanDerWaalsContact O-N 3.09Å
87	T	97.1	Very high	91.7	Very high	31 Å²	31	92.2 Å²	92.2	19%	0.19	49%	0.49	C	S	.	.	B	Isolated β-bridge	trans	-105.3	4.1	179.5	58.1	0	0	0	0	112.8	R42 M44 N85	R42-T87 HydrophobicContact CG-CG2 4.17Å; M44-T87 HydrophobicContact CB-CG2 4.35Å; M44-T87 VanDerWaalsContact CE-C 3.41Å; M44-T87 VanDerWaalsContact CE-CB 3.46Å; M44-T87 HydrophobicContact CE-CG2 4.08Å; M44-T87 WeakPolarHBondContact CE-O 3.37Å; N85-T87 VanDerWaalsContact C-N 3.3Å; N85-T87 VanDerWaalsContact CG-OG1 3.27Å; N85-T87 PolarHBondContact ND2-OG1 3.01Å; N85-T87 PolarHBondContact O-N 2.9Å; N85-T87 WeakPolarHBondContact OD1-CB 3.27Å; N85-T87 VanDerWaalsContact OD1-CG2 3.28Å; N85-T87 WeakPolarHBondContact OD1-CG2 3.28Å; N85-T87 PolarHBondContact OD1-OG1 3.46Å
88	K	96.8	Very high	91.6	Very high	154 Å²	154	93.4 Å²	93.4	67%	0.67	49%	0.494	S	S	*	.	S	Bend	trans	-137.4	143.4	-177.5	-63.4	-175.7	-178.8	-178.2	0	110	L57	L57-K88 CarbonylContact C-O 3.37Å; L57-K88 VanDerWaalsContact C-O 3.3Å; L57-K88 WeakPolarHBondContact CB-O 3.38Å
89	Y	96.8	Very high	91.7	Very high	150 Å²	150	90.2 Å²	90.2	59%	0.588	47%	0.473	S	S	*	.			trans	-61.5	139.5	168.8	-71.5	-73.5	0	0	0	110	L57 W106	L57-Y89 HydrophobicContact CD1-CD1 4.45Å; L57-Y89 HydrophobicContact CD1-CD2 4.07Å; L57-Y89 HydrophobicContact CD1-CE1 4.29Å; L57-Y89 HydrophobicContact CD1-CE2 3.88Å; L57-Y89 HydrophobicContact CD1-CG 4.35Å; L57-Y89 HydrophobicContact CD2-CD1 4.35Å; L57-Y89 HydrophobicContact CD2-CE1 3.81Å; Y89-W106 HydrophobicContact CE1-CZ2 4.19Å
90	A	95.4	Very high	91.6	Very high	35 Å²	35	83.4 Å²	83.4	29%	0.289	45%	0.445	S	S	.	.			trans	-84.7	176.3	168.8	0	0	0	0	0	110.9	Y102	A90-Y102 HydrophobicContact CB-CD1 3.86Å; A90-Y102 HydrophobicContact CB-CD2 3.34Å; A90-Y102 HydrophobicContact CB-CE1 4.41Å; A90-Y102 HydrophobicContact CB-CE2 3.99Å; A90-Y102 HydrophobicContact CB-CG 3.3Å
91	N	93.8	Very high	91.6	Very high	77 Å²	77	82.7 Å²	82.7	41%	0.412	44%	0.444	S	S	.	.	P	Polyproline II helix	trans	-63	141.9	179.1	-52.7	-49.9	0	0	0	111.2	I97 D99 C100	N91-I97 HydrophobicContact CB-CB 4.37Å; N91-I97 HydrophobicContact CB-CD1 4.17Å; N91-I97 HydrophobicContact CB-CG2 3.92Å; N91-D99 WeakPolarHBondContact CB-O 3.5Å; N91-D99 PolarHBondContact ND2-O 3.37Å; N91-C100 WeakPolarHBondContact O-CB 3.37Å
92	S	91.2	Very high	91.7	Very high	108 Å²	108	79.9 Å²	79.9	76%	0.755	42%	0.417	S	S	*	.	P	Polyproline II helix	trans	-76.1	151.9	165.6	-64.5	0	0	0	0	110.6
93	C	87.1	Confident	91.7	Very high	79 Å²	79	77.1 Å²	77.1	53%	0.534	40%	0.402	S	S	.	.	S	Bend	trans	-67.1	160.9	179.1	-65.7	0	0	0	0	113	Q95 C100	C93-Q95 PolarHBondContact O-N 2.92Å; C93-Q95 VanDerWaalsContact O-N 3.12Å; C93-C100 VanDerWaalsContact CA-CB 3.45Å; C93-C100 WeakPolarHBondContact CA-SG 3.4Å; C93-C100 HydrophobicContact CB-CB 3.84Å; C93-C100 WeakPolarHBondContact CB-SG 3.27Å; C93-C100 WeakPolarHBondContact SG-CB 3.35Å; C93-C100 CovalentContact SG-SG 2.05Å; C93-C100 PolarHBondContact SG-SG 3.29Å
94	C	80.9	Confident	91.7	Very high	86 Å²	86	76.9 Å²	76.9	58%	0.581	40%	0.401	S	S	*	.	S	Bend	trans	-36	108	-163.7	-72.1	0	0	0	0	116.6	I97	C94-I97 PolarHBondContact SG-O 3.3Å; C94-I97 VanDerWaalsContact SG-O 3.4Å
95	Q	67.4	Low	91.8	Very high	179 Å²	179	75.3 Å²	75.3	84%	0.836	40%	0.401	S	S	*	.	S	Bend		-96.5	-27.1	109.6	-165	170.5	-37.1	0	0	112.9	C93	C93-Q95 PolarHBondContact O-N 2.92Å; C93-Q95 VanDerWaalsContact O-N 3.12Å
96	N	75	Confident	91.7	Very high	147 Å²	147	77.6 Å²	77.6	79%	0.786	40%	0.404	S	S	*	.	S	Bend	trans	-146	-8	-177.8	-69.2	-53.6	0	0	0	117.4
97	I	86.1	Confident	91.6	Very high	74 Å²	74	80.3 Å²	80.3	38%	0.379	42%	0.418	S	S	.	.			trans	-135.3	129.3	-170.8	-63	162.2	0	0	0	110.7	N91 C94 D99	N91-I97 HydrophobicContact CB-CB 4.37Å; N91-I97 HydrophobicContact CB-CD1 4.17Å; N91-I97 HydrophobicContact CB-CG2 3.92Å; C94-I97 PolarHBondContact SG-O 3.3Å; C94-I97 VanDerWaalsContact SG-O 3.4Å; I97-D99 HydrophobicContact CG2-CB 4.32Å
98	E	90.9	Very high	91.4	Very high	58 Å²	58	82.3 Å²	82.3	27%	0.271	43%	0.431	S	S	.	.	S	Bend	trans	-89.6	-22.6	179.7	-61.5	-163.3	138.2	0	0	113.4	P65 L66 R70 C100	P65-E98 WeakPolarHBondContact CD-O 3.35Å; P65-E98 WeakPolarHBondContact CG-O 3.34Å; L66-E98 HydrophobicContact CD2-CB 3.73Å; R70-E98 IonicContact CZ-OE1 3.03Å; R70-E98 IonicContact NE-OE1 2.67Å; R70-E98 PolarHBondContact NE-OE1 3.37Å; R70-E98 IonicContact NE-OE2 3.59Å; R70-E98 IonicContact NH2-OE1 2.86Å; R70-E98 PolarHBondContact NH2-OE1 3.45Å; E98-C100 PolarHBondContact O-N 3.47Å; E98-C100 VanDerWaalsContact O-N 3.07Å
99	D	93.8	Very high	90.9	Very high	44 Å²	44	76.3 Å²	76.3	24%	0.235	41%	0.411	C	S	.	.			trans	-80.5	83.7	173	-175.1	10.4	0	0	0	110.6	P64 L66 N91 I97 Y102	P64-D99 HydrophobicContact CB-CB 4.37Å; P64-D99 WeakPolarHBondContact CB-OD1 3.35Å; L66-D99 HydrophobicContact CD1-CB 4.38Å; L66-D99 HydrophobicContact CD2-CB 4.37Å; N91-D99 WeakPolarHBondContact CB-O 3.5Å; N91-D99 PolarHBondContact ND2-O 3.37Å; I97-D99 HydrophobicContact CG2-CB 4.32Å; D99-Y102 VanDerWaalsContact CG-OH 3.29Å; D99-Y102 WeakPolarHBondContact OD1-CE2 3.33Å; D99-Y102 PolarHBondContact OD1-OH 2.94Å; D99-Y102 PolarHBondContact OD2-OH 3.06Å
100	C	94.2	Very high	90.2	Very high	15 Å²	15	75 Å²	75	10%	0.101	42%	0.421	C	S	.	.			trans	-138.8	6.3	-171.7	68.6	0	0	0	0	114.7	N91 C93 E98 Y102	N91-C100 WeakPolarHBondContact O-CB 3.37Å; C93-C100 VanDerWaalsContact CA-CB 3.45Å; C93-C100 WeakPolarHBondContact CA-SG 3.4Å; C93-C100 HydrophobicContact CB-CB 3.84Å; C93-C100 WeakPolarHBondContact CB-SG 3.27Å; C93-C100 WeakPolarHBondContact SG-CB 3.35Å; C93-C100 CovalentContact SG-SG 2.05Å; C93-C100 PolarHBondContact SG-SG 3.29Å; E98-C100 PolarHBondContact O-N 3.47Å; E98-C100 VanDerWaalsContact O-N 3.07Å; C100-Y102 VanDerWaalsContact C-CD2 3.44Å; C100-Y102 VanDerWaalsContact C-N 3.3Å; C100-Y102 PolarHBondContact O-N 3.4Å
101	L	95.4	Very high	89.3	Confident	30 Å²	30	81.7 Å²	81.7	16%	0.157	44%	0.443	C	S	.	.			trans	-85.6	71	-174.4	-56.3	-174.3	0	0	0	111.7	Y61 V62 P65	Y61-L101 VanDerWaalsContact CD1-O 3.28Å; Y61-L101 WeakPolarHBondContact CD1-O 3.25Å; Y61-L101 HydrophobicContact CE1-CB 3.97Å; Y61-L101 WeakPolarHBondContact CE1-O 3.47Å; V62-L101 HydrophobicContact CG2-CB 3.59Å; V62-L101 HydrophobicContact CG2-CD1 3.45Å; V62-L101 VanDerWaalsContact CG2-CD1 3.45Å; V62-L101 HydrophobicContact CG2-CG 4.15Å; P65-L101 HydrophobicContact CB-CD1 4.4Å; P65-L101 HydrophobicContact CG-CD1 3.95Å; P65-L101 HydrophobicContact CG-CG 4.27Å
102	Y	96.9	Very high	88.5	Confident	54 Å²	54	82.1 Å²	82.1	21%	0.212	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	156.1	-179.9	-56.2	-95.1	0	0	0	111.3	G58 I59 P60 W84 A90 D99 C100	G58-Y102 WeakPolarHBondContact O-CD1 3.41Å; I59-Y102 CarbonylContact O-C 3.56Å; I59-Y102 VanDerWaalsContact O-CA 3.28Å; I59-Y102 WeakPolarHBondContact O-CA 3.49Å; P60-Y102 HydrophobicContact CB-CD1 3.86Å; P60-Y102 HydrophobicContact CB-CE1 3.73Å; P60-Y102 HydrophobicContact CG-CE1 4.4Å; W84-Y102 HydrophobicContact CH2-CE1 4.49Å; W84-Y102 HydrophobicContact CZ2-CE1 4.01Å; A90-Y102 HydrophobicContact CB-CD1 3.86Å; A90-Y102 HydrophobicContact CB-CD2 3.34Å; A90-Y102 HydrophobicContact CB-CE1 4.41Å; A90-Y102 HydrophobicContact CB-CE2 3.99Å; A90-Y102 HydrophobicContact CB-CG 3.3Å; D99-Y102 VanDerWaalsContact CG-OH 3.29Å; D99-Y102 WeakPolarHBondContact OD1-CE2 3.33Å; D99-Y102 PolarHBondContact OD1-OH 2.94Å; D99-Y102 PolarHBondContact OD2-OH 3.06Å; C100-Y102 VanDerWaalsContact C-CD2 3.44Å; C100-Y102 VanDerWaalsContact C-N 3.3Å; C100-Y102 PolarHBondContact O-N 3.4Å
103	L	97.1	Very high	87.3	Confident	68 Å²	68	90.4 Å²	90.4	36%	0.356	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	161.2	174.2	65.9	80	0	0	0	111.6	G58 I59 Y61 V105	G58-L103 PolarHBondContact N-O 3.03Å; I59-L103 HydrophobicContact CB-CD1 3.99Å; I59-L103 HydrophobicContact CB-CG 4.31Å; I59-L103 HydrophobicContact CD1-CD1 4.03Å; I59-L103 PolarHBondContact N-O 3.45Å; I59-L103 PolarHBondContact O-N 3.3Å; Y61-L103 HydrophobicContact CD1-CB 4.39Å; Y61-L103 HydrophobicContact CD1-CD2 4.36Å; Y61-L103 HydrophobicContact CG-CD2 4.38Å; L103-V105 HydrophobicContact CD1-CG2 3.47Å; L103-V105 VanDerWaalsContact CD1-CG2 3.47Å
104	N	98.1	Very high	87.3	Confident	57 Å²	57	91 Å²	91	31%	0.305	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.4	143	175	-54.7	-50.8	0	0	0	108.8	F56 L57 G58 W106	F56-N104 CarbonylContact O-C 3.58Å; F56-N104 VanDerWaalsContact O-CA 3.26Å; F56-N104 WeakPolarHBondContact O-CA 3.5Å; L57-N104 VanDerWaalsContact CA-OD1 3.26Å; L57-N104 WeakPolarHBondContact CA-OD1 3.28Å; L57-N104 HydrophobicContact CD2-CB 3.95Å; G58-N104 PolarHBondContact N-OD1 3.04Å; N104-W106 HydrophobicContact CB-CE3 4.3Å; N104-W106 HydrophobicContact CB-CH2 3.16Å; N104-W106 HydrophobicContact CB-CZ2 3.77Å; N104-W106 HydrophobicContact CB-CZ3 3.45Å; N104-W106 VanDerWaalsContact CB-CZ3 3.45Å
105	V	97.6	Very high	87.6	Confident	57 Å²	57	91.3 Å²	91.3	35%	0.345	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.4	134.6	-179.4	-175.3	0	0	0	0	109.2	A55 F56 I59 L103 I107	A55-V105 CarbonylContact C-O 3.53Å; A55-V105 WeakPolarHBondContact CA-O 3.35Å; F56-V105 HydrophobicContact CB-CB 4.39Å; F56-V105 PolarHBondContact N-O 3.41Å; F56-V105 PolarHBondContact O-N 3.48Å; I59-V105 HydrophobicContact CD1-CG2 4.34Å; L103-V105 HydrophobicContact CD1-CG2 3.47Å; L103-V105 VanDerWaalsContact CD1-CG2 3.47Å; V105-I107 HydrophobicContact CG1-CG1 4.16Å
106	W	96.4	Very high	88.7	Confident	126 Å²	126	86.4 Å²	86.4	48%	0.477	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	129.6	174.7	-63	-97.3	0	0	0	109.7	T54 L57 Y89 N104	T54-W106 WeakPolarHBondContact O-CA 3.2Å; L57-W106 HydrophobicContact CD2-CZ2 3.8Å; Y89-W106 HydrophobicContact CE1-CZ2 4.19Å; N104-W106 HydrophobicContact CB-CE3 4.3Å; N104-W106 HydrophobicContact CB-CH2 3.16Å; N104-W106 HydrophobicContact CB-CZ2 3.77Å; N104-W106 HydrophobicContact CB-CZ3 3.45Å; N104-W106 VanDerWaalsContact CB-CZ3 3.45Å
107	I	94.8	Very high	89.5	Confident	57 Å²	57	82.8 Å²	82.8	29%	0.292	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	126.8	-178	-50.1	179.6	0	0	0	107.4	I34 V53 T54 F56 V105 A109	I34-I107 HydrophobicContact CD1-CD1 4.48Å; V53-I107 CarbonylContact C-O 3.54Å; V53-I107 WeakPolarHBondContact CA-O 3.19Å; T54-I107 PolarHBondContact N-O 3.28Å; T54-I107 PolarHBondContact O-N 3.12Å; F56-I107 HydrophobicContact CD2-CD1 4.36Å; F56-I107 HydrophobicContact CE2-CD1 3.8Å; F56-I107 HydrophobicContact CE2-CG1 4.47Å; V105-I107 HydrophobicContact CG1-CG1 4.16Å; I107-A109 PolarHBondContact O-N 3.37Å
108	P	93.1	Very high	89.8	Confident	73 Å²	73	83.4 Å²	83.4	47%	0.474	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-59	138.4	172	-20.9	31.7	0	0	0	111.2	P110 K111 P112	P108-P110 CarbonylContact C-O 3.52Å; P108-P110 CarbonylContact O-C 3.29Å; P108-K111 PolarHBondContact O-N 3.47Å; P108-P112 HydrophobicContact CG-CG 4.47Å
109	A	87.8	Confident	89.7	Confident	29 Å²	29	85.1 Å²	85.1	24%	0.24	44%	0.436	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.3	120.9	175.7	0	0	0	0	0	110	T52 I107	T52-A109 HydrophobicContact CG2-CB 3.92Å; T52-A109 WeakPolarHBondContact O-CB 3.35Å; T52-A109 PolarHBondContact O-N 3.24Å; T52-A109 VanDerWaalsContact O-O 3.09Å; I107-A109 PolarHBondContact O-N 3.37Å
110	P	82.1	Confident	89.4	Confident	122 Å²	122	88 Å²	88	79%	0.792	45%	0.45	S	S	*	.	S	Bend	cis	-71.2	156.2	3.3	30.8	-35.1	0	0	0	112.5	P108	P108-P110 CarbonylContact C-O 3.52Å; P108-P110 CarbonylContact O-C 3.29Å
111	K	76	Confident	89	Confident	176 Å²	176	93.6 Å²	93.6	77%	0.765	48%	0.477	S	S	*	.	P	Polyproline II helix	trans	-55.4	131.3	178.4	-169.6	180	179.2	-177.5	0	109.6	P108	P108-K111 PolarHBondContact O-N 3.47Å
112	P	75.9	Confident	88.5	Confident	85 Å²	85	98.9 Å²	98.9	55%	0.552	50%	0.503	S	S	*	.	P	Polyproline II helix	trans	-59.5	144.4	175.6	5.2	-3.8	0	0	0	110.2	P108	P108-P112 HydrophobicContact CG-CG 4.47Å
113	K	66.1	Low	87.7	Confident	283 Å²	283	103 Å²	103	100%	1.23	53%	0.53	S	S	*	.			trans	-68.6	0	175.1	-73.5	-174.8	178.2	179.9	0	111.4

Retrieved 113 of 113 residues in 101 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).