TMA7B_HUMAN Loading...

Translation machinery-associated protein 7B

AlphaFold DB , UniProt , Accession A0A024R1R8, Species HUMAN (Homo sapiens, Human), Gene TMA7B, Length 64 aa.

						>TMA7B_HUMAN|A0A024R1R8|TMA7B
MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.9	Low	59.4	Low	248 Å²	248	153.1 Å²	153.1	100%	1.222	86%	0.857	S	S	*	*				0	127.1	0	-70	174.5	179.2	0	107.9
2	S	55.9	Low	59.2	Low	111 Å²	111	152.8 Å²	152.8	78%	0.776	85%	0.851	S	S	*	*			trans	146.2	89.8	153.6	-179.5	0	0	0	111
3	S	62.7	Low	59.2	Low	110 Å²	110	154.5 Å²	154.5	77%	0.769	84%	0.844	S	S	*	*			trans	59.3	70.2	136.5	-50.8	0	0	0	118
4	H	59.9	Low	59.4	Low	188 Å²	188	151.9 Å²	151.9	87%	0.87	82%	0.823	S	S	*	*				-73.4	116.7	129.4	-66.1	-81.3	0	0	105.9
5	E	61.6	Low	59.6	Low	190 Å²	190	146.7 Å²	146.7	89%	0.888	80%	0.8	S	S	*	*			trans	164.3	123.4	150.3	-82.8	-97.1	90.9	0	110.2
6	G	61.9	Low	59.8	Low	83 Å²	83	148.4 Å²	148.4	86%	0.856	80%	0.798	S	S	*	*			trans	83.8	97.2	153.6	0	0	0	0	118.3
7	G	60.2	Low	60	Low	77 Å²	77	148 Å²	148	79%	0.794	79%	0.787	S	S	*	*	S	Bend	trans	-161.7	-59.6	162.2	0	0	0	0	116.5
8	K	56.5	Low	60.2	Low	193 Å²	193	147.6 Å²	147.6	84%	0.839	78%	0.779	S	S	*	*	S	Bend	trans	-137.4	14.7	-160.7	-70.1	-174	178.6	178.9	117.6
9	K	56.8	Low	60.6	Low	204 Å²	204	142.5 Å²	142.5	89%	0.887	76%	0.761	S	S	*	*	S	Bend	trans	-82.9	-16.8	176.3	-88.9	-174	176.5	178	115.5
10	K	59	Low	61.1	Low	201 Å²	201	141.9 Å²	141.9	87%	0.874	75%	0.751	S	S	*	*	S	Bend	trans	-86.2	-16.4	-178.6	-87.6	-174.8	177	179.3	115.6	L12	K10-L12 PolarHBondContact O-N 3.43Å
11	A	58.7	Low	61.5	Low	79 Å²	79	140.4 Å²	140.4	65%	0.653	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.7	-27	-177.3	0	0	0	0	114.1	P15	A11-P15 WeakPolarHBondContact O-CD 3.43Å
12	L	57.7	Low	62.2	Low	150 Å²	150	134.3 Å²	134.3	79%	0.785	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.4	-14.5	-171.9	-77.2	164.6	0	0	114.8	K10	K10-L12 PolarHBondContact O-N 3.43Å
13	K	59.6	Low	63.5	Low	174 Å²	174	133.2 Å²	133.2	76%	0.757	70%	0.696	S	S	*	*	S	Bend	trans	-101.5	-10.8	-165.5	-158	67.2	175.1	172.6	115.4
14	Q	61.5	Low	64.5	Low	119 Å²	119	133.1 Å²	133.1	56%	0.556	68%	0.683	S	S	*	*	S	Bend	trans	-130.9	3.2	-177.4	-67.4	-65	-6	0	119.9
15	P	62.4	Low	65.6	Low	74 Å²	74	130.8 Å²	130.8	48%	0.481	67%	0.672	S	S	.	*	H	α-helix	trans	-80.8	-16.4	173	27.8	-30	0	0	114.1	A11 A19	A11-P15 WeakPolarHBondContact O-CD 3.43Å; P15-A19 WeakPolarHBondContact O-CB 3.35Å; P15-A19 PolarHBondContact O-N 3.39Å
16	K	63.1	Low	66.9	Low	174 Å²	174	126.4 Å²	126.4	76%	0.757	65%	0.652	S	S	*	*	H	α-helix	trans	-79.3	-25.8	-174.2	-71	-179.4	179	168.9	114.8	K20	K16-K20 WeakPolarHBondContact O-CB 3.26Å
17	K	63	Low	68.2	Low	141 Å²	141	129.4 Å²	129.4	61%	0.613	64%	0.641	S	S	*	*	H	α-helix	trans	-81.6	-48.7	179.6	-77.5	-173.3	174.4	-172.1	111.7	A19 K20 E21	K17-A19 PolarHBondContact O-N 3.15Å; K17-K20 PolarHBondContact O-N 2.92Å; K17-K20 VanDerWaalsContact O-N 3.15Å; K17-E21 PolarHBondContact O-N 3Å
18	Q	64.1	Low	69.6	Low	140 Å²	140	127.9 Å²	127.9	65%	0.654	62%	0.621	S	S	*	*	H	α-helix	trans	-61	-42	177.6	-76.9	177	-6	0	112.5	K20 M22	Q18-K20 VanDerWaalsContact C-N 3.31Å; Q18-K20 PolarHBondContact O-N 3.07Å; Q18-M22 VanDerWaalsContact O-CG 3.26Å; Q18-M22 WeakPolarHBondContact O-CG 3.31Å; Q18-M22 PolarHBondContact O-N 3.42Å
19	A	67.5	Low	71.2	Confident	52 Å²	52	125 Å²	125	43%	0.43	61%	0.609	S	S	.	*	H	α-helix	trans	-61.5	-41.2	176	0	0	0	0	112	P15 K17 D23	P15-A19 WeakPolarHBondContact O-CB 3.35Å; P15-A19 PolarHBondContact O-N 3.39Å; K17-A19 PolarHBondContact O-N 3.15Å; A19-D23 WeakPolarHBondContact O-CB 3.5Å; A19-D23 PolarHBondContact O-N 3.42Å
20	K	69.8	Low	72.9	Confident	130 Å²	130	120.9 Å²	120.9	57%	0.565	59%	0.591	S	S	*	*	H	α-helix	trans	-72.9	-39.4	-177.8	-164.4	176.8	-177.9	-170.6	112.9	K16 K17 Q18 D23 E24	K16-K20 WeakPolarHBondContact O-CB 3.26Å; K17-K20 PolarHBondContact O-N 2.92Å; K17-K20 VanDerWaalsContact O-N 3.15Å; Q18-K20 VanDerWaalsContact C-N 3.31Å; Q18-K20 PolarHBondContact O-N 3.07Å; K20-D23 PolarHBondContact O-N 2.87Å; K20-E24 WeakPolarHBondContact CE-OE1 3.47Å; K20-E24 IonicContact NZ-OE1 3.99Å; K20-E24 WeakPolarHBondContact O-CB 3.38Å; K20-E24 WeakPolarHBondContact O-CG 3.35Å; K20-E24 PolarHBondContact O-N 2.87Å
21	E	70.3	Confident	74.5	Confident	111 Å²	111	117 Å²	117	52%	0.519	58%	0.576	S	S	.	*	H	α-helix	trans	-61.9	-45.3	174	-75.8	173.5	170.9	0	110.8	K17 D23 E24 E25	K17-E21 PolarHBondContact O-N 3Å; E21-D23 PolarHBondContact O-N 3.46Å; E21-E24 PolarHBondContact O-N 3.44Å; E21-E25 WeakPolarHBondContact O-CB 3.2Å; E21-E25 WeakPolarHBondContact O-CG 3.3Å; E21-E25 PolarHBondContact O-N 2.97Å
22	M	74.7	Confident	76.1	Confident	119 Å²	119	119.8 Å²	119.8	59%	0.586	57%	0.573	S	S	*	*	H	α-helix	trans	-60.9	-42.8	174.9	-67.3	-121.7	-62	0	112	Q18 E24 E25 E26	Q18-M22 VanDerWaalsContact O-CG 3.26Å; Q18-M22 WeakPolarHBondContact O-CG 3.31Å; Q18-M22 PolarHBondContact O-N 3.42Å; M22-E24 VanDerWaalsContact C-N 3.34Å; M22-E24 PolarHBondContact O-N 3.26Å; M22-E25 PolarHBondContact O-N 3.43Å; M22-E26 VanDerWaalsContact O-CB 3.31Å; M22-E26 WeakPolarHBondContact O-CB 3.39Å; M22-E26 WeakPolarHBondContact O-CG 3.35Å; M22-E26 PolarHBondContact O-N 3.34Å
23	D	83	Confident	77.8	Confident	89 Å²	89	117.5 Å²	117.5	48%	0.476	56%	0.558	S	S	.	*	H	α-helix	trans	-63.7	-37.7	177.8	-73	-30.2	0	0	112.8	A19 K20 E21 K27	A19-D23 WeakPolarHBondContact O-CB 3.5Å; A19-D23 PolarHBondContact O-N 3.42Å; K20-D23 PolarHBondContact O-N 2.87Å; E21-D23 PolarHBondContact O-N 3.46Å; D23-K27 WeakPolarHBondContact O-CD 3.44Å; D23-K27 VanDerWaalsContact O-CG 3.24Å; D23-K27 WeakPolarHBondContact O-CG 3.36Å; D23-K27 PolarHBondContact O-N 2.84Å
24	E	82.7	Confident	79.4	Confident	108 Å²	108	115.8 Å²	115.8	51%	0.505	55%	0.551	S	S	.	*	H	α-helix	trans	-73.1	-43.5	178	-73.5	176.7	-171.6	0	111.5	K20 E21 M22 K27 A28	K20-E24 WeakPolarHBondContact CE-OE1 3.47Å; K20-E24 IonicContact NZ-OE1 3.99Å; K20-E24 WeakPolarHBondContact O-CB 3.38Å; K20-E24 WeakPolarHBondContact O-CG 3.35Å; K20-E24 PolarHBondContact O-N 2.87Å; E21-E24 PolarHBondContact O-N 3.44Å; M22-E24 VanDerWaalsContact C-N 3.34Å; M22-E24 PolarHBondContact O-N 3.26Å; E24-K27 PolarHBondContact O-N 3.27Å; E24-A28 WeakPolarHBondContact O-CB 3.4Å; E24-A28 PolarHBondContact O-N 2.9Å
25	E	84.1	Confident	80.8	Confident	138 Å²	138	114.1 Å²	114.1	65%	0.645	54%	0.543	S	S	*	.	H	α-helix	trans	-64.6	-42.5	175.8	-74.2	-178.6	-174.3	0	112.3	E21 M22 K27 A28 F29	E21-E25 WeakPolarHBondContact O-CB 3.2Å; E21-E25 WeakPolarHBondContact O-CG 3.3Å; E21-E25 PolarHBondContact O-N 2.97Å; M22-E25 PolarHBondContact O-N 3.43Å; E25-K27 PolarHBondContact O-N 3.33Å; E25-A28 PolarHBondContact O-N 3.5Å; E25-F29 WeakPolarHBondContact O-CB 3.45Å; E25-F29 PolarHBondContact O-N 3.39Å
26	E	88.6	Confident	82.1	Confident	98 Å²	98	116.3 Å²	116.3	46%	0.458	55%	0.547	S	S	.	.	H	α-helix	trans	-62.9	-41.7	176.7	-82.5	-165.5	-168.9	0	112.3	M22 F29 K30	M22-E26 VanDerWaalsContact O-CB 3.31Å; M22-E26 WeakPolarHBondContact O-CB 3.39Å; M22-E26 WeakPolarHBondContact O-CG 3.35Å; M22-E26 PolarHBondContact O-N 3.34Å; E26-F29 PolarHBondContact O-N 2.92Å; E26-K30 WeakPolarHBondContact O-CB 3.32Å; E26-K30 WeakPolarHBondContact O-CG 3.43Å; E26-K30 PolarHBondContact O-N 3.43Å; E26-K30 IonicContact OE2-NZ 3.79Å
27	K	89.7	Confident	83.5	Confident	147 Å²	147	113.1 Å²	113.1	64%	0.639	54%	0.535	S	S	*	.	H	α-helix	trans	-63.5	-44.9	175.7	-76.4	171.8	-171.7	169.4	110.7	D23 E24 E25 F29 K30 Q31	D23-K27 WeakPolarHBondContact O-CD 3.44Å; D23-K27 VanDerWaalsContact O-CG 3.24Å; D23-K27 WeakPolarHBondContact O-CG 3.36Å; D23-K27 PolarHBondContact O-N 2.84Å; E24-K27 PolarHBondContact O-N 3.27Å; E25-K27 PolarHBondContact O-N 3.33Å; K27-F29 VanDerWaalsContact C-N 3.34Å; K27-F29 PolarHBondContact O-N 3.29Å; K27-K30 PolarHBondContact O-N 3.27Å; K27-Q31 WeakPolarHBondContact O-CB 3.43Å; K27-Q31 PolarHBondContact O-N 3.46Å
28	A	89.2	Confident	84.9	Confident	44 Å²	44	113.3 Å²	113.3	36%	0.364	54%	0.536	S	S	.	.	H	α-helix	trans	-62.6	-40.6	176.5	0	0	0	0	111.9	E24 E25 Q31 K32	E24-A28 WeakPolarHBondContact O-CB 3.4Å; E24-A28 PolarHBondContact O-N 2.9Å; E25-A28 PolarHBondContact O-N 3.5Å; A28-Q31 PolarHBondContact O-N 3.39Å; A28-K32 WeakPolarHBondContact O-CG 3.43Å; A28-K32 PolarHBondContact O-N 2.79Å
29	F	90.1	Very high	86.1	Confident	134 Å²	134	112.8 Å²	112.8	59%	0.588	53%	0.531	S	S	*	.	H	α-helix	trans	-65.5	-47.9	177.4	-175.5	-103.7	0	0	111.6	E25 E26 K27 Q31 K32 Q33	E25-F29 WeakPolarHBondContact O-CB 3.45Å; E25-F29 PolarHBondContact O-N 3.39Å; E26-F29 PolarHBondContact O-N 2.92Å; K27-F29 VanDerWaalsContact C-N 3.34Å; K27-F29 PolarHBondContact O-N 3.29Å; F29-Q31 VanDerWaalsContact C-N 3.27Å; F29-Q31 PolarHBondContact O-N 3Å; F29-K32 PolarHBondContact O-N 2.97Å; F29-Q33 VanDerWaalsContact O-CB 3.3Å; F29-Q33 WeakPolarHBondContact O-CB 3.24Å; F29-Q33 PolarHBondContact O-N 3.47Å
30	K	92.3	Very high	87	Confident	116 Å²	116	115 Å²	115	50%	0.504	54%	0.535	S	S	.	.	H	α-helix	trans	-60.2	-36.7	175.4	-76	175.3	-177.9	159.1	112.1	E26 K27 K34	E26-K30 WeakPolarHBondContact O-CB 3.32Å; E26-K30 WeakPolarHBondContact O-CG 3.43Å; E26-K30 PolarHBondContact O-N 3.43Å; E26-K30 IonicContact OE2-NZ 3.79Å; K27-K30 PolarHBondContact O-N 3.27Å; K30-K34 WeakPolarHBondContact O-CB 3.47Å; K30-K34 VanDerWaalsContact O-CG 3.27Å; K30-K34 WeakPolarHBondContact O-CG 3.47Å; K30-K34 PolarHBondContact O-N 3.24Å; K30-K34 VanDerWaalsContact O-N 3.1Å
31	Q	91.7	Very high	87.9	Confident	121 Å²	121	113.7 Å²	113.7	57%	0.565	53%	0.531	S	S	*	.	H	α-helix	trans	-68.2	-49.4	175.7	-174.5	177.5	-19.7	0	111.6	K27 A28 F29 Q33 K34 E35	K27-Q31 WeakPolarHBondContact O-CB 3.43Å; K27-Q31 PolarHBondContact O-N 3.46Å; A28-Q31 PolarHBondContact O-N 3.39Å; F29-Q31 VanDerWaalsContact C-N 3.27Å; F29-Q31 PolarHBondContact O-N 3Å; Q31-Q33 VanDerWaalsContact C-N 3.32Å; Q31-Q33 PolarHBondContact O-N 2.97Å; Q31-K34 PolarHBondContact O-N 2.89Å; Q31-E35 PolarHBondContact NE2-OE1 3.23Å; Q31-E35 WeakPolarHBondContact O-CG 3.4Å; Q31-E35 PolarHBondContact O-N 3.4Å
32	K	92.7	Very high	88.7	Confident	136 Å²	136	112.1 Å²	112.1	59%	0.591	53%	0.529	S	S	*	.	H	α-helix	trans	-57.2	-44.8	175.7	-77.1	-178.9	-179.5	178.1	111.7	A28 F29 K34 E35 E36	A28-K32 WeakPolarHBondContact O-CG 3.43Å; A28-K32 PolarHBondContact O-N 2.79Å; F29-K32 PolarHBondContact O-N 2.97Å; K32-K34 PolarHBondContact O-N 3.17Å; K32-E35 PolarHBondContact O-N 3.44Å; K32-E36 WeakPolarHBondContact O-CB 3.28Å; K32-E36 WeakPolarHBondContact O-CG 3.47Å; K32-E36 PolarHBondContact O-N 2.84Å
33	Q	93.8	Very high	89	Confident	102 Å²	102	111.3 Å²	111.3	48%	0.477	53%	0.527	S	S	.	.	H	α-helix	trans	-63	-41.2	179.5	-162.3	-177.4	42.5	0	112	F29 Q31 E36 Q37	F29-Q33 VanDerWaalsContact O-CB 3.3Å; F29-Q33 WeakPolarHBondContact O-CB 3.24Å; F29-Q33 PolarHBondContact O-N 3.47Å; Q31-Q33 VanDerWaalsContact C-N 3.32Å; Q31-Q33 PolarHBondContact O-N 2.97Å; Q33-E36 PolarHBondContact O-N 2.88Å; Q33-Q37 VanDerWaalsContact O-CB 3.28Å; Q33-Q37 WeakPolarHBondContact O-CB 3.37Å; Q33-Q37 PolarHBondContact O-N 2.94Å
34	K	92.5	Very high	89.1	Confident	138 Å²	138	113.7 Å²	113.7	60%	0.6	53%	0.533	S	S	*	.	H	α-helix	trans	-64.2	-39.7	173.5	-76	175.3	-178	-178.1	112.4	K30 Q31 K32 K38	K30-K34 WeakPolarHBondContact O-CB 3.47Å; K30-K34 VanDerWaalsContact O-CG 3.27Å; K30-K34 WeakPolarHBondContact O-CG 3.47Å; K30-K34 PolarHBondContact O-N 3.24Å; K30-K34 VanDerWaalsContact O-N 3.1Å; Q31-K34 PolarHBondContact O-N 2.89Å; K32-K34 PolarHBondContact O-N 3.17Å; K34-K38 WeakPolarHBondContact O-CB 3.26Å; K34-K38 VanDerWaalsContact O-CG 3.26Å; K34-K38 WeakPolarHBondContact O-CG 3.49Å; K34-K38 PolarHBondContact O-N 3.44Å
35	E	90.7	Very high	89	Confident	85 Å²	85	111.5 Å²	111.5	40%	0.397	53%	0.533	S	S	.	.	H	α-helix	trans	-68.5	-42.5	177.3	-73.4	178.8	-165	0	112.3	Q31 K32 K38 K39	Q31-E35 PolarHBondContact NE2-OE1 3.23Å; Q31-E35 WeakPolarHBondContact O-CG 3.4Å; Q31-E35 PolarHBondContact O-N 3.4Å; K32-E35 PolarHBondContact O-N 3.44Å; E35-K38 PolarHBondContact O-N 3.1Å; E35-K39 WeakPolarHBondContact O-CB 3.48Å; E35-K39 VanDerWaalsContact O-CG 3.26Å; E35-K39 WeakPolarHBondContact O-CG 3.22Å; E35-K39 PolarHBondContact O-N 3.49Å
36	E	91.5	Very high	88.8	Confident	119 Å²	119	111.6 Å²	111.6	56%	0.556	53%	0.532	S	S	*	.	H	α-helix	trans	-63.1	-44.8	174.5	-75.2	177.6	-176.8	0	111.5	K32 Q33 K38 K39 L40	K32-E36 WeakPolarHBondContact O-CB 3.28Å; K32-E36 WeakPolarHBondContact O-CG 3.47Å; K32-E36 PolarHBondContact O-N 2.84Å; Q33-E36 PolarHBondContact O-N 2.88Å; E36-K38 PolarHBondContact O-N 3.25Å; E36-K39 PolarHBondContact O-N 3.5Å; E36-L40 WeakPolarHBondContact O-CB 3.27Å; E36-L40 WeakPolarHBondContact O-CG 3.29Å; E36-L40 PolarHBondContact O-N 3.4Å
37	Q	91.7	Very high	88.2	Confident	107 Å²	107	111.8 Å²	111.8	50%	0.5	54%	0.539	S	S	.	.	H	α-helix	trans	-61.7	-44.9	176.2	-172.6	178.9	-8.9	0	111.6	Q33 K39 L40 E41	Q33-Q37 VanDerWaalsContact O-CB 3.28Å; Q33-Q37 WeakPolarHBondContact O-CB 3.37Å; Q33-Q37 PolarHBondContact O-N 2.94Å; Q37-K39 VanDerWaalsContact C-N 3.35Å; Q37-K39 PolarHBondContact O-N 3.44Å; Q37-L40 PolarHBondContact O-N 2.84Å; Q37-E41 PolarHBondContact NE2-OE1 3.26Å; Q37-E41 WeakPolarHBondContact O-CG 3.41Å; Q37-E41 PolarHBondContact O-N 3.06Å
38	K	91.7	Very high	87.4	Confident	145 Å²	145	110.4 Å²	110.4	63%	0.63	54%	0.542	S	S	*	.	H	α-helix	trans	-60.3	-42.8	174.9	-77.5	176.8	-179.5	-175.9	112.1	K34 E35 E36 L40 E41 V42	K34-K38 WeakPolarHBondContact O-CB 3.26Å; K34-K38 VanDerWaalsContact O-CG 3.26Å; K34-K38 WeakPolarHBondContact O-CG 3.49Å; K34-K38 PolarHBondContact O-N 3.44Å; E35-K38 PolarHBondContact O-N 3.1Å; E36-K38 PolarHBondContact O-N 3.25Å; K38-L40 VanDerWaalsContact C-N 3.35Å; K38-E41 PolarHBondContact O-N 2.99Å; K38-V42 VanDerWaalsContact O-CG2 3.31Å; K38-V42 WeakPolarHBondContact O-CG2 3.26Å; K38-V42 PolarHBondContact O-N 2.89Å
39	K	89.1	Confident	86.3	Confident	130 Å²	130	111.3 Å²	111.3	57%	0.565	56%	0.557	S	S	*	*	H	α-helix	trans	-62.1	-43.5	176	-73.6	168.5	-173.9	170.9	111	E35 E36 Q37 V42 L43	E35-K39 WeakPolarHBondContact O-CB 3.48Å; E35-K39 VanDerWaalsContact O-CG 3.26Å; E35-K39 WeakPolarHBondContact O-CG 3.22Å; E35-K39 PolarHBondContact O-N 3.49Å; E36-K39 PolarHBondContact O-N 3.5Å; Q37-K39 VanDerWaalsContact C-N 3.35Å; Q37-K39 PolarHBondContact O-N 3.44Å; K39-V42 PolarHBondContact O-N 3.21Å; K39-L43 WeakPolarHBondContact O-CB 3.44Å; K39-L43 VanDerWaalsContact O-CG 3.26Å; K39-L43 WeakPolarHBondContact O-CG 3.31Å; K39-L43 PolarHBondContact O-N 3.42Å
40	L	87.3	Confident	85.1	Confident	97 Å²	97	112.8 Å²	112.8	51%	0.508	56%	0.563	S	S	.	*	H	α-helix	trans	-65	-41.5	176.8	-74.4	172.3	0	0	112.5	E36 Q37 K38 L43 K44	E36-L40 WeakPolarHBondContact O-CB 3.27Å; E36-L40 WeakPolarHBondContact O-CG 3.29Å; E36-L40 PolarHBondContact O-N 3.4Å; Q37-L40 PolarHBondContact O-N 2.84Å; K38-L40 VanDerWaalsContact C-N 3.35Å; L40-L43 PolarHBondContact O-N 3.47Å; L40-K44 VanDerWaalsContact O-CB 3.29Å; L40-K44 WeakPolarHBondContact O-CB 3.43Å; L40-K44 VanDerWaalsContact O-CG 3.22Å; L40-K44 WeakPolarHBondContact O-CG 3.46Å; L40-K44 PolarHBondContact O-N 2.82Å
41	E	88.5	Confident	83.5	Confident	103 Å²	103	107.7 Å²	107.7	48%	0.481	54%	0.543	S	S	.	.	H	α-helix	trans	-64.5	-43.3	176.7	-77.3	174.7	-169.5	0	111.8	Q37 K38 K44 A45	Q37-E41 PolarHBondContact NE2-OE1 3.26Å; Q37-E41 WeakPolarHBondContact O-CG 3.41Å; Q37-E41 PolarHBondContact O-N 3.06Å; K38-E41 PolarHBondContact O-N 2.99Å; E41-K44 PolarHBondContact O-N 3.44Å; E41-A45 VanDerWaalsContact O-CB 3.25Å; E41-A45 WeakPolarHBondContact O-CB 3.26Å; E41-A45 PolarHBondContact O-N 3.48Å
42	V	86.9	Confident	82.1	Confident	78 Å²	78	107.7 Å²	107.7	47%	0.473	55%	0.554	S	S	.	*	H	α-helix	trans	-64.8	-41.6	175.8	172.3	0	0	0	111.3	K38 K39 A45 K46	K38-V42 VanDerWaalsContact O-CG2 3.31Å; K38-V42 WeakPolarHBondContact O-CG2 3.26Å; K38-V42 PolarHBondContact O-N 2.89Å; K39-V42 PolarHBondContact O-N 3.21Å; V42-A45 PolarHBondContact O-N 3.46Å; V42-K46 HydrophobicContact CG1-CD 4.34Å; V42-K46 WeakPolarHBondContact O-CB 3.26Å; V42-K46 VanDerWaalsContact O-CG 3.31Å; V42-K46 WeakPolarHBondContact O-CG 3.27Å; V42-K46 PolarHBondContact O-N 2.97Å
43	L	82.1	Confident	80.7	Confident	103 Å²	103	109.1 Å²	109.1	54%	0.539	57%	0.567	S	S	.	*	H	α-helix	trans	-64.4	-46.7	175.2	-72.6	171.4	0	0	111.3	K39 L40 A45 K46 V47	K39-L43 WeakPolarHBondContact O-CB 3.44Å; K39-L43 VanDerWaalsContact O-CG 3.26Å; K39-L43 WeakPolarHBondContact O-CG 3.31Å; K39-L43 PolarHBondContact O-N 3.42Å; L40-L43 PolarHBondContact O-N 3.47Å; L43-A45 PolarHBondContact O-N 2.93Å; L43-K46 PolarHBondContact O-N 3.48Å; L43-V47 VanDerWaalsContact O-CG2 3.27Å; L43-V47 WeakPolarHBondContact O-CG2 3.44Å; L43-V47 PolarHBondContact O-N 2.78Å
44	K	84.2	Confident	79.2	Confident	138 Å²	138	107.5 Å²	107.5	60%	0.6	57%	0.571	S	S	*	*	H	α-helix	trans	-58.9	-45.5	175	-76.4	175.3	-178.1	179.9	111.3	L40 E41 K46 V47 V48	L40-K44 VanDerWaalsContact O-CB 3.29Å; L40-K44 WeakPolarHBondContact O-CB 3.43Å; L40-K44 VanDerWaalsContact O-CG 3.22Å; L40-K44 WeakPolarHBondContact O-CG 3.46Å; L40-K44 PolarHBondContact O-N 2.82Å; E41-K44 PolarHBondContact O-N 3.44Å; K44-K46 PolarHBondContact O-N 3.19Å; K44-V47 CarbonylContact O-C 3.6Å; K44-V47 PolarHBondContact O-N 3.39Å; K44-V48 WeakPolarHBondContact O-CB 3.25Å; K44-V48 VanDerWaalsContact O-CG2 3.26Å; K44-V48 WeakPolarHBondContact O-CG2 3.31Å; K44-V48 PolarHBondContact O-N 2.79Å
45	A	80.8	Confident	77.8	Confident	62 Å²	62	106.8 Å²	106.8	51%	0.512	58%	0.579	S	S	.	*	H	α-helix	trans	-62.8	-41.2	177.5	0	0	0	0	112.1	E41 V42 L43 V48 G49	E41-A45 VanDerWaalsContact O-CB 3.25Å; E41-A45 WeakPolarHBondContact O-CB 3.26Å; E41-A45 PolarHBondContact O-N 3.48Å; V42-A45 PolarHBondContact O-N 3.46Å; L43-A45 PolarHBondContact O-N 2.93Å; A45-V48 PolarHBondContact O-N 2.99Å; A45-G49 PolarHBondContact O-N 2.76Å
46	K	79	Confident	76.2	Confident	141 Å²	141	105.3 Å²	105.3	61%	0.613	59%	0.586	S	S	*	*	H	α-helix	trans	-61.9	-42.3	172.7	-75.4	176.7	-179	-176.7	111.8	V42 L43 K44 K50	V42-K46 HydrophobicContact CG1-CD 4.34Å; V42-K46 WeakPolarHBondContact O-CB 3.26Å; V42-K46 VanDerWaalsContact O-CG 3.31Å; V42-K46 WeakPolarHBondContact O-CG 3.27Å; V42-K46 PolarHBondContact O-N 2.97Å; L43-K46 PolarHBondContact O-N 3.48Å; K44-K46 PolarHBondContact O-N 3.19Å; K46-K50 VanDerWaalsContact O-CB 3.23Å; K46-K50 WeakPolarHBondContact O-CB 3.23Å; K46-K50 PolarHBondContact O-N 3.5Å
47	V	77.4	Confident	74.9	Confident	102 Å²	102	102.9 Å²	102.9	62%	0.618	59%	0.593	S	S	*	*	H	α-helix	trans	-68.7	-40.2	178.1	173.2	0	0	0	111.5	L43 K44 K50 G51	L43-V47 VanDerWaalsContact O-CG2 3.27Å; L43-V47 WeakPolarHBondContact O-CG2 3.44Å; L43-V47 PolarHBondContact O-N 2.78Å; K44-V47 CarbonylContact O-C 3.6Å; K44-V47 PolarHBondContact O-N 3.39Å; V47-K50 CarbonylContact O-C 3.32Å; V47-K50 VanDerWaalsContact O-C 3.32Å; V47-G51 WeakPolarHBondContact O-CA 3.45Å; V47-G51 PolarHBondContact O-N 2.95Å
48	V	72.7	Confident	73.6	Confident	117 Å²	117	105 Å²	105	71%	0.709	61%	0.606	S	S	*	*	H	α-helix	trans	-69	-45.3	176.4	172.1	0	0	0	110.9	K44 A45 K50 G51	K44-V48 WeakPolarHBondContact O-CB 3.25Å; K44-V48 VanDerWaalsContact O-CG2 3.26Å; K44-V48 WeakPolarHBondContact O-CG2 3.31Å; K44-V48 PolarHBondContact O-N 2.79Å; A45-V48 PolarHBondContact O-N 2.99Å; V48-K50 VanDerWaalsContact C-N 3.28Å; V48-K50 PolarHBondContact O-N 2.88Å; V48-G51 WeakPolarHBondContact O-CA 3.12Å; V48-G51 PolarHBondContact O-N 2.81Å
49	G	65.7	Low	72.2	Confident	64 Å²	64	107.1 Å²	107.1	66%	0.66	62%	0.615	S	S	*	*	H	α-helix	trans	-66.3	-29.2	177.7	0	0	0	0	113.3	A45	A45-G49 PolarHBondContact O-N 2.76Å
50	K	64.2	Low	71	Confident	164 Å²	164	110.4 Å²	110.4	71%	0.713	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.9	14.1	169.5	-156.1	66.2	177.3	-176.8	112.6	K46 V47 V48	K46-K50 VanDerWaalsContact O-CB 3.23Å; K46-K50 WeakPolarHBondContact O-CB 3.23Å; K46-K50 PolarHBondContact O-N 3.5Å; V47-K50 CarbonylContact O-C 3.32Å; V47-K50 VanDerWaalsContact O-C 3.32Å; V48-K50 VanDerWaalsContact C-N 3.28Å; V48-K50 PolarHBondContact O-N 2.88Å
51	G	59.3	Low	69.8	Low	10 Å²	10	110.9 Å²	110.9	10%	0.103	64%	0.641	C	S	.	*	S	Bend	trans	-61.6	166.3	-175.1	0	0	0	0	111.4	V47 V48 L53 A54	V47-G51 WeakPolarHBondContact O-CA 3.45Å; V47-G51 PolarHBondContact O-N 2.95Å; V48-G51 WeakPolarHBondContact O-CA 3.12Å; V48-G51 PolarHBondContact O-N 2.81Å; G51-L53 PolarHBondContact O-N 2.81Å; G51-A54 PolarHBondContact O-N 3.4Å
52	P	63.1	Low	68.8	Low	120 Å²	120	109.2 Å²	109.2	78%	0.779	65%	0.651	S	S	*	*	G	3₁₀ helix	trans	-54.6	-13	-172.6	18.7	-30.8	0	0	115	A54 G56	P52-A54 VanDerWaalsContact C-N 3.33Å; P52-G56 PolarHBondContact O-N 2.93Å
53	L	63.1	Low	67.3	Low	166 Å²	166	114.9 Å²	114.9	87%	0.869	67%	0.67	S	S	*	*	G	3₁₀ helix	trans	-65.4	-30.4	171.8	-56	-179.1	0	0	113.5	G51 T55	G51-L53 PolarHBondContact O-N 2.81Å; L53-T55 VanDerWaalsContact C-N 3.3Å; L53-T55 PolarHBondContact O-N 2.82Å
54	A	61.7	Low	66	Low	69 Å²	69	123.2 Å²	123.2	57%	0.57	70%	0.702	S	S	*	*	G	3₁₀ helix	trans	-75.2	-16.3	-179	0	0	0	0	113.7	G51 P52	G51-A54 PolarHBondContact O-N 3.4Å; P52-A54 VanDerWaalsContact C-N 3.33Å
55	T	62.8	Low	65.1	Low	123 Å²	123	122.5 Å²	122.5	76%	0.755	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	-117.2	-7.8	-171.6	-37.8	0	0	0	113.8	L53	L53-T55 VanDerWaalsContact C-N 3.3Å; L53-T55 PolarHBondContact O-N 2.82Å
56	G	56.8	Low	64.3	Low	53 Å²	53	125.7 Å²	125.7	55%	0.546	72%	0.717	S	S	.	*			trans	-132.1	29.1	-164.2	0	0	0	0	115.4	P52 I58	P52-G56 PolarHBondContact O-N 2.93Å; G56-I58 PolarHBondContact O-N 3.42Å
57	G	65.2	Low	63.4	Low	68 Å²	68	124.8 Å²	124.8	70%	0.701	72%	0.723	S	S	*	*			trans	-63.2	92.8	154.7	0	0	0	0	106.4	K59	G57-K59 PolarHBondContact O-N 2.75Å
58	I	64.7	Low	62.6	Low	151 Å²	151	126.2 Å²	126.2	77%	0.774	73%	0.729	S	S	*	*			trans	-42.6	105.9	156.8	-78.2	168.8	0	0	103.3	G56 K60	G56-I58 PolarHBondContact O-N 3.42Å; I58-K60 PolarHBondContact O-N 2.81Å
59	K	62.4	Low	62	Low	190 Å²	190	126.8 Å²	126.8	83%	0.826	73%	0.73	S	S	*	*			trans	-52.3	107.4	161.2	-73.5	-178.9	-179.9	-179	101.2	G57 S61	G57-K59 PolarHBondContact O-N 2.75Å; K59-S61 PolarHBondContact O-N 2.64Å
60	K	62.7	Low	61.7	Low	200 Å²	200	130.9 Å²	130.9	87%	0.87	74%	0.735	S	S	*	*			trans	-56.9	90.9	165.8	-79.7	-170.7	-175.8	-179.5	102.9	I58 G62	I58-K60 PolarHBondContact O-N 2.81Å; K60-G62 PolarHBondContact O-N 3.1Å
61	S	62.1	Low	61.6	Low	107 Å²	107	128.6 Å²	128.6	75%	0.748	74%	0.736	S	S	*	*			trans	-63.8	78.9	154.1	54.4	0	0	0	103.1	K59 K63	K59-S61 PolarHBondContact O-N 2.64Å; S61-K63 PolarHBondContact O-N 2.77Å
62	G	67.6	Low	61.7	Low	68 Å²	68	137.7 Å²	137.7	70%	0.701	79%	0.785	S	S	*	*			trans	-61.9	87.1	162.2	0	0	0	0	104.7	K60 K64	K60-G62 PolarHBondContact O-N 3.1Å; G62-K64 VanDerWaalsContact C-N 3.32Å; G62-K64 PolarHBondContact O-N 2.76Å; G62-K64 VanDerWaalsContact O-N 3.1Å
63	K	55.7	Low	61.6	Low	197 Å²	197	139.2 Å²	139.2	86%	0.857	79%	0.785	S	S	*	*			trans	-70	94.5	169.9	-175.7	168.3	-174.1	178	105.5	S61	S61-K63 PolarHBondContact O-N 2.77Å
64	K	54.8	Low	61.5	Low	278 Å²	278	136.7 Å²	136.7	100%	1.209	78%	0.778	S	S	*	*			trans	166.8	0	151.1	-94.6	177.3	-173.8	-177.5	109.3	G62	G62-K64 VanDerWaalsContact C-N 3.32Å; G62-K64 PolarHBondContact O-N 2.76Å; G62-K64 VanDerWaalsContact O-N 3.1Å

Retrieved 64 of 64 residues in 64.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).