A0A024R3B9_HUMAN Loading...

Alpha-crystallin B chain

May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions. In lens epithelial cells, stabilizes the ATP6V1A protein, preventing its degradation by the proteasome.

AlphaFold DB , UniProt , Accession A0A024R3B9, Species HUMAN (Homo sapiens, Human), Gene CRYAB, Length 108 aa.

						>A0A024R3B9_HUMAN|A0A024R3B9|CRYAB
MRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.4	Very low	73.2	Confident	183 Å²	183	102.4 Å²	102.4	90%	0.901	48%	0.476	S	S	*	.				0	109.5	0	-155.7	-179.9	-160.8	0	0	106.8	L3 F8	M1-L3 HydrophobicContact CG-CG 4.49Å; M1-F8 HydrophobicContact CE-CE2 4.41Å
2	R	41.1	Very low	75.3	Confident	217 Å²	217	94.1 Å²	94.1	82%	0.819	44%	0.438	S	S	*	.			trans	-95.6	98.7	178.3	-137.3	-179.5	-171.2	174.6	1.8	106.4	E4	R2-E4 VanDerWaalsContact C-N 3.34Å; R2-E4 PolarHBondContact O-N 3.34Å
3	L	47.7	Very low	77	Confident	93 Å²	93	94.2 Å²	94.2	49%	0.487	44%	0.443	S	S	.	.			trans	-84.8	85.3	174	-68.8	159.2	0	0	0	106.6	M1 K5	M1-L3 HydrophobicContact CG-CG 4.49Å; L3-K5 PolarHBondContact O-N 3.41Å
4	E	59.3	Low	78.5	Confident	95 Å²	95	87.8 Å²	87.8	44%	0.444	41%	0.413	S	S	.	.	B	Isolated β-bridge	trans	-58.3	131.7	157.9	-72.5	169.4	178.4	0	0	106.2	R2 D6 R7	R2-E4 VanDerWaalsContact C-N 3.34Å; R2-E4 PolarHBondContact O-N 3.34Å; E4-D6 PolarHBondContact O-N 3.18Å; E4-R7 PolarHBondContact O-N 3.19Å; E4-R7 IonicContact OE2-CZ 3.77Å; E4-R7 IonicContact OE2-NE 3.63Å; E4-R7 PolarHBondContact OE2-NE 3.42Å; E4-R7 IonicContact OE2-NH2 3.69Å; E4-R7 PolarHBondContact OE2-NH2 3.4Å
5	K	66.6	Low	79.6	Confident	190 Å²	190	89.9 Å²	89.9	83%	0.826	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	-48.8	-29.5	-168.6	-96.7	-179.6	173.2	-178.3	0	113.5	L3	L3-K5 PolarHBondContact O-N 3.41Å
6	D	81.1	Confident	80.5	Confident	87 Å²	87	90.3 Å²	90.3	47%	0.465	42%	0.422	S	S	.	.	T	Hydrogen-bonded Turn	trans	-111.4	3.2	-170.9	-46.8	-55.6	0	0	0	114.1	E4 R82 Q84	E4-D6 PolarHBondContact O-N 3.18Å; D6-R82 PolarHBondContact O-N 3.17Å; D6-Q84 PolarHBondContact OD1-NE2 2.94Å
7	R	86.6	Confident	81.4	Confident	106 Å²	106	86.7 Å²	86.7	40%	0.4	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.5	136.7	-174.9	-166.2	170.1	59.9	162	-2.1	114.1	E4 G80	E4-R7 PolarHBondContact O-N 3.19Å; E4-R7 IonicContact OE2-CZ 3.77Å; E4-R7 IonicContact OE2-NE 3.63Å; E4-R7 PolarHBondContact OE2-NE 3.42Å; E4-R7 IonicContact OE2-NH2 3.69Å; E4-R7 PolarHBondContact OE2-NH2 3.4Å; R7-G80 WeakPolarHBondContact CG-O 3.26Å
8	F	92.9	Very high	82.2	Confident	3 Å²	3	83.9 Å²	83.9	1%	0.013	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93	134.5	166.1	165.2	-97.1	0	0	0	109	M1 V10 I31 P58 V61 N79 G80 R82	M1-F8 HydrophobicContact CE-CE2 4.41Å; F8-V10 HydrophobicContact CE1-CG2 4.23Å; F8-V10 HydrophobicContact CE2-CG2 4.02Å; F8-V10 HydrophobicContact CZ-CG2 3.55Å; F8-I31 HydrophobicContact CE1-CD1 3.54Å; F8-I31 HydrophobicContact CZ-CD1 3.95Å; F8-P58 HydrophobicContact CD2-CG 3.61Å; F8-P58 HydrophobicContact CE2-CG 4.08Å; F8-P58 HydrophobicContact CG-CG 4.28Å; F8-V61 HydrophobicContact CB-CG2 3.5Å; F8-V61 HydrophobicContact CG-CG2 4.14Å; F8-N79 CarbonylContact O-C 3.58Å; F8-N79 WeakPolarHBondContact O-CA 3.47Å; F8-N79 VanDerWaalsContact O-CB 3.31Å; F8-N79 WeakPolarHBondContact O-CB 3.47Å; F8-G80 PolarHBondContact N-O 2.89Å; F8-G80 PolarHBondContact O-N 3.02Å; F8-R82 HydrophobicContact CB-CG 4.16Å
9	S	95.3	Very high	82.9	Confident	33 Å²	33	83.7 Å²	83.7	23%	0.231	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.8	138.3	179	176.4	0	0	0	0	111.7	N11 V78	S9-N11 PolarHBondContact OG-OD1 3.23Å; S9-V78 WeakPolarHBondContact CA-O 3.39Å
10	V	96.2	Very high	83.6	Confident	17 Å²	17	87.4 Å²	87.4	10%	0.103	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	132.1	172	177.6	0	0	0	0	108.1	F8 L12 Y55 T77 V78	F8-V10 HydrophobicContact CE1-CG2 4.23Å; F8-V10 HydrophobicContact CE2-CG2 4.02Å; F8-V10 HydrophobicContact CZ-CG2 3.55Å; V10-L12 HydrophobicContact CG1-CG 4.36Å; V10-Y55 HydrophobicContact CG1-CD1 3.89Å; V10-Y55 HydrophobicContact CG1-CD2 4.04Å; V10-Y55 HydrophobicContact CG1-CE1 3.58Å; V10-Y55 HydrophobicContact CG1-CE2 3.74Å; V10-Y55 HydrophobicContact CG1-CG 4.11Å; V10-Y55 HydrophobicContact CG2-CD1 3.9Å; V10-Y55 HydrophobicContact CG2-CE1 4.36Å; V10-Y55 HydrophobicContact CG2-CG 4.06Å; V10-T77 WeakPolarHBondContact O-CA 3.26Å; V10-V78 PolarHBondContact N-O 2.98Å; V10-V78 PolarHBondContact O-N 3.1Å
11	N	97.3	Very high	84.3	Confident	102 Å²	102	84.5 Å²	84.5	55%	0.545	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	135.9	178.3	-60.5	-15.1	0	0	0	109.7	S9 V75 L76 T77	S9-N11 PolarHBondContact OG-OD1 3.23Å; N11-V75 HydrophobicContact CB-CG1 4.03Å; N11-L76 CarbonylContact C-O 3.59Å; N11-L76 WeakPolarHBondContact CA-O 3.31Å; N11-T77 WeakPolarHBondContact OD1-CG2 3.37Å; N11-T77 PolarHBondContact OD1-OG1 3.43Å
12	L	97.8	Very high	87	Confident	3 Å²	3	77.1 Å²	77.1	2%	0.016	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	121.4	-176	-68.9	173.1	0	0	0	109.5	V10 V14 V33 Y55 V75 L76	V10-L12 HydrophobicContact CG1-CG 4.36Å; L12-V14 HydrophobicContact CB-CG1 3.98Å; L12-V14 PolarHBondContact O-N 2.86Å; L12-V33 HydrophobicContact CD1-CB 4.08Å; L12-V33 HydrophobicContact CD1-CG1 3.89Å; L12-V33 HydrophobicContact CD1-CG2 3.91Å; L12-Y55 HydrophobicContact CD1-CE2 4.2Å; L12-Y55 HydrophobicContact CD2-CE2 4.27Å; L12-Y55 WeakPolarHBondContact CD2-OH 3.18Å; L12-V75 CarbonylContact O-C 3.51Å; L12-V75 WeakPolarHBondContact O-CA 3.36Å; L12-L76 HydrophobicContact CB-CB 4.22Å; L12-L76 HydrophobicContact CD1-CD2 4.11Å; L12-L76 PolarHBondContact N-O 3.06Å; L12-L76 PolarHBondContact O-N 2.87Å
13	D	97.7	Very high	89.7	Confident	96 Å²	96	72.2 Å²	72.2	51%	0.513	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.8	114.6	165.1	-178	-7.1	0	0	0	108.5	K15	D13-K15 WeakPolarHBondContact OD1-CD 3.4Å; D13-K15 VanDerWaalsContact OD1-CG 3.3Å; D13-K15 WeakPolarHBondContact OD1-CG 3.35Å; D13-K15 PolarHBondContact OD1-N 3.22Å; D13-K15 IonicContact OD1-NZ 2.87Å; D13-K15 IonicContact OD2-NZ 2.76Å; D13-K15 PolarHBondContact OD2-NZ 3.31Å
14	V	97.8	Very high	92.1	Very high	4 Å²	4	70 Å²	70	2%	0.024	35%	0.345	C	S	.	.			trans	-130.2	22.9	-178.4	-63	0	0	0	0	111.4	L12 H16 F17 L22 F51 L70 G74 L76	L12-V14 HydrophobicContact CB-CG1 3.98Å; L12-V14 PolarHBondContact O-N 2.86Å; V14-H16 PolarHBondContact O-N 2.65Å; V14-F17 HydrophobicContact CB-CD2 4.35Å; V14-F17 PolarHBondContact O-N 3.01Å; V14-L22 HydrophobicContact CB-CD1 4.17Å; V14-L22 HydrophobicContact CB-CD2 4.26Å; V14-L22 HydrophobicContact CG1-CD2 4.26Å; V14-L22 HydrophobicContact CG2-CD1 3.75Å; V14-F51 HydrophobicContact CG1-CE1 4.1Å; V14-F51 HydrophobicContact CG1-CZ 3.88Å; V14-L70 HydrophobicContact CG2-CD1 3.59Å; V14-G74 CarbonylContact C-O 3.58Å; V14-G74 VanDerWaalsContact CG2-O 3.29Å; V14-G74 WeakPolarHBondContact CG2-O 3.48Å; V14-G74 PolarHBondContact N-O 2.87Å; V14-L76 HydrophobicContact CG1-CB 4.28Å; V14-L76 HydrophobicContact CG2-CB 3.71Å
15	K	95.9	Very high	94	Very high	120 Å²	120	70 Å²	70	52%	0.522	34%	0.343	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.9	-14.5	-175.8	71.2	-166.2	170.1	-141.5	0	116.1	D13 G74	D13-K15 WeakPolarHBondContact OD1-CD 3.4Å; D13-K15 VanDerWaalsContact OD1-CG 3.3Å; D13-K15 WeakPolarHBondContact OD1-CG 3.35Å; D13-K15 PolarHBondContact OD1-N 3.22Å; D13-K15 IonicContact OD1-NZ 2.87Å; D13-K15 IonicContact OD2-NZ 2.76Å; D13-K15 PolarHBondContact OD2-NZ 3.31Å; K15-G74 PolarHBondContact N-O 3.04Å
16	H	93.9	Very high	95.5	Very high	96 Å²	96	63.8 Å²	63.8	44%	0.444	32%	0.321	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.3	5.8	177.2	-57.6	-59.7	0	0	0	113.9	V14	V14-H16 PolarHBondContact O-N 2.65Å
17	F	96	Very high	96.2	Very high	29 Å²	29	64 Å²	64	13%	0.127	32%	0.322	C	S	.	.	S	Bend	trans	-126.2	139.7	-179.2	-61.7	-93.7	0	0	0	109.8	V14 E21 L22 H37 R49 F51	V14-F17 HydrophobicContact CB-CD2 4.35Å; V14-F17 PolarHBondContact O-N 3.01Å; F17-E21 WeakPolarHBondContact CA-OE2 3.42Å; F17-E21 HydrophobicContact CB-CB 4.36Å; F17-E21 HydrophobicContact CD1-CB 4.34Å; F17-L22 HydrophobicContact CB-CD1 4.39Å; F17-L22 HydrophobicContact CB-CD2 3.79Å; F17-L22 HydrophobicContact CB-CG 3.98Å; F17-L22 HydrophobicContact CG-CD2 4.08Å; F17-H37 HydrophobicContact CD1-CB 4.01Å; F17-H37 HydrophobicContact CE1-CB 3.94Å; F17-R49 HydrophobicContact CE1-CB 4.06Å; F17-R49 WeakPolarHBondContact CE1-O 3.3Å; F17-R49 HydrophobicContact CZ-CB 3.67Å; F17-F51 HydrophobicContact CD2-CD1 4.43Å; F17-F51 HydrophobicContact CD2-CE1 4Å; F17-F51 HydrophobicContact CE1-CD1 4.21Å; F17-F51 HydrophobicContact CE1-CE1 4.35Å; F17-F51 AromaticContact CE2-CD1 3.69Å; F17-F51 HydrophobicContact CE2-CD1 3.69Å; F17-F51 AromaticContact CE2-CE1 3.73Å; F17-F51 HydrophobicContact CE2-CE1 3.73Å; F17-F51 HydrophobicContact CG-CE1 4.45Å; F17-F51 AromaticContact CZ-CD1 3.57Å; F17-F51 HydrophobicContact CZ-CD1 3.57Å; F17-F51 AromaticContact CZ-CE1 3.92Å; F17-F51 HydrophobicContact CZ-CE1 3.92Å
18	S	94.6	Very high	96.6	Very high	37 Å²	37	62 Å²	62	26%	0.259	33%	0.333	S	S	.	.			trans	-76.8	160.5	168.5	86	0	0	0	0	110.8	E20 E21	S18-E20 VanDerWaalsContact CB-OE2 3.23Å; S18-E20 WeakPolarHBondContact CB-OE2 3.39Å; S18-E20 PolarHBondContact O-N 3Å; S18-E20 VanDerWaalsContact O-N 3.16Å; S18-E20 PolarHBondContact OG-OE2 3.29Å; S18-E21 PolarHBondContact N-OE2 3.49Å; S18-E21 WeakPolarHBondContact O-CB 3.45Å; S18-E21 PolarHBondContact O-N 3.05Å
19	P	96.3	Very high	96.7	Very high	79 Å²	79	65 Å²	65	51%	0.513	35%	0.35	S	S	.	.	G	3₁₀ helix	trans	-53.8	-35.1	176.8	-22.1	29.6	0	0	0	113.4	E21 L22 L70	P19-E21 VanDerWaalsContact C-N 3.29Å; P19-E21 PolarHBondContact O-N 3.05Å; P19-L22 PolarHBondContact O-N 2.62Å; P19-L70 HydrophobicContact CB-CD2 4.29Å; P19-L70 HydrophobicContact CG-CD2 3.93Å
20	E	97.1	Very high	96.9	Very high	158 Å²	158	64.9 Å²	64.9	74%	0.738	35%	0.348	S	S	*	.	G	3₁₀ helix	trans	-73	-21.4	-178.3	-54.6	72.4	-154	0	0	112.9	S18 L22	S18-E20 VanDerWaalsContact CB-OE2 3.23Å; S18-E20 WeakPolarHBondContact CB-OE2 3.39Å; S18-E20 PolarHBondContact O-N 3Å; S18-E20 VanDerWaalsContact O-N 3.16Å; S18-E20 PolarHBondContact OG-OE2 3.29Å; E20-L22 VanDerWaalsContact C-N 3.31Å
21	E	97.3	Very high	97	Very high	26 Å²	26	64.1 Å²	64.1	12%	0.121	34%	0.343	C	S	.	.	G	3₁₀ helix	trans	-86	-6.4	177.1	-67.4	178.6	149.1	0	0	112.7	F17 S18 P19 G35 K36 H37 R40	F17-E21 WeakPolarHBondContact CA-OE2 3.42Å; F17-E21 HydrophobicContact CB-CB 4.36Å; F17-E21 HydrophobicContact CD1-CB 4.34Å; S18-E21 PolarHBondContact N-OE2 3.49Å; S18-E21 WeakPolarHBondContact O-CB 3.45Å; S18-E21 PolarHBondContact O-N 3.05Å; P19-E21 VanDerWaalsContact C-N 3.29Å; P19-E21 PolarHBondContact O-N 3.05Å; E21-G35 WeakPolarHBondContact O-CA 3.49Å; E21-K36 WeakPolarHBondContact CB-O 3.46Å; E21-K36 PolarHBondContact O-N 2.87Å; E21-H37 VanDerWaalsContact CD-ND1 3.28Å; E21-H37 IonicContact OE1-CE1 2.83Å; E21-H37 IonicContact OE1-CG 2.81Å; E21-H37 IonicContact OE1-ND1 3.69Å; E21-H37 PolarHBondContact OE1-ND1 3.36Å; E21-H37 IonicContact OE2-CG 3.61Å; E21-H37 IonicContact OE2-ND1 3.84Å; E21-H37 PolarHBondContact OE2-ND1 3.4Å; E21-R40 IonicContact OE1-CZ 3.32Å; E21-R40 IonicContact OE1-NE 3.64Å; E21-R40 IonicContact OE1-NH2 2.66Å; E21-R40 PolarHBondContact OE1-NH2 2.87Å
22	L	98.4	Very high	97	Very high	28 Å²	28	61.6 Å²	61.6	15%	0.147	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.2	138.5	-178.5	-63.4	171.8	0	0	0	110.9	V14 F17 P19 E20 H34 F51 L70	V14-L22 HydrophobicContact CB-CD1 4.17Å; V14-L22 HydrophobicContact CB-CD2 4.26Å; V14-L22 HydrophobicContact CG1-CD2 4.26Å; V14-L22 HydrophobicContact CG2-CD1 3.75Å; F17-L22 HydrophobicContact CB-CD1 4.39Å; F17-L22 HydrophobicContact CB-CD2 3.79Å; F17-L22 HydrophobicContact CB-CG 3.98Å; F17-L22 HydrophobicContact CG-CD2 4.08Å; P19-L22 PolarHBondContact O-N 2.62Å; E20-L22 VanDerWaalsContact C-N 3.31Å; L22-H34 CarbonylContact C-O 3.52Å; L22-H34 WeakPolarHBondContact CA-O 3.33Å; L22-F51 HydrophobicContact CD2-CE1 3.98Å; L22-F51 HydrophobicContact CD2-CZ 3.95Å; L22-L70 HydrophobicContact CD1-CD2 4.12Å
23	K	98.4	Very high	97.1	Very high	115 Å²	115	61.5 Å²	61.5	50%	0.5	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.2	123.8	175.4	-165.2	169.9	-164	167.8	0	110.2	K25 V33 H34	K23-K25 HydrophobicContact CG-CG 4.39Å; K23-V33 WeakPolarHBondContact O-CA 3.27Å; K23-H34 HydrophobicContact CB-CB 4.47Å; K23-H34 PolarHBondContact N-O 2.81Å; K23-H34 PolarHBondContact O-N 2.78Å
24	V	98.3	Very high	97.1	Very high	47 Å²	47	59.5 Å²	59.5	29%	0.285	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.1	131.7	172.9	-175.1	0	0	0	0	108.5	I31 E32 V33 L76 V78	V24-I31 HydrophobicContact CG1-CG2 4.03Å; V24-E32 CarbonylContact C-O 3.54Å; V24-E32 WeakPolarHBondContact CA-O 3.15Å; V24-V33 HydrophobicContact CG2-CG1 4.37Å; V24-V33 HydrophobicContact CG2-CG2 4.38Å; V24-L76 HydrophobicContact CG2-CD1 4.48Å; V24-L76 HydrophobicContact CG2-CD2 4.04Å; V24-V78 HydrophobicContact CG1-CG2 4.24Å; V24-V78 HydrophobicContact CG2-CG2 4.5Å
25	K	98.2	Very high	97.1	Very high	93 Å²	93	59.3 Å²	59.3	40%	0.404	31%	0.314	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133	148.5	175.2	-65.5	178.5	-177.9	174	0	110.3	K23 I31 E32	K23-K25 HydrophobicContact CG-CG 4.39Å; K25-I31 CarbonylContact O-C 3.58Å; K25-I31 WeakPolarHBondContact O-CA 3.44Å; K25-E32 PolarHBondContact N-O 2.98Å; K25-E32 PolarHBondContact O-N 2.79Å
26	V	97.9	Very high	97.2	Very high	60 Å²	60	57.8 Å²	57.8	36%	0.364	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	121.7	167.1	176.7	0	0	0	0	107.6	V30 I31 I57 P63 I66	V26-V30 WeakPolarHBondContact CA-O 3.36Å; V26-I31 HydrophobicContact CG2-CG1 4.28Å; V26-I57 HydrophobicContact CG1-CD1 3.78Å; V26-P63 HydrophobicContact CG1-CB 3.8Å; V26-I66 HydrophobicContact CG2-CB 4.34Å; V26-I66 HydrophobicContact CG2-CD1 4.17Å; V26-I66 HydrophobicContact CG2-CG2 4.24Å
27	L	96.6	Very high	97.3	Very high	92 Å²	92	54.3 Å²	54.3	48%	0.482	29%	0.291	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	97.7	179	-61.1	179.6	0	0	0	108.2	D29 V30 E32	L27-D29 PolarHBondContact O-N 2.88Å; L27-D29 VanDerWaalsContact O-N 3.1Å; L27-V30 PolarHBondContact N-O 2.99Å; L27-V30 PolarHBondContact O-N 2.91Å; L27-V30 VanDerWaalsContact O-N 3.12Å; L27-E32 VanDerWaalsContact CD1-CD 3.49Å; L27-E32 HydrophobicContact CD1-CG 4.21Å; L27-E32 WeakPolarHBondContact CD1-OE2 3.43Å
28	G	94.9	Very high	97.2	Very high	63 Å²	63	59 Å²	59	65%	0.649	31%	0.314	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.2	-111.7	-173.1	0	0	0	0	0	111.2
29	D	95.8	Very high	97.2	Very high	68 Å²	68	64.1 Å²	64.1	36%	0.364	33%	0.333	S	S	.	.	T	Hydrogen-bonded Turn	trans	-107.1	21.5	-179.4	62.6	4.2	0	0	0	113.1	L27 R56 I57	L27-D29 PolarHBondContact O-N 2.88Å; L27-D29 VanDerWaalsContact O-N 3.1Å; D29-R56 IonicContact OD1-CZ 3.72Å; D29-R56 IonicContact OD1-NH1 2.87Å; D29-R56 PolarHBondContact OD1-NH1 2.83Å; D29-R56 IonicContact OD1-NH2 3.94Å; D29-R56 IonicContact OD2-CZ 3.03Å; D29-R56 IonicContact OD2-NH1 3.6Å; D29-R56 PolarHBondContact OD2-NH1 3.18Å; D29-R56 IonicContact OD2-NH2 2.62Å; D29-R56 PolarHBondContact OD2-NH2 3.29Å; D29-I57 WeakPolarHBondContact O-CB 3.44Å; D29-I57 PolarHBondContact O-N 2.83Å
30	V	97.8	Very high	96.9	Very high	30 Å²	30	66.5 Å²	66.5	18%	0.182	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	132.4	177.3	179	0	0	0	0	110.6	V26 L27 E32 K54 Y55	V26-V30 WeakPolarHBondContact CA-O 3.36Å; L27-V30 PolarHBondContact N-O 2.99Å; L27-V30 PolarHBondContact O-N 2.91Å; L27-V30 VanDerWaalsContact O-N 3.12Å; V30-E32 HydrophobicContact CG1-CG 4.2Å; V30-K54 HydrophobicContact CG1-CB 3.9Å; V30-K54 HydrophobicContact CG1-CD 4.27Å; V30-K54 HydrophobicContact CG1-CG 4.43Å; V30-Y55 CarbonylContact C-O 3.53Å; V30-Y55 WeakPolarHBondContact CA-O 3.39Å
31	I	98.4	Very high	96.5	Very high	1 Å²	1	66.3 Å²	66.3	1%	0.005	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	127.8	163.3	-61.9	154	0	0	0	107.9	F8 V24 K25 V26 V33 K54 Y55 I57 I66 V78	F8-I31 HydrophobicContact CE1-CD1 3.54Å; F8-I31 HydrophobicContact CZ-CD1 3.95Å; V24-I31 HydrophobicContact CG1-CG2 4.03Å; K25-I31 CarbonylContact O-C 3.58Å; K25-I31 WeakPolarHBondContact O-CA 3.44Å; V26-I31 HydrophobicContact CG2-CG1 4.28Å; I31-V33 HydrophobicContact CG2-CG2 4.04Å; I31-K54 CarbonylContact O-C 3.56Å; I31-K54 VanDerWaalsContact O-CA 3.27Å; I31-K54 WeakPolarHBondContact O-CA 3.19Å; I31-Y55 PolarHBondContact N-O 3.29Å; I31-Y55 PolarHBondContact O-N 2.79Å; I31-I57 HydrophobicContact CD1-CG1 3.99Å; I31-I57 HydrophobicContact CG1-CD1 3.98Å; I31-I57 HydrophobicContact CG1-CG1 3.81Å; I31-I66 HydrophobicContact CD1-CD1 4.03Å; I31-I66 HydrophobicContact CD1-CG2 4.42Å; I31-I66 HydrophobicContact CG1-CD1 4.05Å; I31-V78 HydrophobicContact CD1-CG1 3.82Å; I31-V78 HydrophobicContact CG1-CG1 4.45Å; I31-V78 HydrophobicContact CG2-CG1 4.19Å
32	E	98.6	Very high	95.7	Very high	48 Å²	48	68 Å²	68	22%	0.224	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	128.1	168.9	-58.1	-168.2	153.6	0	0	109.7	V24 K25 L27 V30 K54	V24-E32 CarbonylContact C-O 3.54Å; V24-E32 WeakPolarHBondContact CA-O 3.15Å; K25-E32 PolarHBondContact N-O 2.98Å; K25-E32 PolarHBondContact O-N 2.79Å; L27-E32 VanDerWaalsContact CD1-CD 3.49Å; L27-E32 HydrophobicContact CD1-CG 4.21Å; L27-E32 WeakPolarHBondContact CD1-OE2 3.43Å; V30-E32 HydrophobicContact CG1-CG 4.2Å; E32-K54 HydrophobicContact CG-CD 4.15Å; E32-K54 HydrophobicContact CG-CG 4.14Å; E32-K54 WeakPolarHBondContact OE1-CE 3.41Å; E32-K54 IonicContact OE1-NZ 3.49Å; E32-K54 PolarHBondContact OE1-NZ 3.05Å
33	V	98.6	Very high	94.9	Very high	1 Å²	1	75.5 Å²	75.5	1%	0.006	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.5	118.9	171.8	-171.6	0	0	0	0	108.1	L12 K23 V24 I31 F51 R53 L76	L12-V33 HydrophobicContact CD1-CB 4.08Å; L12-V33 HydrophobicContact CD1-CG1 3.89Å; L12-V33 HydrophobicContact CD1-CG2 3.91Å; K23-V33 WeakPolarHBondContact O-CA 3.27Å; V24-V33 HydrophobicContact CG2-CG1 4.37Å; V24-V33 HydrophobicContact CG2-CG2 4.38Å; I31-V33 HydrophobicContact CG2-CG2 4.04Å; V33-F51 HydrophobicContact CB-CE2 4.21Å; V33-F51 HydrophobicContact CG1-CE2 3.71Å; V33-F51 HydrophobicContact CG1-CZ 3.92Å; V33-R53 PolarHBondContact N-O 3.08Å; V33-R53 PolarHBondContact O-N 2.85Å; V33-L76 HydrophobicContact CG1-CD2 3.64Å
34	H	98.6	Very high	94.2	Very high	54 Å²	54	78.4 Å²	78.4	25%	0.25	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	127.7	175.5	175.6	-148.4	0	0	0	108.5	L22 K23 E50 F51 H52	L22-H34 CarbonylContact C-O 3.52Å; L22-H34 WeakPolarHBondContact CA-O 3.33Å; K23-H34 HydrophobicContact CB-CB 4.47Å; K23-H34 PolarHBondContact N-O 2.81Å; K23-H34 PolarHBondContact O-N 2.78Å; H34-E50 IonicContact CD2-OE1 3.86Å; H34-E50 IonicContact CE1-OE1 3.01Å; H34-E50 IonicContact NE2-OE1 2.83Å; H34-E50 PolarHBondContact NE2-OE1 3.12Å; H34-F51 WeakPolarHBondContact CA-O 3.37Å; H34-F51 PolarHBondContact CD2-O 2.82Å; H34-H52 AromaticContact CD2-CD2 3.85Å; H34-H52 AromaticContact CD2-CE1 3.05Å; H34-H52 PolarHBondContact CD2-CE1 2.84Å; H34-H52 AromaticContact CD2-ND1 3.56Å; H34-H52 AromaticContact CD2-NE2 3.25Å; H34-H52 PolarHBondContact CD2-NE2 2.97Å; H34-H52 AromaticContact CE1-CE1 3.79Å; H34-H52 AromaticContact CG-CE1 3.59Å; H34-H52 AromaticContact CG-ND1 3.9Å; H34-H52 AromaticContact NE2-CE1 3.2Å; H34-H52 PolarHBondContact NE2-CE1 3.12Å; H34-H52 AromaticContact NE2-NE2 3.22Å; H34-H52 PolarHBondContact NE2-NE2 2.67Å
35	G	98.4	Very high	93.8	Very high	0 Å²	0	77.5 Å²	77.5	0%	0	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	129.8	168.9	0	0	0	0	0	109.3	E21 E50 F51	E21-G35 WeakPolarHBondContact O-CA 3.49Å; G35-E50 CarbonylContact O-C 3.58Å; G35-E50 VanDerWaalsContact O-CA 3.29Å; G35-E50 WeakPolarHBondContact O-CA 3.29Å; G35-F51 PolarHBondContact N-O 2.76Å; G35-F51 PolarHBondContact O-N 2.83Å
36	K	98	Very high	93.5	Very high	89 Å²	89	79.5 Å²	79.5	39%	0.387	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	111.8	177.7	-175.4	178.3	178.8	-169.8	0	110.6	E21 E50	E21-K36 WeakPolarHBondContact CB-O 3.46Å; E21-K36 PolarHBondContact O-N 2.87Å; K36-E50 HydrophobicContact CB-CG 4.28Å; K36-E50 HydrophobicContact CG-CG 4.31Å
37	H	95.6	Very high	93.2	Very high	22 Å²	22	78.8 Å²	78.8	10%	0.102	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	112.5	169.2	-173.4	83.6	0	0	0	107.5	F17 E21 S48 R49	F17-H37 HydrophobicContact CD1-CB 4.01Å; F17-H37 HydrophobicContact CE1-CB 3.94Å; E21-H37 VanDerWaalsContact CD-ND1 3.28Å; E21-H37 IonicContact OE1-CE1 2.83Å; E21-H37 IonicContact OE1-CG 2.81Å; E21-H37 IonicContact OE1-ND1 3.69Å; E21-H37 PolarHBondContact OE1-ND1 3.36Å; E21-H37 IonicContact OE2-CG 3.61Å; E21-H37 IonicContact OE2-ND1 3.84Å; E21-H37 PolarHBondContact OE2-ND1 3.4Å; H37-S48 PolarHBondContact O-OG 3.1Å; H37-R49 HydrophobicContact CB-CB 4.19Å; H37-R49 PolarHBondContact N-O 3Å; H37-R49 PolarHBondContact O-N 2.71Å; H37-R49 VanDerWaalsContact O-N 3.1Å
38	E	94	Very high	93.1	Very high	129 Å²	129	77.8 Å²	77.8	60%	0.603	39%	0.394	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-64.7	165.9	175.2	-62.1	-165.4	154.2	0	0	111.1	R40	E38-R40 PolarHBondContact O-N 2.83Å
39	E	93.4	Very high	93.1	Very high	143 Å²	143	78.6 Å²	78.6	67%	0.668	38%	0.377	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-60	115.9	178.6	-171.8	173	-102.4	0	0	110.4	F46 I47	E39-F46 HydrophobicContact CG-CB 3.71Å; E39-F46 HydrophobicContact CG-CD1 4.1Å; E39-F46 HydrophobicContact CG-CG 4.27Å; E39-I47 WeakPolarHBondContact CA-O 3.45Å
40	R	89.7	Confident	93.2	Very high	129 Å²	129	80.3 Å²	80.3	49%	0.487	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	149.3	174.8	-60.6	-170.8	-161.7	-166.6	3.3	110	E21 E38 F46 I47	E21-R40 IonicContact OE1-CZ 3.32Å; E21-R40 IonicContact OE1-NE 3.64Å; E21-R40 IonicContact OE1-NH2 2.66Å; E21-R40 PolarHBondContact OE1-NH2 2.87Å; E38-R40 PolarHBondContact O-N 2.83Å; R40-F46 CarbonylContact O-C 3.54Å; R40-F46 WeakPolarHBondContact O-CA 3.12Å; R40-I47 PolarHBondContact N-O 3.4Å; R40-I47 PolarHBondContact O-N 2.93Å
41	Q	88.8	Confident	93.3	Very high	154 Å²	154	80.7 Å²	80.7	72%	0.72	38%	0.382	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-71.2	132.8	175.1	-164.5	176	-7.1	0	0	110.1	G45 F46	Q41-G45 CarbonylContact C-O 3.55Å; Q41-G45 VanDerWaalsContact CA-O 3.26Å; Q41-G45 WeakPolarHBondContact CA-O 3.11Å; Q41-G45 WeakPolarHBondContact CG-O 3.34Å; Q41-F46 HydrophobicContact CB-CD1 4.08Å; Q41-F46 HydrophobicContact CB-CE1 3.89Å; Q41-F46 HydrophobicContact CG-CE1 4.21Å; Q41-F46 HydrophobicContact CG-CZ 4.39Å
42	D	81.3	Confident	93.3	Very high	63 Å²	63	86.5 Å²	86.5	34%	0.337	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	-174.2	170.3	73.2	14.4	0	0	0	110.8	H44 G45 I47	D42-H44 PolarHBondContact O-N 2.87Å; D42-H44 VanDerWaalsContact O-N 3.13Å; D42-H44 PolarHBondContact OD1-N 2.9Å; D42-G45 PolarHBondContact N-O 3.46Å; D42-G45 PolarHBondContact O-N 3.39Å; D42-G45 PolarHBondContact OD1-N 2.87Å; D42-I47 HydrophobicContact CB-CG2 4.26Å; D42-I47 WeakPolarHBondContact OD2-CG2 3.39Å
43	E	82.8	Confident	93.2	Very high	185 Å²	185	90 Å²	90	86%	0.864	42%	0.42	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.3	-19	-178	-65.4	-178.3	168.3	0	0	113.9
44	H	83.4	Confident	93.2	Very high	176 Å²	176	96.7 Å²	96.7	82%	0.815	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	-119.8	2.9	-173.2	-62.9	-58.8	0	0	0	114	D42	D42-H44 PolarHBondContact O-N 2.87Å; D42-H44 VanDerWaalsContact O-N 3.13Å; D42-H44 PolarHBondContact OD1-N 2.9Å
45	G	89.5	Confident	93.2	Very high	28 Å²	28	97 Å²	97	29%	0.289	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	144.3	-129.4	178.9	0	0	0	0	0	111.3	Q41 D42	Q41-G45 CarbonylContact C-O 3.55Å; Q41-G45 VanDerWaalsContact CA-O 3.26Å; Q41-G45 WeakPolarHBondContact CA-O 3.11Å; Q41-G45 WeakPolarHBondContact CG-O 3.34Å; D42-G45 PolarHBondContact N-O 3.46Å; D42-G45 PolarHBondContact O-N 3.39Å; D42-G45 PolarHBondContact OD1-N 2.87Å
46	F	91.5	Very high	93.1	Very high	135 Å²	135	104.8 Å²	104.8	59%	0.592	48%	0.478	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119	142	177.3	-65.8	-90.5	0	0	0	109.5	E39 R40 Q41	E39-F46 HydrophobicContact CG-CB 3.71Å; E39-F46 HydrophobicContact CG-CD1 4.1Å; E39-F46 HydrophobicContact CG-CG 4.27Å; R40-F46 CarbonylContact O-C 3.54Å; R40-F46 WeakPolarHBondContact O-CA 3.12Å; Q41-F46 HydrophobicContact CB-CD1 4.08Å; Q41-F46 HydrophobicContact CB-CE1 3.89Å; Q41-F46 HydrophobicContact CG-CE1 4.21Å; Q41-F46 HydrophobicContact CG-CZ 4.39Å
47	I	91.9	Very high	93	Very high	44 Å²	44	101 Å²	101	23%	0.226	46%	0.462	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133	136.2	178.4	-163.1	143.3	0	0	0	111.7	E39 R40 D42 R49	E39-I47 WeakPolarHBondContact CA-O 3.45Å; R40-I47 PolarHBondContact N-O 3.4Å; R40-I47 PolarHBondContact O-N 2.93Å; D42-I47 HydrophobicContact CB-CG2 4.26Å; D42-I47 WeakPolarHBondContact OD2-CG2 3.39Å; I47-R49 HydrophobicContact CG1-CG 4.3Å
48	S	94.8	Very high	92.9	Very high	72 Å²	72	101.4 Å²	101.4	50%	0.503	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	141.6	171.7	174.7	0	0	0	0	108.3	H37	H37-S48 PolarHBondContact O-OG 3.1Å
49	R	95	Very high	92.8	Very high	80 Å²	80	100.7 Å²	100.7	30%	0.302	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.7	134.9	179.7	-60.8	-179.2	178.5	87.8	-5.3	109.5	F17 H37 I47	F17-R49 HydrophobicContact CE1-CB 4.06Å; F17-R49 WeakPolarHBondContact CE1-O 3.3Å; F17-R49 HydrophobicContact CZ-CB 3.67Å; H37-R49 HydrophobicContact CB-CB 4.19Å; H37-R49 PolarHBondContact N-O 3Å; H37-R49 PolarHBondContact O-N 2.71Å; H37-R49 VanDerWaalsContact O-N 3.1Å; I47-R49 HydrophobicContact CG1-CG 4.3Å
50	E	98.1	Very high	92.7	Very high	103 Å²	103	95.3 Å²	95.3	48%	0.481	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.4	139.3	174.4	-174	167.6	-177.9	0	0	110.7	H34 G35 K36 H52	H34-E50 IonicContact CD2-OE1 3.86Å; H34-E50 IonicContact CE1-OE1 3.01Å; H34-E50 IonicContact NE2-OE1 2.83Å; H34-E50 PolarHBondContact NE2-OE1 3.12Å; G35-E50 CarbonylContact O-C 3.58Å; G35-E50 VanDerWaalsContact O-CA 3.29Å; G35-E50 WeakPolarHBondContact O-CA 3.29Å; K36-E50 HydrophobicContact CB-CG 4.28Å; K36-E50 HydrophobicContact CG-CG 4.31Å; E50-H52 IonicContact OE1-CD2 3.86Å; E50-H52 IonicContact OE1-CE1 2.79Å; E50-H52 IonicContact OE1-NE2 2.67Å; E50-H52 PolarHBondContact OE1-NE2 2.47Å
51	F	98.3	Very high	92.9	Very high	38 Å²	38	89.5 Å²	89.5	17%	0.167	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.6	149.6	172.3	77.2	-94.5	0	0	0	112.2	V14 F17 L22 V33 H34 G35 R53	V14-F51 HydrophobicContact CG1-CE1 4.1Å; V14-F51 HydrophobicContact CG1-CZ 3.88Å; F17-F51 HydrophobicContact CD2-CD1 4.43Å; F17-F51 HydrophobicContact CD2-CE1 4Å; F17-F51 HydrophobicContact CE1-CD1 4.21Å; F17-F51 HydrophobicContact CE1-CE1 4.35Å; F17-F51 AromaticContact CE2-CD1 3.69Å; F17-F51 HydrophobicContact CE2-CD1 3.69Å; F17-F51 AromaticContact CE2-CE1 3.73Å; F17-F51 HydrophobicContact CE2-CE1 3.73Å; F17-F51 HydrophobicContact CG-CE1 4.45Å; F17-F51 AromaticContact CZ-CD1 3.57Å; F17-F51 HydrophobicContact CZ-CD1 3.57Å; F17-F51 AromaticContact CZ-CE1 3.92Å; F17-F51 HydrophobicContact CZ-CE1 3.92Å; L22-F51 HydrophobicContact CD2-CE1 3.98Å; L22-F51 HydrophobicContact CD2-CZ 3.95Å; V33-F51 HydrophobicContact CB-CE2 4.21Å; V33-F51 HydrophobicContact CG1-CE2 3.71Å; V33-F51 HydrophobicContact CG1-CZ 3.92Å; H34-F51 WeakPolarHBondContact CA-O 3.37Å; H34-F51 PolarHBondContact CD2-O 2.82Å; G35-F51 PolarHBondContact N-O 2.76Å; G35-F51 PolarHBondContact O-N 2.83Å; F51-R53 HydrophobicContact CD2-CB 4.45Å; F51-R53 HydrophobicContact CD2-CG 4Å; F51-R53 HydrophobicContact CE2-CG 4.47Å
52	H	98.3	Very high	93.1	Very high	123 Å²	123	84.7 Å²	84.7	57%	0.569	42%	0.417	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-129.2	117.6	172.5	-66.8	-99.7	0	0	0	108.6	H34 E50	H34-H52 AromaticContact CD2-CD2 3.85Å; H34-H52 AromaticContact CD2-CE1 3.05Å; H34-H52 PolarHBondContact CD2-CE1 2.84Å; H34-H52 AromaticContact CD2-ND1 3.56Å; H34-H52 AromaticContact CD2-NE2 3.25Å; H34-H52 PolarHBondContact CD2-NE2 2.97Å; H34-H52 AromaticContact CE1-CE1 3.79Å; H34-H52 AromaticContact CG-CE1 3.59Å; H34-H52 AromaticContact CG-ND1 3.9Å; H34-H52 AromaticContact NE2-CE1 3.2Å; H34-H52 PolarHBondContact NE2-CE1 3.12Å; H34-H52 AromaticContact NE2-NE2 3.22Å; H34-H52 PolarHBondContact NE2-NE2 2.67Å; E50-H52 IonicContact OE1-CD2 3.86Å; E50-H52 IonicContact OE1-CE1 2.79Å; E50-H52 IonicContact OE1-NE2 2.67Å; E50-H52 PolarHBondContact OE1-NE2 2.47Å
53	R	98.1	Very high	93.8	Very high	122 Å²	122	83.9 Å²	83.9	46%	0.46	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	138.7	176.7	-72.1	-175.1	-178.6	-170.7	3.4	110.4	V33 F51 Y55	V33-R53 PolarHBondContact N-O 3.08Å; V33-R53 PolarHBondContact O-N 2.85Å; F51-R53 HydrophobicContact CD2-CB 4.45Å; F51-R53 HydrophobicContact CD2-CG 4Å; F51-R53 HydrophobicContact CE2-CG 4.47Å; R53-Y55 HydrophobicContact CB-CE2 3.81Å; R53-Y55 WeakPolarHBondContact CD-OH 3.44Å
54	K	98.1	Very high	94.4	Very high	142 Å²	142	82.8 Å²	82.8	62%	0.617	41%	0.414	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121.2	135.8	176.8	-55.9	-163.4	-172.4	-161.3	0	110.3	V30 I31 E32	V30-K54 HydrophobicContact CG1-CB 3.9Å; V30-K54 HydrophobicContact CG1-CD 4.27Å; V30-K54 HydrophobicContact CG1-CG 4.43Å; I31-K54 CarbonylContact O-C 3.56Å; I31-K54 VanDerWaalsContact O-CA 3.27Å; I31-K54 WeakPolarHBondContact O-CA 3.19Å; E32-K54 HydrophobicContact CG-CD 4.15Å; E32-K54 HydrophobicContact CG-CG 4.14Å; E32-K54 WeakPolarHBondContact OE1-CE 3.41Å; E32-K54 IonicContact OE1-NZ 3.49Å; E32-K54 PolarHBondContact OE1-NZ 3.05Å
55	Y	97.6	Very high	95	Very high	60 Å²	60	76.9 Å²	76.9	24%	0.235	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.2	129.3	177.8	-63.8	-80.9	0	0	0	109.7	V10 L12 V30 I31 R53	V10-Y55 HydrophobicContact CG1-CD1 3.89Å; V10-Y55 HydrophobicContact CG1-CD2 4.04Å; V10-Y55 HydrophobicContact CG1-CE1 3.58Å; V10-Y55 HydrophobicContact CG1-CE2 3.74Å; V10-Y55 HydrophobicContact CG1-CG 4.11Å; V10-Y55 HydrophobicContact CG2-CD1 3.9Å; V10-Y55 HydrophobicContact CG2-CE1 4.36Å; V10-Y55 HydrophobicContact CG2-CG 4.06Å; L12-Y55 HydrophobicContact CD1-CE2 4.2Å; L12-Y55 HydrophobicContact CD2-CE2 4.27Å; L12-Y55 WeakPolarHBondContact CD2-OH 3.18Å; V30-Y55 CarbonylContact C-O 3.53Å; V30-Y55 WeakPolarHBondContact CA-O 3.39Å; I31-Y55 PolarHBondContact N-O 3.29Å; I31-Y55 PolarHBondContact O-N 2.79Å; R53-Y55 HydrophobicContact CB-CE2 3.81Å; R53-Y55 WeakPolarHBondContact CD-OH 3.44Å
56	R	96.6	Very high	95.3	Very high	163 Å²	163	76.8 Å²	76.8	62%	0.615	38%	0.383	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.8	129.2	175.5	-164.7	150.5	-179.2	71.9	4.5	109.8	D29	D29-R56 IonicContact OD1-CZ 3.72Å; D29-R56 IonicContact OD1-NH1 2.87Å; D29-R56 PolarHBondContact OD1-NH1 2.83Å; D29-R56 IonicContact OD1-NH2 3.94Å; D29-R56 IonicContact OD2-CZ 3.03Å; D29-R56 IonicContact OD2-NH1 3.6Å; D29-R56 PolarHBondContact OD2-NH1 3.18Å; D29-R56 IonicContact OD2-NH2 2.62Å; D29-R56 PolarHBondContact OD2-NH2 3.29Å
57	I	95.7	Very high	95.6	Very high	10 Å²	10	74.2 Å²	74.2	5%	0.051	38%	0.378	C	S	.	.	P	Polyproline II helix	trans	-76.1	124.7	175.4	-58.8	168.5	0	0	0	107.1	V26 D29 I31 V61 P63 I66	V26-I57 HydrophobicContact CG1-CD1 3.78Å; D29-I57 WeakPolarHBondContact O-CB 3.44Å; D29-I57 PolarHBondContact O-N 2.83Å; I31-I57 HydrophobicContact CD1-CG1 3.99Å; I31-I57 HydrophobicContact CG1-CD1 3.98Å; I31-I57 HydrophobicContact CG1-CG1 3.81Å; I57-V61 HydrophobicContact CG2-CB 3.68Å; I57-V61 HydrophobicContact CG2-CG1 3.84Å; I57-P63 HydrophobicContact CD1-CB 4.09Å; I57-P63 HydrophobicContact CD1-CG 4.31Å; I57-I66 HydrophobicContact CD1-CD1 3.33Å; I57-I66 HydrophobicContact CG1-CD1 3.73Å; I57-I66 HydrophobicContact CG2-CD1 4.14Å
58	P	93.6	Very high	95.8	Very high	30 Å²	30	75.3 Å²	75.3	20%	0.195	39%	0.39	C	S	.	.	P	Polyproline II helix	trans	-58.6	147.5	172.8	-24.8	35.2	0	0	0	111.8	F8 D60 V61	F8-P58 HydrophobicContact CD2-CG 3.61Å; F8-P58 HydrophobicContact CE2-CG 4.08Å; F8-P58 HydrophobicContact CG-CG 4.28Å; P58-D60 VanDerWaalsContact CB-OD1 3.26Å; P58-D60 WeakPolarHBondContact CB-OD1 3.43Å; P58-D60 PolarHBondContact O-N 2.82Å; P58-V61 HydrophobicContact CB-CG2 4.16Å; P58-V61 HydrophobicContact CG-CG2 4.22Å; P58-V61 PolarHBondContact O-N 3.08Å
59	A	92.1	Very high	96	Very high	114 Å²	114	75 Å²	75	94%	0.942	39%	0.388	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.5	-19.2	-177.4	0	0	0	0	0	114.3
60	D	91.6	Very high	96.1	Very high	30 Å²	30	74.3 Å²	74.3	16%	0.16	39%	0.39	C	S	.	.	T	Hydrogen-bonded Turn	trans	-93.3	6.1	177.6	62.5	-3.3	0	0	0	113.8	P58 R82 K83 V85	P58-D60 VanDerWaalsContact CB-OD1 3.26Å; P58-D60 WeakPolarHBondContact CB-OD1 3.43Å; P58-D60 PolarHBondContact O-N 2.82Å; D60-R82 VanDerWaalsContact CG-NE 3.34Å; D60-R82 IonicContact OD1-CZ 3.6Å; D60-R82 IonicContact OD1-NE 3.01Å; D60-R82 PolarHBondContact OD1-NE 2.82Å; D60-R82 IonicContact OD1-NH2 3.31Å; D60-R82 PolarHBondContact OD1-NH2 3.48Å; D60-R82 IonicContact OD2-CZ 3.11Å; D60-R82 IonicContact OD2-NE 3Å; D60-R82 PolarHBondContact OD2-NE 3Å; D60-R82 IonicContact OD2-NH2 2.65Å; D60-R82 PolarHBondContact OD2-NH2 2.85Å; D60-K83 WeakPolarHBondContact O-CB 3.37Å; D60-K83 PolarHBondContact O-N 2.83Å; D60-V85 HydrophobicContact CB-CG2 4.35Å
61	V	93.9	Very high	96.1	Very high	7 Å²	7	71.6 Å²	71.6	4%	0.042	38%	0.382	C	S	.	.	B	Isolated β-bridge	trans	-105	131.3	172.1	178.1	0	0	0	0	108.9	F8 I57 P58 P63 I66 R82	F8-V61 HydrophobicContact CB-CG2 3.5Å; F8-V61 HydrophobicContact CG-CG2 4.14Å; I57-V61 HydrophobicContact CG2-CB 3.68Å; I57-V61 HydrophobicContact CG2-CG1 3.84Å; P58-V61 HydrophobicContact CB-CG2 4.16Å; P58-V61 HydrophobicContact CG-CG2 4.22Å; P58-V61 PolarHBondContact O-N 3.08Å; V61-P63 WeakPolarHBondContact O-CD 3.36Å; V61-I66 HydrophobicContact CG1-CD1 4.46Å; V61-I66 HydrophobicContact CG1-CG1 4.2Å; V61-R82 HydrophobicContact CG2-CG 3.66Å
62	D	93.9	Very high	96	Very high	53 Å²	53	76.3 Å²	76.3	28%	0.283	42%	0.42	S	S	.	.			trans	-78.7	117.4	171.7	-175.7	-16.9	0	0	0	109.8	L64 T65	D62-L64 PolarHBondContact O-N 2.94Å; D62-L64 VanDerWaalsContact O-N 3.12Å; D62-L64 WeakPolarHBondContact OD1-CB 3.42Å; D62-L64 PolarHBondContact OD1-N 3.04Å; D62-T65 HydrophobicContact CB-CG2 3.83Å; D62-T65 PolarHBondContact O-N 2.88Å; D62-T65 PolarHBondContact O-OG1 2.87Å
63	P	95.4	Very high	95.9	Very high	46 Å²	46	75.8 Å²	75.8	30%	0.299	42%	0.421	S	S	.	.	G	3₁₀ helix	trans	-56.1	-28.7	-179.6	-25	35	0	0	0	114.2	V26 I57 V61 T65 I66	V26-P63 HydrophobicContact CG1-CB 3.8Å; I57-P63 HydrophobicContact CD1-CB 4.09Å; I57-P63 HydrophobicContact CD1-CG 4.31Å; V61-P63 WeakPolarHBondContact O-CD 3.36Å; P63-T65 PolarHBondContact O-N 2.91Å; P63-I66 PolarHBondContact O-N 3.22Å
64	L	95.1	Very high	95.8	Very high	162 Å²	162	70.4 Å²	70.4	85%	0.848	40%	0.404	S	S	*	.	G	3₁₀ helix	trans	-73.8	-17.1	-179.9	-62.4	178.5	0	0	0	113.3	D62	D62-L64 PolarHBondContact O-N 2.94Å; D62-L64 VanDerWaalsContact O-N 3.12Å; D62-L64 WeakPolarHBondContact OD1-CB 3.42Å; D62-L64 PolarHBondContact OD1-N 3.04Å
65	T	95.1	Very high	95.8	Very high	53 Å²	53	65.5 Å²	65.5	33%	0.325	39%	0.386	S	S	.	.	G	3₁₀ helix	trans	-94.6	-0.9	-179.2	66.8	0	0	0	0	113	D62 P63 P81	D62-T65 HydrophobicContact CB-CG2 3.83Å; D62-T65 PolarHBondContact O-N 2.88Å; D62-T65 PolarHBondContact O-OG1 2.87Å; P63-T65 PolarHBondContact O-N 2.91Å; T65-P81 WeakPolarHBondContact OG1-CD 3.35Å
66	I	96.9	Very high	95.9	Very high	26 Å²	26	63 Å²	63	13%	0.133	38%	0.377	C	S	.	.			trans	-70.1	133	-180	-67.5	170.9	0	0	0	109.7	V26 I31 I57 V61 P63 V78 N79	V26-I66 HydrophobicContact CG2-CB 4.34Å; V26-I66 HydrophobicContact CG2-CD1 4.17Å; V26-I66 HydrophobicContact CG2-CG2 4.24Å; I31-I66 HydrophobicContact CD1-CD1 4.03Å; I31-I66 HydrophobicContact CD1-CG2 4.42Å; I31-I66 HydrophobicContact CG1-CD1 4.05Å; I57-I66 HydrophobicContact CD1-CD1 3.33Å; I57-I66 HydrophobicContact CG1-CD1 3.73Å; I57-I66 HydrophobicContact CG2-CD1 4.14Å; V61-I66 HydrophobicContact CG1-CD1 4.46Å; V61-I66 HydrophobicContact CG1-CG1 4.2Å; P63-I66 PolarHBondContact O-N 3.22Å; I66-V78 HydrophobicContact CG2-CG1 3.56Å; I66-N79 WeakPolarHBondContact CA-O 3.23Å
67	T	97.2	Very high	96	Very high	80 Å²	80	56.6 Å²	56.6	49%	0.491	36%	0.356	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	163.5	175.8	64.5	0	0	0	0	110.4	V78 N79	T67-V78 WeakPolarHBondContact O-CA 3.48Å; T67-N79 PolarHBondContact N-O 2.81Å; T67-N79 PolarHBondContact O-N 2.78Å; T67-N79 PolarHBondContact OG1-OD1 3.13Å
68	S	97.5	Very high	96.1	Very high	67 Å²	67	56.3 Å²	56.3	47%	0.469	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.9	147.2	175.5	60.1	0	0	0	0	111.9	T77	S68-T77 CarbonylContact C-O 3.56Å; S68-T77 WeakPolarHBondContact CA-O 3.45Å
69	S	97.6	Very high	96.2	Very high	67 Å²	67	56.3 Å²	56.3	47%	0.469	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.3	150.4	171.6	58.7	0	0	0	0	110.5	T77	S69-T77 PolarHBondContact N-O 2.8Å; S69-T77 PolarHBondContact O-N 2.91Å
70	L	98.1	Very high	96.3	Very high	64 Å²	64	50.9 Å²	50.9	34%	0.335	31%	0.308	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	123.1	174.4	177.7	59.2	0	0	0	108.4	V14 P19 L22 L76	V14-L70 HydrophobicContact CG2-CD1 3.59Å; P19-L70 HydrophobicContact CB-CD2 4.29Å; P19-L70 HydrophobicContact CG-CD2 3.93Å; L22-L70 HydrophobicContact CD1-CD2 4.12Å; L70-L76 HydrophobicContact CD1-CB 4.23Å
71	S	97.8	Very high	96.3	Very high	46 Å²	46	52.9 Å²	52.9	32%	0.322	32%	0.323	S	S	.	.			trans	-79.8	161.8	176.2	55.8	0	0	0	0	111.8	D73 G74 V75	S71-D73 WeakPolarHBondContact CB-OD1 3.35Å; S71-D73 PolarHBondContact O-N 3.2Å; S71-D73 PolarHBondContact OG-OD1 3.05Å; S71-G74 PolarHBondContact O-N 3.34Å; S71-V75 PolarHBondContact N-O 3.29Å; S71-V75 VanDerWaalsContact N-O 3.08Å; S71-V75 WeakPolarHBondContact OG-CA 3.29Å; S71-V75 WeakPolarHBondContact OG-CB 3.46Å; S71-V75 PolarHBondContact OG-N 3.25Å; S71-V75 PolarHBondContact OG-O 2.83Å; S71-V75 VanDerWaalsContact OG-O 3.08Å
72	S	95.9	Very high	96.1	Very high	138 Å²	138	55.2 Å²	55.2	97%	0.965	33%	0.331	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.5	-21.6	179.3	51.5	0	0	0	0	114.1	G74	S72-G74 VanDerWaalsContact C-N 3.28Å
73	D	95.7	Very high	95.7	Very high	111 Å²	111	59.1 Å²	59.1	59%	0.594	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.8	7	173.4	66.2	-20	0	0	0	113.3	S71	S71-D73 WeakPolarHBondContact CB-OD1 3.35Å; S71-D73 PolarHBondContact O-N 3.2Å; S71-D73 PolarHBondContact OG-OD1 3.05Å
74	G	97	Very high	94.6	Very high	10 Å²	10	64.2 Å²	64.2	10%	0.103	37%	0.365	C	S	.	.	S	Bend	trans	85	24.9	171.9	0	0	0	0	0	114.7	V14 K15 S71 S72	V14-G74 CarbonylContact C-O 3.58Å; V14-G74 VanDerWaalsContact CG2-O 3.29Å; V14-G74 WeakPolarHBondContact CG2-O 3.48Å; V14-G74 PolarHBondContact N-O 2.87Å; K15-G74 PolarHBondContact N-O 3.04Å; S71-G74 PolarHBondContact O-N 3.34Å; S72-G74 VanDerWaalsContact C-N 3.28Å
75	V	98.3	Very high	93.2	Very high	38 Å²	38	62 Å²	62	23%	0.23	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	111.9	175.9	-174.5	0	0	0	0	110.6	N11 L12 S71	N11-V75 HydrophobicContact CB-CG1 4.03Å; L12-V75 CarbonylContact O-C 3.51Å; L12-V75 WeakPolarHBondContact O-CA 3.36Å; S71-V75 PolarHBondContact N-O 3.29Å; S71-V75 VanDerWaalsContact N-O 3.08Å; S71-V75 WeakPolarHBondContact OG-CA 3.29Å; S71-V75 WeakPolarHBondContact OG-CB 3.46Å; S71-V75 PolarHBondContact OG-N 3.25Å; S71-V75 PolarHBondContact OG-O 2.83Å; S71-V75 VanDerWaalsContact OG-O 3.08Å
76	L	98.5	Very high	91.7	Very high	7 Å²	7	65 Å²	65	4%	0.037	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.4	120.9	169.6	172.1	64.9	0	0	0	109.1	N11 L12 V14 V24 V33 L70 V78	N11-L76 CarbonylContact C-O 3.59Å; N11-L76 WeakPolarHBondContact CA-O 3.31Å; L12-L76 HydrophobicContact CB-CB 4.22Å; L12-L76 HydrophobicContact CD1-CD2 4.11Å; L12-L76 PolarHBondContact N-O 3.06Å; L12-L76 PolarHBondContact O-N 2.87Å; V14-L76 HydrophobicContact CG1-CB 4.28Å; V14-L76 HydrophobicContact CG2-CB 3.71Å; V24-L76 HydrophobicContact CG2-CD1 4.48Å; V24-L76 HydrophobicContact CG2-CD2 4.04Å; V33-L76 HydrophobicContact CG1-CD2 3.64Å; L70-L76 HydrophobicContact CD1-CB 4.23Å; L76-V78 HydrophobicContact CD1-CG2 4.48Å; L76-V78 HydrophobicContact CG-CG2 4.32Å
77	T	98.2	Very high	90.2	Very high	30 Å²	30	66.1 Å²	66.1	18%	0.184	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.5	124.1	173.5	-59.8	0	0	0	0	109	V10 N11 S68 S69 N79	V10-T77 WeakPolarHBondContact O-CA 3.26Å; N11-T77 WeakPolarHBondContact OD1-CG2 3.37Å; N11-T77 PolarHBondContact OD1-OG1 3.43Å; S68-T77 CarbonylContact C-O 3.56Å; S68-T77 WeakPolarHBondContact CA-O 3.45Å; S69-T77 PolarHBondContact N-O 2.8Å; S69-T77 PolarHBondContact O-N 2.91Å; T77-N79 HydrophobicContact CG2-CB 4.36Å
78	V	97.9	Very high	88.9	Confident	3 Å²	3	68.5 Å²	68.5	2%	0.018	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	124.6	168	-174.5	0	0	0	0	107.9	S9 V10 V24 I31 I66 T67 L76	S9-V78 WeakPolarHBondContact CA-O 3.39Å; V10-V78 PolarHBondContact N-O 2.98Å; V10-V78 PolarHBondContact O-N 3.1Å; V24-V78 HydrophobicContact CG1-CG2 4.24Å; V24-V78 HydrophobicContact CG2-CG2 4.5Å; I31-V78 HydrophobicContact CD1-CG1 3.82Å; I31-V78 HydrophobicContact CG1-CG1 4.45Å; I31-V78 HydrophobicContact CG2-CG1 4.19Å; I66-V78 HydrophobicContact CG2-CG1 3.56Å; T67-V78 WeakPolarHBondContact O-CA 3.48Å; L76-V78 HydrophobicContact CD1-CG2 4.48Å; L76-V78 HydrophobicContact CG-CG2 4.32Å
79	N	95.9	Very high	87.8	Confident	30 Å²	30	74.3 Å²	74.3	16%	0.16	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.3	161.9	-173.8	72.4	67.2	0	0	0	113.1	F8 I66 T67 T77	F8-N79 CarbonylContact O-C 3.58Å; F8-N79 WeakPolarHBondContact O-CA 3.47Å; F8-N79 VanDerWaalsContact O-CB 3.31Å; F8-N79 WeakPolarHBondContact O-CB 3.47Å; I66-N79 WeakPolarHBondContact CA-O 3.23Å; T67-N79 PolarHBondContact N-O 2.81Å; T67-N79 PolarHBondContact O-N 2.78Å; T67-N79 PolarHBondContact OG1-OD1 3.13Å; T77-N79 HydrophobicContact CG2-CB 4.36Å
80	G	94.2	Very high	87.1	Confident	0 Å²	0	80.7 Å²	80.7	0%	0	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-160.6	150.8	173.5	0	0	0	0	0	111.8	R7 F8	R7-G80 WeakPolarHBondContact CG-O 3.26Å; F8-G80 PolarHBondContact N-O 2.89Å; F8-G80 PolarHBondContact O-N 3.02Å
81	P	93.1	Very high	86.4	Confident	72 Å²	72	83.9 Å²	83.9	47%	0.468	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.7	140.9	175.6	28.2	-34.7	0	0	0	110.7	T65	T65-P81 WeakPolarHBondContact OG1-CD 3.35Å
82	R	89.9	Confident	86	Confident	57 Å²	57	87 Å²	87	22%	0.215	48%	0.483	C	S	.	.	B	Isolated β-bridge	trans	-92.7	135.4	168.6	-65.6	-179	79.6	-167.4	1.4	108.7	D6 F8 D60 V61 Q84	D6-R82 PolarHBondContact O-N 3.17Å; F8-R82 HydrophobicContact CB-CG 4.16Å; D60-R82 VanDerWaalsContact CG-NE 3.34Å; D60-R82 IonicContact OD1-CZ 3.6Å; D60-R82 IonicContact OD1-NE 3.01Å; D60-R82 PolarHBondContact OD1-NE 2.82Å; D60-R82 IonicContact OD1-NH2 3.31Å; D60-R82 PolarHBondContact OD1-NH2 3.48Å; D60-R82 IonicContact OD2-CZ 3.11Å; D60-R82 IonicContact OD2-NE 3Å; D60-R82 PolarHBondContact OD2-NE 3Å; D60-R82 IonicContact OD2-NH2 2.65Å; D60-R82 PolarHBondContact OD2-NH2 2.85Å; V61-R82 HydrophobicContact CG2-CG 3.66Å; R82-Q84 PolarHBondContact O-N 2.97Å
83	K	84.1	Confident	85.5	Confident	135 Å²	135	85.5 Å²	85.5	59%	0.587	47%	0.47	S	S	*	.	P	Polyproline II helix	trans	-61.6	124	168.4	-68.4	175.7	-177.4	174.8	0	107.5	D60 V85	D60-K83 WeakPolarHBondContact O-CB 3.37Å; D60-K83 PolarHBondContact O-N 2.83Å; K83-V85 PolarHBondContact O-N 3.01Å
84	Q	73.4	Confident	85.2	Confident	153 Å²	153	88.4 Å²	88.4	72%	0.715	48%	0.484	S	S	*	.			trans	-60.5	115.4	172.1	-88	-172.8	-20.1	0	0	108.9	D6 R82 S86	D6-Q84 PolarHBondContact OD1-NE2 2.94Å; R82-Q84 PolarHBondContact O-N 2.97Å; Q84-S86 VanDerWaalsContact C-N 3.26Å; Q84-S86 PolarHBondContact O-N 2.64Å
85	V	64.5	Low	84.7	Confident	116 Å²	116	94 Å²	94	70%	0.703	52%	0.517	S	S	*	.			trans	-80.7	81.5	172.7	-165.4	0	0	0	0	107.3	D60 K83 G87	D60-V85 HydrophobicContact CB-CG2 4.35Å; K83-V85 PolarHBondContact O-N 3.01Å; V85-G87 PolarHBondContact O-N 3.05Å
86	S	63.9	Low	84	Confident	116 Å²	116	103 Å²	103	81%	0.811	55%	0.546	S	S	*	.			trans	-75.6	71.9	164.7	63.9	0	0	0	0	108.5	Q84	Q84-S86 VanDerWaalsContact C-N 3.26Å; Q84-S86 PolarHBondContact O-N 2.64Å
87	G	65.6	Low	83.1	Confident	48 Å²	48	111.7 Å²	111.7	50%	0.495	59%	0.587	S	S	.	*	P	Polyproline II helix	trans	-74.3	151.2	169.5	0	0	0	0	0	110.2	V85 E89	V85-G87 PolarHBondContact O-N 3.05Å; G87-E89 PolarHBondContact O-N 3.16Å; G87-E89 VanDerWaalsContact O-N 3.17Å
88	P	69.9	Low	82.1	Confident	131 Å²	131	118.4 Å²	118.4	85%	0.851	62%	0.616	S	S	*	*	P	Polyproline II helix	trans	-60.2	121.6	172.3	24.4	-31.3	0	0	0	109.5	R90	P88-R90 PolarHBondContact O-N 3.3Å
89	E	74.9	Confident	80.5	Confident	189 Å²	189	127.7 Å²	127.7	88%	0.883	66%	0.656	S	S	*	*	P	Polyproline II helix	trans	-66.5	124.6	169.6	-176.1	174.1	-172.1	0	0	108.4	G87	G87-E89 PolarHBondContact O-N 3.16Å; G87-E89 VanDerWaalsContact O-N 3.17Å
90	R	81.4	Confident	78.9	Confident	201 Å²	201	132 Å²	132	76%	0.758	69%	0.686	S	S	*	*			trans	-123.4	130.6	173.8	86.4	-179.8	-168.6	-173.8	2.2	110.2	P88 I92	P88-R90 PolarHBondContact O-N 3.3Å; R90-I92 HydrophobicContact CG-CG1 4.24Å
91	T	84.5	Confident	77.2	Confident	130 Å²	130	136.5 Å²	136.5	80%	0.798	72%	0.723	S	S	*	*	P	Polyproline II helix	trans	-84.1	125.5	168.9	-61.7	0	0	0	0	108.6
92	I	88.2	Confident	75.7	Confident	112 Å²	112	140.1 Å²	140.1	57%	0.574	74%	0.743	S	S	*	*	P	Polyproline II helix	trans	-97.6	117.2	174.5	-55.7	179.6	0	0	0	107.6	R90	R90-I92 HydrophobicContact CG-CG1 4.24Å
93	P	86.8	Confident	73.9	Confident	106 Å²	106	144 Å²	144	69%	0.688	77%	0.773	S	S	*	*	P	Polyproline II helix	trans	-69.4	139.6	177.3	28.1	-32.9	0	0	0	110.7
94	I	88.9	Confident	72.7	Confident	172 Å²	172	142.3 Å²	142.3	88%	0.882	79%	0.785	S	S	*	*			trans	-89	113.5	173.9	-62.3	167.1	0	0	0	108.1
95	T	87.5	Confident	72	Confident	129 Å²	129	139.4 Å²	139.4	79%	0.791	79%	0.787	S	S	*	*			trans	-100.1	132.5	170.5	24.3	0	0	0	0	110.5
96	R	83.3	Confident	71.6	Confident	227 Å²	227	140.1 Å²	140.1	86%	0.857	79%	0.794	S	S	*	*			trans	-89.4	119.1	174.6	-169.3	178.2	-173.9	-175.5	0.8	108.6	E98	R96-E98 PolarHBondContact O-N 3.44Å
97	E	78	Confident	71	Confident	189 Å²	189	144.5 Å²	144.5	88%	0.883	80%	0.798	S	S	*	*			trans	-77	113.6	170.6	-72.8	-175.2	170.6	0	0	109.5	K99	E97-K99 PolarHBondContact O-N 2.98Å
98	E	78.5	Confident	70.4	Confident	171 Å²	171	155.8 Å²	155.8	80%	0.799	83%	0.834	S	S	*	*			trans	-82.2	107.4	167.5	-68.6	-169.1	171.2	0	0	109.1	R96	R96-E98 PolarHBondContact O-N 3.44Å
99	K	64.7	Low	70.5	Confident	198 Å²	198	157.1 Å²	157.1	86%	0.861	83%	0.833	S	S	*	*	P	Polyproline II helix	trans	-76.2	123.6	166	-162.9	171.9	-173.3	174.7	0	107.7	E97 A101	E97-K99 PolarHBondContact O-N 2.98Å; K99-A101 PolarHBondContact O-N 3.07Å
100	P	62.2	Low	70.2	Confident	120 Å²	120	155.4 Å²	155.4	78%	0.779	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-62.3	124	-178.1	-10	19.3	0	0	0	109.9
101	A	58.9	Low	69.6	Low	95 Å²	95	152.8 Å²	152.8	79%	0.785	83%	0.834	S	S	*	*	P	Polyproline II helix	trans	-71.7	126.5	171.1	0	0	0	0	0	109.1	K99 T103	K99-A101 PolarHBondContact O-N 3.07Å; A101-T103 PolarHBondContact O-N 3.28Å
102	V	60.3	Low	68.7	Low	147 Å²	147	154.2 Å²	154.2	89%	0.891	84%	0.837	S	S	*	*	P	Polyproline II helix	trans	-55.2	117.3	-179.7	-166.4	0	0	0	0	109.6	A104	V102-A104 PolarHBondContact O-N 2.66Å
103	T	52.9	Low	67.5	Low	138 Å²	138	156.8 Å²	156.8	85%	0.847	85%	0.853	S	S	*	*	P	Polyproline II helix	trans	-65.9	120.9	177.3	8.7	0	0	0	0	110.3	A101	A101-T103 PolarHBondContact O-N 3.28Å
104	A	58.9	Low	66.2	Low	101 Å²	101	160.2 Å²	160.2	84%	0.835	86%	0.864	S	S	*	*	P	Polyproline II helix	trans	-68.1	127.7	172.8	0	0	0	0	0	110.7	V102	V102-A104 PolarHBondContact O-N 2.66Å
105	A	57.5	Low	64.6	Low	91 Å²	91	159.4 Å²	159.4	75%	0.752	86%	0.863	S	S	*	*	P	Polyproline II helix	trans	-79.6	141.2	173.5	0	0	0	0	0	111.1
106	P	56.4	Low	62.8	Low	131 Å²	131	161.7 Å²	161.7	85%	0.851	87%	0.868	S	S	*	*	P	Polyproline II helix	trans	-78.6	135.4	177.2	31.8	-30.8	0	0	0	110.4
107	K	50.7	Low	61.1	Low	208 Å²	208	156.3 Å²	156.3	90%	0.904	87%	0.869	S	S	*	*	P	Polyproline II helix	trans	-84.6	136.9	167.8	-75.3	-173.6	176.1	-179.1	0	109.6
108	K	54.8	Low	59.6	Low	286 Å²	286	153.3 Å²	153.3	100%	1.243	87%	0.868	S	S	*	*			trans	-57.1	0	172.8	-79.1	-179.4	172.6	-177.9	0	112.7

Retrieved 108 of 108 residues in 263.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).