A0A024DAT2_HUMAN Loading...

Integrin beta-2

AlphaFold DB , UniProt , Accession A0A024DAT2, Species HUMAN (Homo sapiens, Human), Gene ITGB2, Length 75 aa.

						>A0A024DAT2_HUMAN|A0A024DAT2|ITGB2
CVAGPNIAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	C	59.1	Low	87.4	Confident	189 Å²	189	104.5 Å²	104.5	100%	1.277	69%	0.694	S	S	*	*				0	139.2	0	-55.7	0	0	0	0	108.9
2	V	77.6	Confident	88.3	Confident	145 Å²	145	99.1 Å²	99.1	88%	0.879	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-77.3	132.2	178	168.2	0	0	0	0	109.2
3	A	82.2	Confident	89	Confident	92 Å²	92	95.2 Å²	95.2	76%	0.76	66%	0.657	S	S	*	*	P	Polyproline II helix	trans	-65.5	137	173.4	0	0	0	0	0	110
4	G	85.2	Confident	89.6	Confident	63 Å²	63	94.1 Å²	94.1	65%	0.649	65%	0.645	S	S	*	*	P	Polyproline II helix	trans	-62	159.3	177.8	0	0	0	0	0	112.5
5	P	88.4	Confident	90.2	Very high	102 Å²	102	93.3 Å²	93.3	66%	0.662	64%	0.635	S	S	*	*	P	Polyproline II helix	trans	-61.2	143.5	-179.6	25.7	-33.7	0	0	0	111.3	I7	P5-I7 PolarHBondContact O-N 3.02Å
6	N	91.9	Very high	90.7	Very high	116 Å²	116	90.6 Å²	90.6	62%	0.62	62%	0.621	S	S	*	*			trans	-80.4	87.2	178.5	-161.9	-32.4	0	0	0	110.5	A8 A9 I10	N6-A8 VanDerWaalsContact C-N 3.26Å; N6-A8 PolarHBondContact O-N 3.23Å; N6-A9 HydrophobicContact CB-CB 4.39Å; N6-A9 PolarHBondContact O-N 3.29Å; N6-I10 PolarHBondContact O-N 3.03Å
7	I	94.3	Very high	91.2	Very high	118 Å²	118	87 Å²	87	61%	0.605	60%	0.603	S	S	*	*	H	α-helix	trans	-59.4	-37.6	-174.9	-61.4	157.3	0	0	0	111.4	P5 A9 I10 V11	P5-I7 PolarHBondContact O-N 3.02Å; I7-A9 VanDerWaalsContact C-N 3.31Å; I7-A9 PolarHBondContact O-N 3.06Å; I7-I10 PolarHBondContact O-N 3.44Å; I7-V11 HydrophobicContact CG2-CG2 4.09Å; I7-V11 WeakPolarHBondContact O-CG2 3.44Å; I7-V11 PolarHBondContact O-N 3.14Å
8	A	94.4	Very high	91.6	Very high	75 Å²	75	88.6 Å²	88.6	62%	0.62	60%	0.602	S	S	*	*	H	α-helix	trans	-61.3	-39.8	-179.2	0	0	0	0	0	112.1	N6 G12	N6-A8 VanDerWaalsContact C-N 3.26Å; N6-A8 PolarHBondContact O-N 3.23Å; A8-G12 PolarHBondContact O-N 3.02Å
9	A	95.5	Very high	91.9	Very high	65 Å²	65	88.1 Å²	88.1	54%	0.537	60%	0.596	S	S	.	*	H	α-helix	trans	-66.8	-40.9	177.6	0	0	0	0	0	112.1	N6 I7 G13	N6-A9 HydrophobicContact CB-CB 4.39Å; N6-A9 PolarHBondContact O-N 3.29Å; I7-A9 VanDerWaalsContact C-N 3.31Å; I7-A9 PolarHBondContact O-N 3.06Å; A9-G13 PolarHBondContact O-N 3.15Å
10	I	95.9	Very high	92.3	Very high	103 Å²	103	89.6 Å²	89.6	53%	0.528	60%	0.597	S	S	.	*	H	α-helix	trans	-64.7	-53.2	179.5	-62.1	169.3	0	0	0	109.8	N6 I7 G12 G13 T14	N6-I10 PolarHBondContact O-N 3.03Å; I7-I10 PolarHBondContact O-N 3.44Å; I10-G12 PolarHBondContact O-N 3.43Å; I10-G13 PolarHBondContact O-N 2.82Å; I10-T14 PolarHBondContact O-N 3.21Å; I10-T14 PolarHBondContact O-OG1 2.86Å
11	V	97.5	Very high	92.5	Very high	81 Å²	81	90.4 Å²	90.4	49%	0.491	60%	0.595	S	S	.	*	H	α-helix	trans	-62.3	-45.2	-179.3	176.9	0	0	0	0	110.8	I7 G13 T14 V15	I7-V11 HydrophobicContact CG2-CG2 4.09Å; I7-V11 WeakPolarHBondContact O-CG2 3.44Å; I7-V11 PolarHBondContact O-N 3.14Å; V11-G13 PolarHBondContact O-N 3.05Å; V11-T14 PolarHBondContact O-N 3.4Å; V11-V15 HydrophobicContact CG1-CG2 4.33Å; V11-V15 WeakPolarHBondContact O-CG2 3.27Å; V11-V15 PolarHBondContact O-N 3.05Å
12	G	97.8	Very high	94.4	Very high	40 Å²	40	83 Å²	83	41%	0.412	55%	0.55	S	S	.	.	H	α-helix	trans	-59.6	-44.8	177.7	0	0	0	0	0	112.4	A8 I10 A16	A8-G12 PolarHBondContact O-N 3.02Å; I10-G12 PolarHBondContact O-N 3.43Å; G12-A16 VanDerWaalsContact O-CB 3.28Å; G12-A16 WeakPolarHBondContact O-CB 3.4Å; G12-A16 PolarHBondContact O-N 3.05Å
13	G	97.6	Very high	95.4	Very high	48 Å²	48	80.3 Å²	80.3	50%	0.495	53%	0.53	S	S	.	.	H	α-helix	trans	-62.4	-44.4	176.7	0	0	0	0	0	112.8	A9 I10 V11 G17	A9-G13 PolarHBondContact O-N 3.15Å; I10-G13 PolarHBondContact O-N 2.82Å; V11-G13 PolarHBondContact O-N 3.05Å; G13-G17 PolarHBondContact O-N 3.16Å
14	T	97.8	Very high	96.2	Very high	80 Å²	80	80.9 Å²	80.9	49%	0.491	52%	0.519	S	S	.	.	H	α-helix	trans	-64.5	-46.6	179	-50.7	0	0	0	0	111.9	I10 V11 G17 I18	I10-T14 PolarHBondContact O-N 3.21Å; I10-T14 PolarHBondContact O-OG1 2.86Å; V11-T14 PolarHBondContact O-N 3.4Å; T14-G17 PolarHBondContact O-N 2.97Å; T14-I18 HydrophobicContact CG2-CD1 4.11Å; T14-I18 WeakPolarHBondContact O-CG1 3.2Å; T14-I18 PolarHBondContact O-N 2.94Å
15	V	98.3	Very high	96.8	Very high	82 Å²	82	83.1 Å²	83.1	50%	0.497	52%	0.516	S	S	.	.	H	α-helix	trans	-63.1	-46.5	179.4	174	0	0	0	0	110.7	V11 G17 I18 V19	V11-V15 HydrophobicContact CG1-CG2 4.33Å; V11-V15 WeakPolarHBondContact O-CG2 3.27Å; V11-V15 PolarHBondContact O-N 3.05Å; V15-G17 VanDerWaalsContact C-N 3.3Å; V15-G17 PolarHBondContact O-N 2.67Å; V15-I18 PolarHBondContact O-N 3.5Å; V15-V19 HydrophobicContact CG1-CG2 4.39Å; V15-V19 VanDerWaalsContact O-CG2 3.3Å; V15-V19 WeakPolarHBondContact O-CG2 3.45Å; V15-V19 PolarHBondContact O-N 3.14Å
16	A	98.2	Very high	97.3	Very high	50 Å²	50	83.2 Å²	83.2	41%	0.413	51%	0.51	S	S	.	.	H	α-helix	trans	-59.5	-41.8	177	0	0	0	0	0	111.9	G12 V19 L20	G12-A16 VanDerWaalsContact O-CB 3.28Å; G12-A16 WeakPolarHBondContact O-CB 3.4Å; G12-A16 PolarHBondContact O-N 3.05Å; A16-V19 PolarHBondContact O-N 2.76Å; A16-L20 WeakPolarHBondContact O-CB 3.34Å; A16-L20 VanDerWaalsContact O-CG 3.3Å; A16-L20 WeakPolarHBondContact O-CG 3.07Å; A16-L20 PolarHBondContact O-N 3.4Å
17	G	98.2	Very high	97.6	Very high	30 Å²	30	82 Å²	82	31%	0.309	51%	0.507	S	S	.	.	H	α-helix	trans	-59.7	-48.1	176.5	0	0	0	0	0	112.9	G13 T14 V15 V19 L20 I21	G13-G17 PolarHBondContact O-N 3.16Å; T14-G17 PolarHBondContact O-N 2.97Å; V15-G17 VanDerWaalsContact C-N 3.3Å; V15-G17 PolarHBondContact O-N 2.67Å; G17-V19 PolarHBondContact O-N 3.06Å; G17-L20 PolarHBondContact O-N 2.74Å; G17-I21 VanDerWaalsContact O-CG1 3.31Å; G17-I21 WeakPolarHBondContact O-CG1 3.41Å; G17-I21 PolarHBondContact O-N 3.48Å
18	I	98.4	Very high	97.7	Very high	115 Å²	115	80.6 Å²	80.6	59%	0.59	50%	0.5	S	S	*	.	H	α-helix	trans	-63	-44.1	179.1	-65	165.8	0	0	0	110.8	T14 V15 L20 I21 G22	T14-I18 HydrophobicContact CG2-CD1 4.11Å; T14-I18 WeakPolarHBondContact O-CG1 3.2Å; T14-I18 PolarHBondContact O-N 2.94Å; V15-I18 PolarHBondContact O-N 3.5Å; I18-L20 PolarHBondContact O-N 3.24Å; I18-I21 PolarHBondContact O-N 3.47Å; I18-G22 PolarHBondContact O-N 3.17Å
19	V	98.5	Very high	97.9	Very high	80 Å²	80	84.9 Å²	84.9	49%	0.485	50%	0.5	S	S	.	.	H	α-helix	trans	-61.5	-44.8	178.6	171.6	0	0	0	0	111	V15 A16 G17 I21 G22 I23	V15-V19 HydrophobicContact CG1-CG2 4.39Å; V15-V19 VanDerWaalsContact O-CG2 3.3Å; V15-V19 WeakPolarHBondContact O-CG2 3.45Å; V15-V19 PolarHBondContact O-N 3.14Å; A16-V19 PolarHBondContact O-N 2.76Å; G17-V19 PolarHBondContact O-N 3.06Å; V19-I21 PolarHBondContact O-N 2.91Å; V19-G22 PolarHBondContact O-N 3.36Å; V19-I23 HydrophobicContact CG1-CD1 3.77Å; V19-I23 HydrophobicContact CG1-CG1 4.4Å; V19-I23 VanDerWaalsContact O-CG1 3.3Å; V19-I23 WeakPolarHBondContact O-CG1 3.34Å; V19-I23 PolarHBondContact O-N 3.24Å
20	L	98.4	Very high	98	Very high	117 Å²	117	89.4 Å²	89.4	61%	0.613	51%	0.507	S	S	*	.	H	α-helix	trans	-62.2	-42.6	178	-75	173.7	0	0	0	112.2	A16 G17 I18 I23 L24	A16-L20 WeakPolarHBondContact O-CB 3.34Å; A16-L20 VanDerWaalsContact O-CG 3.3Å; A16-L20 WeakPolarHBondContact O-CG 3.07Å; A16-L20 PolarHBondContact O-N 3.4Å; G17-L20 PolarHBondContact O-N 2.74Å; I18-L20 PolarHBondContact O-N 3.24Å; L20-I23 PolarHBondContact O-N 3.13Å; L20-L24 WeakPolarHBondContact O-CB 3.49Å; L20-L24 PolarHBondContact O-N 3.35Å
21	I	98.3	Very high	98.1	Very high	108 Å²	108	86.7 Å²	86.7	55%	0.554	50%	0.501	S	S	*	.	H	α-helix	trans	-63.2	-44.5	176.1	-66.5	165.4	0	0	0	110.5	G17 I18 V19 I23 L24 L25	G17-I21 VanDerWaalsContact O-CG1 3.31Å; G17-I21 WeakPolarHBondContact O-CG1 3.41Å; G17-I21 PolarHBondContact O-N 3.48Å; I18-I21 PolarHBondContact O-N 3.47Å; V19-I21 PolarHBondContact O-N 2.91Å; I21-I23 PolarHBondContact O-N 3.46Å; I21-L24 PolarHBondContact O-N 3.21Å; I21-L25 HydrophobicContact CG2-CD1 4.15Å; I21-L25 WeakPolarHBondContact O-CG 3.49Å; I21-L25 PolarHBondContact O-N 3.1Å
22	G	98.3	Very high	98.1	Very high	32 Å²	32	88.1 Å²	88.1	33%	0.33	51%	0.505	S	S	.	.	H	α-helix	trans	-59.1	-46.4	176.7	0	0	0	0	0	112.4	I18 V19 L24 L25 L26	I18-G22 PolarHBondContact O-N 3.17Å; V19-G22 PolarHBondContact O-N 3.36Å; G22-L24 VanDerWaalsContact C-N 3.34Å; G22-L24 PolarHBondContact O-N 3.47Å; G22-L25 PolarHBondContact O-N 3.32Å; G22-L26 VanDerWaalsContact O-CG 3.31Å; G22-L26 WeakPolarHBondContact O-CG 3.37Å; G22-L26 PolarHBondContact O-N 3.36Å
23	I	98.5	Very high	98.1	Very high	90 Å²	90	90.3 Å²	90.3	46%	0.462	51%	0.506	S	S	.	.	H	α-helix	trans	-61	-45.1	176.1	-68.5	168.1	0	0	0	110.6	V19 L20 I21 L25 L26 V27	V19-I23 HydrophobicContact CG1-CD1 3.77Å; V19-I23 HydrophobicContact CG1-CG1 4.4Å; V19-I23 VanDerWaalsContact O-CG1 3.3Å; V19-I23 WeakPolarHBondContact O-CG1 3.34Å; V19-I23 PolarHBondContact O-N 3.24Å; L20-I23 PolarHBondContact O-N 3.13Å; I21-I23 PolarHBondContact O-N 3.46Å; I23-L25 PolarHBondContact O-N 2.77Å; I23-L26 PolarHBondContact O-N 3.19Å; I23-V27 HydrophobicContact CG2-CG2 4.27Å; I23-V27 WeakPolarHBondContact O-CG2 3.27Å; I23-V27 PolarHBondContact O-N 3Å
24	L	98.3	Very high	98	Very high	104 Å²	104	93.1 Å²	93.1	55%	0.545	51%	0.506	S	S	.	.	H	α-helix	trans	-60.7	-44.4	-179.7	-172.7	147.6	0	0	0	111.5	L20 I21 G22 V27 I28	L20-L24 WeakPolarHBondContact O-CB 3.49Å; L20-L24 PolarHBondContact O-N 3.35Å; I21-L24 PolarHBondContact O-N 3.21Å; G22-L24 VanDerWaalsContact C-N 3.34Å; G22-L24 PolarHBondContact O-N 3.47Å; L24-V27 PolarHBondContact O-N 2.82Å; L24-I28 HydrophobicContact CD2-CD1 3.53Å; L24-I28 HydrophobicContact CD2-CG1 4.43Å; L24-I28 HydrophobicContact CG-CD1 4.45Å; L24-I28 WeakPolarHBondContact O-CG1 3.29Å; L24-I28 PolarHBondContact O-N 3.33Å
25	L	98.4	Very high	97.9	Very high	109 Å²	109	94.4 Å²	94.4	57%	0.571	51%	0.51	S	S	*	.	H	α-helix	trans	-62.4	-43	175.2	-71.5	172.6	0	0	0	112.2	I21 G22 I23 V27 I28 W29	I21-L25 HydrophobicContact CG2-CD1 4.15Å; I21-L25 WeakPolarHBondContact O-CG 3.49Å; I21-L25 PolarHBondContact O-N 3.1Å; G22-L25 PolarHBondContact O-N 3.32Å; I23-L25 PolarHBondContact O-N 2.77Å; L25-V27 PolarHBondContact O-N 2.98Å; L25-I28 PolarHBondContact O-N 3.07Å; L25-W29 WeakPolarHBondContact O-CB 3.4Å; L25-W29 PolarHBondContact O-N 3.25Å
26	L	98.3	Very high	97.8	Very high	104 Å²	104	93.5 Å²	93.5	55%	0.545	51%	0.507	S	S	.	.	H	α-helix	trans	-63.4	-40.4	177	-71.6	175.4	0	0	0	112.2	G22 I23 W29 K30	G22-L26 VanDerWaalsContact O-CG 3.31Å; G22-L26 WeakPolarHBondContact O-CG 3.37Å; G22-L26 PolarHBondContact O-N 3.36Å; I23-L26 PolarHBondContact O-N 3.19Å; L26-W29 HydrophobicContact CD2-CE3 4.08Å; L26-W29 HydrophobicContact CD2-CZ3 4.39Å; L26-W29 PolarHBondContact O-N 3.24Å; L26-K30 VanDerWaalsContact O-CB 3.27Å; L26-K30 WeakPolarHBondContact O-CB 3.37Å; L26-K30 PolarHBondContact O-N 3.12Å
27	V	98.2	Very high	97.7	Very high	91 Å²	91	96.1 Å²	96.1	55%	0.552	51%	0.514	S	S	*	.	H	α-helix	trans	-64.5	-45.8	177.1	170.5	0	0	0	0	110.7	I23 L24 L25 K30 A31	I23-V27 HydrophobicContact CG2-CG2 4.27Å; I23-V27 WeakPolarHBondContact O-CG2 3.27Å; I23-V27 PolarHBondContact O-N 3Å; L24-V27 PolarHBondContact O-N 2.82Å; L25-V27 PolarHBondContact O-N 2.98Å; V27-K30 PolarHBondContact O-N 2.85Å; V27-A31 VanDerWaalsContact O-CB 3.29Å; V27-A31 WeakPolarHBondContact O-CB 3.46Å; V27-A31 PolarHBondContact O-N 2.83Å
28	I	98.1	Very high	97.6	Very high	89 Å²	89	97.4 Å²	97.4	46%	0.456	51%	0.513	S	S	.	.	H	α-helix	trans	-59.9	-49.4	176.3	-68.7	171.6	0	0	0	110.1	L24 L25 K30 A31 L32	L24-I28 HydrophobicContact CD2-CD1 3.53Å; L24-I28 HydrophobicContact CD2-CG1 4.43Å; L24-I28 HydrophobicContact CG-CD1 4.45Å; L24-I28 WeakPolarHBondContact O-CG1 3.29Å; L24-I28 PolarHBondContact O-N 3.33Å; L25-I28 PolarHBondContact O-N 3.07Å; I28-K30 PolarHBondContact O-N 3.23Å; I28-A31 PolarHBondContact O-N 3.33Å; I28-L32 HydrophobicContact CG2-CD1 4.12Å; I28-L32 HydrophobicContact CG2-CG 4.43Å; I28-L32 WeakPolarHBondContact O-CG 3.46Å; I28-L32 PolarHBondContact O-N 2.96Å
29	W	98.1	Very high	97.4	Very high	164 Å²	164	101 Å²	101	62%	0.621	52%	0.52	S	S	*	.	H	α-helix	trans	-60.2	-45.6	-180	-179	35.1	0	0	0	112.1	L25 L26 A31 L32 I33	L25-W29 WeakPolarHBondContact O-CB 3.4Å; L25-W29 PolarHBondContact O-N 3.25Å; L26-W29 HydrophobicContact CD2-CE3 4.08Å; L26-W29 HydrophobicContact CD2-CZ3 4.39Å; L26-W29 PolarHBondContact O-N 3.24Å; W29-A31 VanDerWaalsContact C-N 3.34Å; W29-A31 PolarHBondContact O-N 3.39Å; W29-L32 PolarHBondContact O-N 3.42Å; W29-I33 HydrophobicContact CD2-CD1 4.07Å; W29-I33 HydrophobicContact CG-CD1 4.12Å; W29-I33 HydrophobicContact CZ2-CD1 4.03Å; W29-I33 WeakPolarHBondContact O-CG1 3.26Å; W29-I33 PolarHBondContact O-N 3.13Å
30	K	97.6	Very high	97.3	Very high	160 Å²	160	103.9 Å²	103.9	70%	0.696	53%	0.527	S	S	*	.	H	α-helix	trans	-63.9	-38.6	177.2	-173.2	165.2	177.4	74.4	0	112.1	L26 V27 I28 H34	L26-K30 VanDerWaalsContact O-CB 3.27Å; L26-K30 WeakPolarHBondContact O-CB 3.37Å; L26-K30 PolarHBondContact O-N 3.12Å; V27-K30 PolarHBondContact O-N 2.85Å; I28-K30 PolarHBondContact O-N 3.23Å; K30-H34 WeakPolarHBondContact O-CB 3.46Å; K30-H34 PolarHBondContact O-N 2.93Å
31	A	97.5	Very high	97.1	Very high	47 Å²	47	104.5 Å²	104.5	39%	0.388	52%	0.523	S	S	.	.	H	α-helix	trans	-64.3	-43.7	175.6	0	0	0	0	0	111.6	V27 I28 W29 H34 L35	V27-A31 VanDerWaalsContact O-CB 3.29Å; V27-A31 WeakPolarHBondContact O-CB 3.46Å; V27-A31 PolarHBondContact O-N 2.83Å; I28-A31 PolarHBondContact O-N 3.33Å; W29-A31 VanDerWaalsContact C-N 3.34Å; W29-A31 PolarHBondContact O-N 3.39Å; A31-H34 PolarHBondContact O-N 2.93Å; A31-L35 WeakPolarHBondContact O-CB 3.45Å; A31-L35 VanDerWaalsContact O-CG 3.26Å; A31-L35 WeakPolarHBondContact O-CG 3.32Å; A31-L35 PolarHBondContact O-N 3.03Å
32	L	97.4	Very high	96.9	Very high	111 Å²	111	107.1 Å²	107.1	58%	0.581	53%	0.525	S	S	*	.	H	α-helix	trans	-59.5	-49.2	176.3	-69.8	174	0	0	0	111.5	I28 W29 H34 L35 S36	I28-L32 HydrophobicContact CG2-CD1 4.12Å; I28-L32 HydrophobicContact CG2-CG 4.43Å; I28-L32 WeakPolarHBondContact O-CG 3.46Å; I28-L32 PolarHBondContact O-N 2.96Å; W29-L32 PolarHBondContact O-N 3.42Å; L32-H34 PolarHBondContact O-N 3.47Å; L32-L35 PolarHBondContact O-N 3.4Å; L32-S36 PolarHBondContact O-N 3.29Å; L32-S36 PolarHBondContact O-OG 3.22Å
33	I	96.8	Very high	96.6	Very high	85 Å²	85	113 Å²	113	44%	0.436	54%	0.538	S	S	.	.	H	α-helix	trans	-60.8	-46	178	-65.5	162.4	0	0	0	110.7	W29 L35 S36 D37	W29-I33 HydrophobicContact CD2-CD1 4.07Å; W29-I33 HydrophobicContact CG-CD1 4.12Å; W29-I33 HydrophobicContact CZ2-CD1 4.03Å; W29-I33 WeakPolarHBondContact O-CG1 3.26Å; W29-I33 PolarHBondContact O-N 3.13Å; I33-L35 VanDerWaalsContact C-N 3.32Å; I33-L35 PolarHBondContact O-N 2.86Å; I33-S36 WeakPolarHBondContact CA-OG 3.21Å; I33-S36 PolarHBondContact O-N 3.35Å; I33-S36 PolarHBondContact O-OG 3.27Å; I33-D37 WeakPolarHBondContact O-CB 3.29Å; I33-D37 PolarHBondContact O-N 3.45Å
34	H	97	Very high	96.4	Very high	108 Å²	108	114.6 Å²	114.6	50%	0.5	54%	0.541	S	S	.	.	H	α-helix	trans	-63.1	-38	-179.1	-175.4	-97.8	0	0	0	112.4	K30 A31 L32 D37 L38	K30-H34 WeakPolarHBondContact O-CB 3.46Å; K30-H34 PolarHBondContact O-N 2.93Å; A31-H34 PolarHBondContact O-N 2.93Å; L32-H34 PolarHBondContact O-N 3.47Å; H34-D37 PolarHBondContact O-N 2.94Å; H34-L38 VanDerWaalsContact CE1-CD1 3.4Å; H34-L38 WeakPolarHBondContact CE1-CD1 3.42Å; H34-L38 WeakPolarHBondContact O-CB 3.27Å; H34-L38 WeakPolarHBondContact O-CG 3.41Å; H34-L38 PolarHBondContact O-N 2.69Å
35	L	96.2	Very high	96.1	Very high	107 Å²	107	112.1 Å²	112.1	56%	0.56	53%	0.527	S	S	*	.	H	α-helix	trans	-68.2	-38.3	175.7	-71.6	173.1	0	0	0	112.5	A31 L32 I33 R39	A31-L35 WeakPolarHBondContact O-CB 3.45Å; A31-L35 VanDerWaalsContact O-CG 3.26Å; A31-L35 WeakPolarHBondContact O-CG 3.32Å; A31-L35 PolarHBondContact O-N 3.03Å; L32-L35 PolarHBondContact O-N 3.4Å; I33-L35 VanDerWaalsContact C-N 3.32Å; I33-L35 PolarHBondContact O-N 2.86Å; L35-R39 PolarHBondContact O-N 2.93Å; L35-R39 VanDerWaalsContact O-N 3.12Å
36	S	94.9	Very high	95.7	Very high	62 Å²	62	114.3 Å²	114.3	43%	0.434	53%	0.532	S	S	.	.	H	α-helix	trans	-64	-43.4	173.2	46.4	0	0	0	0	111.6	L32 I33 R39 E40	L32-S36 PolarHBondContact O-N 3.29Å; L32-S36 PolarHBondContact O-OG 3.22Å; I33-S36 WeakPolarHBondContact CA-OG 3.21Å; I33-S36 PolarHBondContact O-N 3.35Å; I33-S36 PolarHBondContact O-OG 3.27Å; S36-R39 WeakPolarHBondContact O-CB 3.38Å; S36-R39 PolarHBondContact O-N 3.04Å; S36-R39 VanDerWaalsContact O-N 3.13Å; S36-E40 PolarHBondContact O-N 2.93Å
37	D	95.7	Very high	95.2	Very high	105 Å²	105	113.8 Å²	113.8	56%	0.561	53%	0.527	S	S	*	.	H	α-helix	trans	-62.3	-46.1	179.5	-170.8	60.8	0	0	0	111.4	I33 H34 R39 E40 Y41	I33-D37 WeakPolarHBondContact O-CB 3.29Å; I33-D37 PolarHBondContact O-N 3.45Å; H34-D37 PolarHBondContact O-N 2.94Å; D37-R39 VanDerWaalsContact C-N 3.27Å; D37-R39 PolarHBondContact O-N 3.25Å; D37-E40 PolarHBondContact O-N 2.87Å; D37-Y41 VanDerWaalsContact O-CB 3.29Å; D37-Y41 WeakPolarHBondContact O-CB 3.35Å; D37-Y41 PolarHBondContact O-N 3.44Å
38	L	95.9	Very high	94.7	Very high	57 Å²	57	114.2 Å²	114.2	30%	0.298	52%	0.521	S	S	.	.	H	α-helix	trans	-59.9	-35.4	174.2	-78.2	171.9	0	0	0	113.3	H34 R42	H34-L38 VanDerWaalsContact CE1-CD1 3.4Å; H34-L38 WeakPolarHBondContact CE1-CD1 3.42Å; H34-L38 WeakPolarHBondContact O-CB 3.27Å; H34-L38 WeakPolarHBondContact O-CG 3.41Å; H34-L38 PolarHBondContact O-N 2.69Å; L38-R42 VanDerWaalsContact O-CG 3.27Å; L38-R42 WeakPolarHBondContact O-CG 3.3Å; L38-R42 PolarHBondContact O-N 3.44Å; L38-R42 VanDerWaalsContact O-N 3.1Å
39	R	95.5	Very high	93.9	Very high	192 Å²	192	115.6 Å²	115.6	73%	0.725	53%	0.529	S	S	*	.	H	α-helix	trans	-68.1	-46.2	178.6	-176.8	-175.4	-69.5	159.4	-2.5	110.6	L35 S36 D37 R42 R43	L35-R39 PolarHBondContact O-N 2.93Å; L35-R39 VanDerWaalsContact O-N 3.12Å; S36-R39 WeakPolarHBondContact O-CB 3.38Å; S36-R39 PolarHBondContact O-N 3.04Å; S36-R39 VanDerWaalsContact O-N 3.13Å; D37-R39 VanDerWaalsContact C-N 3.27Å; D37-R39 PolarHBondContact O-N 3.25Å; R39-R42 PolarHBondContact O-N 3.02Å; R39-R43 PolarHBondContact O-N 3.25Å
40	E	95.1	Very high	93	Very high	139 Å²	139	116.8 Å²	116.8	65%	0.65	54%	0.539	S	S	*	.	H	α-helix	trans	-63.6	-45.4	176.9	-171	120.4	-141.3	0	0	110.9	S36 D37 R42 R43 F44	S36-E40 PolarHBondContact O-N 2.93Å; D37-E40 PolarHBondContact O-N 2.87Å; E40-R42 VanDerWaalsContact C-N 3.33Å; E40-R42 PolarHBondContact O-N 3.39Å; E40-R43 WeakPolarHBondContact O-CA 3.34Å; E40-R43 WeakPolarHBondContact O-CB 3.36Å; E40-R43 PolarHBondContact O-N 3.49Å; E40-F44 PolarHBondContact O-N 3.47Å
41	Y	94.6	Very high	91.8	Very high	130 Å²	130	113.2 Å²	113.2	51%	0.51	53%	0.534	S	S	.	.	H	α-helix	trans	-55.9	-45.1	177	-176.7	-100.3	0	0	0	112.5	D37 R43 F44 E45	D37-Y41 VanDerWaalsContact O-CB 3.29Å; D37-Y41 WeakPolarHBondContact O-CB 3.35Å; D37-Y41 PolarHBondContact O-N 3.44Å; Y41-R43 VanDerWaalsContact C-N 3.28Å; Y41-R43 PolarHBondContact O-N 3.22Å; Y41-F44 PolarHBondContact O-N 2.89Å; Y41-E45 HydrophobicContact CD1-CG 4.39Å; Y41-E45 HydrophobicContact CE1-CG 3.86Å; Y41-E45 HydrophobicContact CE2-CG 4.46Å; Y41-E45 PolarHBondContact O-N 3.38Å
42	R	93.6	Very high	90.4	Very high	163 Å²	163	118.7 Å²	118.7	62%	0.615	55%	0.551	S	S	*	*	H	α-helix	trans	-64	-32.7	176.3	-72.8	176.9	-160.1	169.7	5.7	112.9	L38 R39 E40 K46	L38-R42 VanDerWaalsContact O-CG 3.27Å; L38-R42 WeakPolarHBondContact O-CG 3.3Å; L38-R42 PolarHBondContact O-N 3.44Å; L38-R42 VanDerWaalsContact O-N 3.1Å; R39-R42 PolarHBondContact O-N 3.02Å; E40-R42 VanDerWaalsContact C-N 3.33Å; E40-R42 PolarHBondContact O-N 3.39Å; R42-K46 WeakPolarHBondContact O-CG 3.39Å; R42-K46 PolarHBondContact O-N 3.35Å
43	R	93.4	Very high	88.9	Confident	157 Å²	157	123.1 Å²	123.1	59%	0.592	56%	0.561	S	S	*	*	H	α-helix	trans	-70.4	-45.7	174.7	-178.9	-177.8	174.3	-179.2	-0.6	110.1	R39 E40 Y41 E45 K46 E47	R39-R43 PolarHBondContact O-N 3.25Å; E40-R43 WeakPolarHBondContact O-CA 3.34Å; E40-R43 WeakPolarHBondContact O-CB 3.36Å; E40-R43 PolarHBondContact O-N 3.49Å; Y41-R43 VanDerWaalsContact C-N 3.28Å; Y41-R43 PolarHBondContact O-N 3.22Å; R43-E45 PolarHBondContact O-N 3.43Å; R43-K46 WeakPolarHBondContact O-CB 3.31Å; R43-K46 PolarHBondContact O-N 3Å; R43-E47 IonicContact CZ-OE1 3.52Å; R43-E47 IonicContact NE-OE1 2.83Å; R43-E47 PolarHBondContact NE-OE1 2.96Å; R43-E47 IonicContact NH2-OE1 3.33Å; R43-E47 PolarHBondContact NH2-OE1 2.94Å; R43-E47 PolarHBondContact O-N 2.98Å
44	F	93	Very high	87.4	Confident	122 Å²	122	125.1 Å²	125.1	54%	0.535	57%	0.572	S	S	.	*	H	α-helix	trans	-59.1	-45.2	178.2	-176.4	-98.4	0	0	0	112.1	E40 Y41 K46 E47 K48	E40-F44 PolarHBondContact O-N 3.47Å; Y41-F44 PolarHBondContact O-N 2.89Å; F44-K46 VanDerWaalsContact C-N 3.32Å; F44-K46 PolarHBondContact O-N 2.92Å; F44-E47 CarbonylContact O-C 3.6Å; F44-E47 PolarHBondContact O-N 3.36Å; F44-K48 HydrophobicContact CE1-CD 4.47Å; F44-K48 WeakPolarHBondContact O-CB 3.45Å; F44-K48 PolarHBondContact O-N 3.48Å
45	E	92.9	Very high	85.6	Confident	52 Å²	52	127 Å²	127	24%	0.243	59%	0.585	C	S	.	*	H	α-helix	trans	-59.2	-40.7	176.5	-81.9	-65.4	124.2	0	0	112.6	Y41 R43 K48 L49	Y41-E45 HydrophobicContact CD1-CG 4.39Å; Y41-E45 HydrophobicContact CE1-CG 3.86Å; Y41-E45 HydrophobicContact CE2-CG 4.46Å; Y41-E45 PolarHBondContact O-N 3.38Å; R43-E45 PolarHBondContact O-N 3.43Å; E45-K48 PolarHBondContact O-N 2.9Å; E45-K48 IonicContact OE1-NZ 2.67Å; E45-K48 PolarHBondContact OE1-NZ 3.4Å; E45-K48 IonicContact OE2-NZ 2.97Å; E45-K48 PolarHBondContact OE2-NZ 3.48Å; E45-L49 WeakPolarHBondContact O-CG 3.31Å; E45-L49 PolarHBondContact O-N 3.47Å
46	K	89.8	Confident	84	Confident	155 Å²	155	128.1 Å²	128.1	67%	0.674	59%	0.592	S	S	*	*	H	α-helix	trans	-65.2	-43.2	176	-69.1	174	-175.7	-175.4	0	111.8	R42 R43 F44 L49 K50	R42-K46 WeakPolarHBondContact O-CG 3.39Å; R42-K46 PolarHBondContact O-N 3.35Å; R43-K46 WeakPolarHBondContact O-CB 3.31Å; R43-K46 PolarHBondContact O-N 3Å; F44-K46 VanDerWaalsContact C-N 3.32Å; F44-K46 PolarHBondContact O-N 2.92Å; K46-L49 PolarHBondContact O-N 3.33Å; K46-K50 PolarHBondContact O-N 3.01Å; K46-K50 VanDerWaalsContact O-N 3.13Å
47	E	88.4	Confident	82.6	Confident	94 Å²	94	128.7 Å²	128.7	44%	0.439	59%	0.59	S	S	.	*	H	α-helix	trans	-67.4	-37.2	177.2	-70.6	179.3	-171.6	0	0	111.2	R43 F44 L49 K50 S51	R43-E47 IonicContact CZ-OE1 3.52Å; R43-E47 IonicContact NE-OE1 2.83Å; R43-E47 PolarHBondContact NE-OE1 2.96Å; R43-E47 IonicContact NH2-OE1 3.33Å; R43-E47 PolarHBondContact NH2-OE1 2.94Å; R43-E47 PolarHBondContact O-N 2.98Å; F44-E47 CarbonylContact O-C 3.6Å; F44-E47 PolarHBondContact O-N 3.36Å; E47-L49 PolarHBondContact O-N 3.4Å; E47-K50 CarbonylContact O-C 3.59Å; E47-K50 PolarHBondContact O-N 3.27Å; E47-S51 WeakPolarHBondContact O-CA 3.28Å; E47-S51 WeakPolarHBondContact O-CB 3.3Å; E47-S51 PolarHBondContact O-N 2.92Å
48	K	87.3	Confident	81.3	Confident	100 Å²	100	129.5 Å²	129.5	44%	0.435	60%	0.601	S	S	.	*	H	α-helix	trans	-60.9	-44.5	174.7	-169.4	-171.5	75.4	-170	0	112	F44 E45 K50 S51 Q52	F44-K48 HydrophobicContact CE1-CD 4.47Å; F44-K48 WeakPolarHBondContact O-CB 3.45Å; F44-K48 PolarHBondContact O-N 3.48Å; E45-K48 PolarHBondContact O-N 2.9Å; E45-K48 IonicContact OE1-NZ 2.67Å; E45-K48 PolarHBondContact OE1-NZ 3.4Å; E45-K48 IonicContact OE2-NZ 2.97Å; E45-K48 PolarHBondContact OE2-NZ 3.48Å; K48-K50 VanDerWaalsContact C-N 3.35Å; K48-S51 CarbonylContact O-C 3.57Å; K48-S51 PolarHBondContact O-N 3.48Å; K48-Q52 PolarHBondContact O-N 3.04Å; K48-Q52 VanDerWaalsContact O-N 3.17Å
49	L	82	Confident	79.9	Confident	118 Å²	118	134.1 Å²	134.1	62%	0.618	63%	0.626	S	S	*	*	H	α-helix	trans	-64.1	-39.4	175.7	-70.9	172.3	0	0	0	112	E45 K46 E47	E45-L49 WeakPolarHBondContact O-CG 3.31Å; E45-L49 PolarHBondContact O-N 3.47Å; K46-L49 PolarHBondContact O-N 3.33Å; E47-L49 PolarHBondContact O-N 3.4Å
50	K	78.3	Confident	78.4	Confident	189 Å²	189	132.3 Å²	132.3	82%	0.822	62%	0.623	S	S	*	*	H	α-helix	trans	-73.3	-30.5	176.7	-172.1	178.5	178	-174	0	113	K46 E47 K48 Q52	K46-K50 PolarHBondContact O-N 3.01Å; K46-K50 VanDerWaalsContact O-N 3.13Å; E47-K50 CarbonylContact O-C 3.59Å; E47-K50 PolarHBondContact O-N 3.27Å; K48-K50 VanDerWaalsContact C-N 3.35Å; K50-Q52 VanDerWaalsContact C-N 3.28Å
51	S	72.1	Confident	76.9	Confident	85 Å²	85	134.3 Å²	134.3	59%	0.594	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.3	7.2	179.8	-165	0	0	0	0	112.6	E47 K48 W53	E47-S51 WeakPolarHBondContact O-CA 3.28Å; E47-S51 WeakPolarHBondContact O-CB 3.3Å; E47-S51 PolarHBondContact O-N 2.92Å; K48-S51 CarbonylContact O-C 3.57Å; K48-S51 PolarHBondContact O-N 3.48Å; S51-W53 VanDerWaalsContact C-N 3.25Å; S51-W53 PolarHBondContact O-N 3.24Å
52	Q	69.1	Low	75.6	Confident	162 Å²	162	132.3 Å²	132.3	76%	0.757	64%	0.635	S	S	*	*	S	Bend	trans	-57	102	161	-94.8	-165.7	-15.9	0	0	107.1	K48 K50 N54	K48-Q52 PolarHBondContact O-N 3.04Å; K48-Q52 VanDerWaalsContact O-N 3.17Å; K50-Q52 VanDerWaalsContact C-N 3.28Å; Q52-N54 PolarHBondContact O-N 3.37Å; Q52-N54 VanDerWaalsContact O-N 3.16Å
53	W	65.5	Low	74.3	Confident	204 Å²	204	129.2 Å²	129.2	77%	0.773	64%	0.644	S	S	*	*			trans	-55.5	122.4	-178.9	-158	-78.4	0	0	0	107.1	S51 N55	S51-W53 VanDerWaalsContact C-N 3.25Å; S51-W53 PolarHBondContact O-N 3.24Å; W53-N55 VanDerWaalsContact C-N 3.26Å; W53-N55 PolarHBondContact O-N 2.92Å; W53-N55 PolarHBondContact O-ND2 3.3Å; W53-N55 VanDerWaalsContact O-ND2 3.15Å
54	N	64.2	Low	73.2	Confident	126 Å²	126	127.3 Å²	127.3	67%	0.674	65%	0.65	S	S	*	*			trans	-64.3	98.6	170.1	-153.1	24.8	0	0	0	105.6	Q52 D56	Q52-N54 PolarHBondContact O-N 3.37Å; Q52-N54 VanDerWaalsContact O-N 3.16Å; N54-D56 PolarHBondContact O-N 3.45Å
55	N	59.7	Low	72	Confident	147 Å²	147	127.1 Å²	127.1	79%	0.786	66%	0.659	S	S	*	*	S	Bend	trans	-66.3	-14.3	-178.9	-84.2	-85.1	0	0	0	111.2	W53 N57	W53-N55 VanDerWaalsContact C-N 3.26Å; W53-N55 PolarHBondContact O-N 2.92Å; W53-N55 PolarHBondContact O-ND2 3.3Å; W53-N55 VanDerWaalsContact O-ND2 3.15Å; N55-N57 VanDerWaalsContact C-N 3.3Å; N55-N57 PolarHBondContact O-N 2.91Å
56	D	63.9	Low	71	Confident	131 Å²	131	130 Å²	130	70%	0.701	68%	0.681	S	S	*	*			trans	-80.3	77.8	168.7	-70.3	-38	0	0	0	110.1	N54 P58	N54-D56 PolarHBondContact O-N 3.45Å; D56-P58 WeakPolarHBondContact O-CD 3.42Å
57	N	65.3	Low	70.2	Confident	74 Å²	74	128.5 Å²	128.5	40%	0.396	68%	0.684	S	S	.	*			trans	-77.5	109.1	161.3	179.7	17.9	0	0	0	108.3	N55 L59 F60	N55-N57 VanDerWaalsContact C-N 3.3Å; N55-N57 PolarHBondContact O-N 2.91Å; N57-L59 PolarHBondContact O-N 3.46Å; N57-L59 WeakPolarHBondContact OD1-CB 3.3Å; N57-L59 PolarHBondContact OD1-N 3.29Å; N57-L59 VanDerWaalsContact OD1-N 3.14Å; N57-F60 HydrophobicContact CB-CB 3.8Å; N57-F60 WeakPolarHBondContact ND2-CB 3.39Å; N57-F60 PolarHBondContact ND2-N 3.39Å; N57-F60 PolarHBondContact O-N 2.96Å
58	P	67.8	Low	69.3	Low	122 Å²	122	131.7 Å²	131.7	79%	0.792	70%	0.701	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.3	-14.1	179.1	28.1	-35.6	0	0	0	113	D56	D56-P58 WeakPolarHBondContact O-CD 3.42Å
59	L	66.7	Low	68.8	Low	155 Å²	155	131 Å²	131	81%	0.812	70%	0.702	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.3	-15.7	174.5	-56.2	173.7	0	0	0	113.2	N57 K61	N57-L59 PolarHBondContact O-N 3.46Å; N57-L59 WeakPolarHBondContact OD1-CB 3.3Å; N57-L59 PolarHBondContact OD1-N 3.29Å; N57-L59 VanDerWaalsContact OD1-N 3.14Å; L59-K61 PolarHBondContact O-N 3.06Å
60	F	63	Low	68.4	Low	153 Å²	153	130.8 Å²	130.8	67%	0.671	71%	0.708	S	S	*	*			trans	-93	98.6	179.7	-160.3	-99.9	0	0	0	109.9	N57	N57-F60 HydrophobicContact CB-CB 3.8Å; N57-F60 WeakPolarHBondContact ND2-CB 3.39Å; N57-F60 PolarHBondContact ND2-N 3.39Å; N57-F60 PolarHBondContact O-N 2.96Å
61	K	65.4	Low	67.9	Low	181 Å²	181	130.3 Å²	130.3	79%	0.787	71%	0.706	S	S	*	*			trans	-86.2	121	164.7	-67.9	-80.2	-177	178.6	0	107.2	L59 A63	L59-K61 PolarHBondContact O-N 3.06Å; K61-A63 PolarHBondContact O-N 3.31Å
62	S	66.9	Low	67.5	Low	89 Å²	89	134.1 Å²	134.1	62%	0.622	71%	0.712	S	S	*	*			trans	-54.7	114.8	168.9	-53.3	0	0	0	0	108.5	T64	S62-T64 PolarHBondContact O-N 2.98Å
63	A	66.1	Low	67.3	Low	98 Å²	98	130.7 Å²	130.7	81%	0.81	71%	0.711	S	S	*	*			trans	-76.4	65.3	173.8	0	0	0	0	0	109	K61 T65	K61-A63 PolarHBondContact O-N 3.31Å; A63-T65 VanDerWaalsContact C-N 3.32Å; A63-T65 PolarHBondContact O-N 3.3Å
64	T	70	Confident	67.1	Low	117 Å²	117	129.6 Å²	129.6	72%	0.718	72%	0.715	S	S	*	*			trans	-78.2	88.8	172.2	-56.6	0	0	0	0	107.5	S62 T66	S62-T64 PolarHBondContact O-N 2.98Å; T64-T66 PolarHBondContact O-N 2.98Å
65	T	68.6	Low	66.8	Low	117 Å²	117	132.2 Å²	132.2	72%	0.718	74%	0.743	S	S	*	*			trans	-69.5	100.7	167.9	-71.1	0	0	0	0	108	A63 V67	A63-T65 VanDerWaalsContact C-N 3.32Å; A63-T65 PolarHBondContact O-N 3.3Å; T65-V67 HydrophobicContact CG2-CG2 3.85Å; T65-V67 PolarHBondContact O-N 2.99Å
66	T	72.1	Confident	67.2	Low	113 Å²	113	131.5 Å²	131.5	69%	0.693	74%	0.741	S	S	*	*			trans	-77.3	103.9	167.6	-179	0	0	0	0	108.5	T64 M68	T64-T66 PolarHBondContact O-N 2.98Å; T66-M68 PolarHBondContact O-N 3.32Å
67	V	72.8	Confident	67.3	Low	124 Å²	124	131.5 Å²	131.5	75%	0.752	74%	0.743	S	S	*	*			trans	-79.8	100.1	172.7	-177.7	0	0	0	0	107.4	T65 N69	T65-V67 HydrophobicContact CG2-CG2 3.85Å; T65-V67 PolarHBondContact O-N 2.99Å; V67-N69 PolarHBondContact O-N 3.22Å
68	M	69.5	Low	67.5	Low	161 Å²	161	134.7 Å²	134.7	79%	0.793	76%	0.762	S	S	*	*			trans	-72.9	124.1	170.6	-63.6	-149.8	75.6	0	0	109.1	T66 P70	T66-M68 PolarHBondContact O-N 3.32Å; M68-P70 VanDerWaalsContact O-CD 3.27Å; M68-P70 WeakPolarHBondContact O-CD 3.32Å
69	N	75.8	Confident	67.4	Low	84 Å²	84	135.5 Å²	135.5	45%	0.449	76%	0.76	S	S	.	*			trans	-78.3	113.2	176.1	-176.2	-8.9	0	0	0	109.2	V67 K71 F72	V67-N69 PolarHBondContact O-N 3.22Å; N69-K71 PolarHBondContact O-N 3.01Å; N69-K71 WeakPolarHBondContact OD1-CB 3.39Å; N69-K71 PolarHBondContact OD1-N 3.43Å; N69-K71 VanDerWaalsContact OD1-N 3.14Å; N69-F72 HydrophobicContact CB-CD2 4.08Å; N69-F72 PolarHBondContact O-N 2.97Å
70	P	73.6	Confident	67.5	Low	115 Å²	115	134.3 Å²	134.3	75%	0.747	76%	0.757	S	S	*	*	G	3₁₀ helix	trans	-63.3	-13.7	-176.4	24.1	-32.4	0	0	0	113.7	M68 F72	M68-P70 VanDerWaalsContact O-CD 3.27Å; M68-P70 WeakPolarHBondContact O-CD 3.32Å; P70-F72 VanDerWaalsContact C-N 3.32Å
71	K	69.1	Low	67.8	Low	178 Å²	178	133 Å²	133	77%	0.774	76%	0.763	S	S	*	*	G	3₁₀ helix	trans	-75.6	-13.2	173.7	-80	-76	-156.9	177	0	114.7	N69	N69-K71 PolarHBondContact O-N 3.01Å; N69-K71 WeakPolarHBondContact OD1-CB 3.39Å; N69-K71 PolarHBondContact OD1-N 3.43Å; N69-K71 VanDerWaalsContact OD1-N 3.14Å
72	F	63.8	Low	68	Low	166 Å²	166	129.6 Å²	129.6	73%	0.728	76%	0.761	S	S	*	*	G	3₁₀ helix	trans	-101.3	-5.6	-174.8	-90.8	-90.1	0	0	0	114.5	N69 P70	N69-F72 HydrophobicContact CB-CD2 4.08Å; N69-F72 PolarHBondContact O-N 2.97Å; P70-F72 VanDerWaalsContact C-N 3.32Å
73	A	63.2	Low	68	Low	89 Å²	89	132.7 Å²	132.7	74%	0.736	77%	0.772	S	S	*	*	S	Bend	trans	-88.1	-11.8	-178.1	0	0	0	0	0	114.1
74	E	61.5	Low	68.2	Low	182 Å²	182	135.6 Å²	135.6	85%	0.85	77%	0.769	S	S	*	*			trans	-113.9	84.9	178.2	-59.3	-148.4	157.6	0	0	110.3
75	S	58.7	Low	68	Low	181 Å²	181	137.3 Å²	137.3	100%	1.266	77%	0.773	S	S	*	*			trans	-137.1	0	166.5	-62.4	0	0	0	0	109.5

Retrieved 75 of 75 residues in 173 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).