A0A044SCK0_ONCVO Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A044SCK0, Species ONCVO (Onchocerca volvulus), Gene n/a, Length 88 aa.

						>A0A044SCK0_ONCVO|A0A044SCK0
MDRRQERKYLKCLVNTAEKTVEQAAELEEKKKPLAGLSYKKKTIEWLVRQKSRIEKQVIMIVGIISKANKLEIELEESLHLVKDEMRE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.8	Low	85.1	Confident	184 Å²	184	141.9 Å²	141.9	91%	0.906	62%	0.615	S	S	*	*				0	144.6	0	-90.8	-167.8	-76	0	0	108.4	Q5	M1-Q5 HydrophobicContact SD-CG 4.49Å
2	D	84.3	Confident	85.7	Confident	108 Å²	108	136.1 Å²	136.1	58%	0.578	60%	0.604	S	S	*	*			trans	-67.2	140.4	170	177.1	12.6	0	0	0	110	R4 Q5 E6	D2-R4 PolarHBondContact O-N 2.94Å; D2-R4 VanDerWaalsContact O-N 3.07Å; D2-R4 PolarHBondContact OD1-N 2.94Å; D2-R4 WeakPolarHBondContact OD2-CB 3.36Å; D2-Q5 WeakPolarHBondContact O-CA 3.46Å; D2-Q5 WeakPolarHBondContact O-CB 3.46Å; D2-Q5 PolarHBondContact O-N 3.48Å; D2-E6 PolarHBondContact O-N 3.15Å
3	R	83.6	Confident	86.1	Confident	197 Å²	197	131.8 Å²	131.8	74%	0.743	59%	0.59	S	S	*	*	H	α-helix	trans	-51.9	-31.7	176.8	-75	-171	-76.1	-176.9	-6.5	112.2	R7	R3-R7 WeakPolarHBondContact O-CG 3.2Å; R3-R7 PolarHBondContact O-N 3.01Å; R3-R7 VanDerWaalsContact O-N 3.09Å
4	R	84	Confident	86.4	Confident	177 Å²	177	128 Å²	128	67%	0.668	58%	0.582	S	S	*	*	H	α-helix	trans	-67.3	-39.3	175.5	-164.9	179.2	-165.2	-179	5.6	112.4	D2 K8	D2-R4 PolarHBondContact O-N 2.94Å; D2-R4 VanDerWaalsContact O-N 3.07Å; D2-R4 PolarHBondContact OD1-N 2.94Å; D2-R4 WeakPolarHBondContact OD2-CB 3.36Å; R4-K8 WeakPolarHBondContact O-CG 3.1Å; R4-K8 PolarHBondContact O-N 3Å
5	Q	85.2	Confident	86.9	Confident	107 Å²	107	124.3 Å²	124.3	50%	0.5	57%	0.569	S	S	.	*	H	α-helix	trans	-71.5	-40.2	179.2	-166.9	66.5	5.5	0	0	110.9	M1 D2 K8 Y9	M1-Q5 HydrophobicContact SD-CG 4.49Å; D2-Q5 WeakPolarHBondContact O-CA 3.46Å; D2-Q5 WeakPolarHBondContact O-CB 3.46Å; D2-Q5 PolarHBondContact O-N 3.48Å; Q5-K8 PolarHBondContact O-N 2.98Å; Q5-Y9 WeakPolarHBondContact O-CB 3.21Å; Q5-Y9 PolarHBondContact O-N 3.03Å
6	E	84.9	Confident	87.2	Confident	96 Å²	96	121.3 Å²	121.3	45%	0.449	56%	0.562	S	S	.	*	H	α-helix	trans	-59.6	-47.8	174.3	-173.5	179.4	-173.4	0	0	111.8	D2 K8 Y9 L10	D2-E6 PolarHBondContact O-N 3.15Å; E6-K8 VanDerWaalsContact C-N 3.33Å; E6-K8 PolarHBondContact O-N 2.76Å; E6-Y9 PolarHBondContact O-N 2.99Å; E6-L10 HydrophobicContact CG-CD1 4.28Å; E6-L10 WeakPolarHBondContact O-CG 3.49Å; E6-L10 PolarHBondContact O-N 2.85Å
7	R	90.5	Very high	87.3	Confident	199 Å²	199	117.5 Å²	117.5	75%	0.751	56%	0.557	S	S	*	*	H	α-helix	trans	-59.4	-40.9	175.3	-77.3	-176.9	-177.7	-176.6	1	113	R3 K11	R3-R7 WeakPolarHBondContact O-CG 3.2Å; R3-R7 PolarHBondContact O-N 3.01Å; R3-R7 VanDerWaalsContact O-N 3.09Å; R7-K11 WeakPolarHBondContact O-CB 3.4Å; R7-K11 PolarHBondContact O-N 3.46Å
8	K	90.7	Very high	87.5	Confident	122 Å²	122	116.9 Å²	116.9	53%	0.53	55%	0.554	S	S	.	*	H	α-helix	trans	-64.9	-42.4	176.5	-76.9	179.8	-180	-178.2	0	111.5	R4 Q5 E6 K11 C12	R4-K8 WeakPolarHBondContact O-CG 3.1Å; R4-K8 PolarHBondContact O-N 3Å; Q5-K8 PolarHBondContact O-N 2.98Å; E6-K8 VanDerWaalsContact C-N 3.33Å; E6-K8 PolarHBondContact O-N 2.76Å; K8-K11 PolarHBondContact O-N 3.4Å; K8-C12 WeakPolarHBondContact O-CB 3.47Å; K8-C12 PolarHBondContact O-N 3.07Å
9	Y	90.4	Very high	87.6	Confident	136 Å²	136	117.8 Å²	117.8	53%	0.533	56%	0.555	S	S	.	*	H	α-helix	trans	-63.5	-48.5	178.2	-179	-104.3	0	0	0	111.4	Q5 E6 K11 C12 L13	Q5-Y9 WeakPolarHBondContact O-CB 3.21Å; Q5-Y9 PolarHBondContact O-N 3.03Å; E6-Y9 PolarHBondContact O-N 2.99Å; Y9-K11 VanDerWaalsContact C-N 3.34Å; Y9-K11 PolarHBondContact O-N 3.26Å; Y9-C12 WeakPolarHBondContact O-CB 3.21Å; Y9-C12 PolarHBondContact O-N 3.4Å; Y9-C12 VanDerWaalsContact O-N 3.12Å; Y9-L13 HydrophobicContact CD1-CD1 3.94Å; Y9-L13 HydrophobicContact CD1-CG 4.47Å; Y9-L13 HydrophobicContact CE1-CD1 3.42Å; Y9-L13 VanDerWaalsContact CE1-CD1 3.42Å; Y9-L13 HydrophobicContact CE1-CG 4.1Å; Y9-L13 PolarHBondContact O-N 3.24Å
10	L	91	Very high	87.7	Confident	91 Å²	91	116 Å²	116	48%	0.476	55%	0.553	S	S	.	*	H	α-helix	trans	-59.6	-43.1	175.8	-70.3	173.9	0	0	0	112	E6 C12 L13 V14	E6-L10 HydrophobicContact CG-CD1 4.28Å; E6-L10 WeakPolarHBondContact O-CG 3.49Å; E6-L10 PolarHBondContact O-N 2.85Å; L10-C12 VanDerWaalsContact C-N 3.3Å; L10-C12 PolarHBondContact O-N 3.48Å; L10-L13 WeakPolarHBondContact O-CB 3.46Å; L10-L13 PolarHBondContact O-N 2.97Å; L10-V14 WeakPolarHBondContact O-CG2 3.26Å; L10-V14 PolarHBondContact O-N 2.78Å
11	K	91.9	Very high	87.6	Confident	144 Å²	144	115.3 Å²	115.3	63%	0.626	56%	0.556	S	S	*	*	H	α-helix	trans	-61.8	-38.3	175.5	-171.8	171	-175.6	174.1	0	112.3	R7 K8 Y9 V14 N15	R7-K11 WeakPolarHBondContact O-CB 3.4Å; R7-K11 PolarHBondContact O-N 3.46Å; K8-K11 PolarHBondContact O-N 3.4Å; Y9-K11 VanDerWaalsContact C-N 3.34Å; Y9-K11 PolarHBondContact O-N 3.26Å; K11-V14 PolarHBondContact O-N 3.37Å; K11-N15 WeakPolarHBondContact O-CB 3.49Å; K11-N15 PolarHBondContact O-N 3.23Å; K11-N15 PolarHBondContact O-OD1 3.16Å
12	C	91.9	Very high	88.9	Confident	72 Å²	72	112.4 Å²	112.4	49%	0.486	54%	0.54	S	S	.	.	H	α-helix	trans	-64	-41.9	175.4	-167.8	0	0	0	0	111.7	K8 Y9 L10 N15 T16	K8-C12 WeakPolarHBondContact O-CB 3.47Å; K8-C12 PolarHBondContact O-N 3.07Å; Y9-C12 WeakPolarHBondContact O-CB 3.21Å; Y9-C12 PolarHBondContact O-N 3.4Å; Y9-C12 VanDerWaalsContact O-N 3.12Å; L10-C12 VanDerWaalsContact C-N 3.3Å; L10-C12 PolarHBondContact O-N 3.48Å; C12-N15 PolarHBondContact O-N 2.89Å; C12-T16 WeakPolarHBondContact O-CB 3.27Å; C12-T16 PolarHBondContact O-N 3.26Å; C12-T16 PolarHBondContact O-OG1 2.9Å
13	L	90.7	Very high	88.9	Confident	81 Å²	81	113 Å²	113	42%	0.424	54%	0.539	S	S	.	.	H	α-helix	trans	-63.3	-46	176.2	-70.5	178	0	0	0	112	Y9 L10 T16 A17	Y9-L13 HydrophobicContact CD1-CD1 3.94Å; Y9-L13 HydrophobicContact CD1-CG 4.47Å; Y9-L13 HydrophobicContact CE1-CD1 3.42Å; Y9-L13 VanDerWaalsContact CE1-CD1 3.42Å; Y9-L13 HydrophobicContact CE1-CG 4.1Å; Y9-L13 PolarHBondContact O-N 3.24Å; L10-L13 WeakPolarHBondContact O-CB 3.46Å; L10-L13 PolarHBondContact O-N 2.97Å; L13-T16 PolarHBondContact O-N 3.09Å; L13-A17 WeakPolarHBondContact O-CB 3.3Å; L13-A17 PolarHBondContact O-N 3.07Å
14	V	91	Very high	88.8	Confident	78 Å²	78	106.3 Å²	106.3	47%	0.473	53%	0.526	S	S	.	.	H	α-helix	trans	-59.4	-50.1	176.5	173	0	0	0	0	110.7	L10 K11 T16 A17 E18	L10-V14 WeakPolarHBondContact O-CG2 3.26Å; L10-V14 PolarHBondContact O-N 2.78Å; K11-V14 PolarHBondContact O-N 3.37Å; V14-T16 VanDerWaalsContact C-N 3.26Å; V14-T16 PolarHBondContact O-N 3.47Å; V14-A17 WeakPolarHBondContact O-CB 3.44Å; V14-A17 PolarHBondContact O-N 3.36Å; V14-A17 VanDerWaalsContact O-N 3.13Å; V14-E18 HydrophobicContact CG1-CG 4.44Å; V14-E18 WeakPolarHBondContact O-CG 3.42Å; V14-E18 PolarHBondContact O-N 3.32Å
15	N	93	Very high	88.5	Confident	72 Å²	72	100.4 Å²	100.4	39%	0.385	52%	0.515	S	S	.	.	H	α-helix	trans	-59.7	-36.6	178.3	-70.1	-1.3	0	0	0	112.6	K11 C12 K19	K11-N15 WeakPolarHBondContact O-CB 3.49Å; K11-N15 PolarHBondContact O-N 3.23Å; K11-N15 PolarHBondContact O-OD1 3.16Å; C12-N15 PolarHBondContact O-N 2.89Å; N15-K19 WeakPolarHBondContact O-CG 3.33Å; N15-K19 PolarHBondContact O-N 3.04Å; N15-K19 VanDerWaalsContact O-N 3.09Å
16	T	92.5	Very high	88.3	Confident	76 Å²	76	100.6 Å²	100.6	47%	0.466	52%	0.516	S	S	.	.	H	α-helix	trans	-70.9	-40.6	178.5	-57	0	0	0	0	110.8	C12 L13 V14 T20	C12-T16 WeakPolarHBondContact O-CB 3.27Å; C12-T16 PolarHBondContact O-N 3.26Å; C12-T16 PolarHBondContact O-OG1 2.9Å; L13-T16 PolarHBondContact O-N 3.09Å; V14-T16 VanDerWaalsContact C-N 3.26Å; V14-T16 PolarHBondContact O-N 3.47Å; T16-T20 WeakPolarHBondContact O-CB 3.45Å; T16-T20 PolarHBondContact O-N 3.06Å; T16-T20 PolarHBondContact O-OG1 3.22Å
17	A	89	Confident	88	Confident	57 Å²	57	101.9 Å²	101.9	47%	0.471	53%	0.525	S	S	.	.	H	α-helix	trans	-62.6	-46.8	174.7	0	0	0	0	0	111.3	L13 V14 T20 V21	L13-A17 WeakPolarHBondContact O-CB 3.3Å; L13-A17 PolarHBondContact O-N 3.07Å; V14-A17 WeakPolarHBondContact O-CB 3.44Å; V14-A17 PolarHBondContact O-N 3.36Å; V14-A17 VanDerWaalsContact O-N 3.13Å; A17-T20 PolarHBondContact O-N 2.89Å; A17-V21 WeakPolarHBondContact O-CG2 3.3Å; A17-V21 PolarHBondContact O-N 3.26Å
18	E	89.8	Confident	86.9	Confident	107 Å²	107	95.3 Å²	95.3	50%	0.5	50%	0.503	S	S	.	.	H	α-helix	trans	-57.2	-51.8	176.7	-75.2	175.1	172.5	0	0	111.7	V14 T20 V21 E22	V14-E18 HydrophobicContact CG1-CG 4.44Å; V14-E18 WeakPolarHBondContact O-CG 3.42Å; V14-E18 PolarHBondContact O-N 3.32Å; E18-T20 VanDerWaalsContact C-N 3.26Å; E18-T20 PolarHBondContact O-N 2.91Å; E18-V21 WeakPolarHBondContact O-CB 3.32Å; E18-V21 PolarHBondContact O-N 2.96Å; E18-V21 VanDerWaalsContact O-N 3.07Å; E18-E22 PolarHBondContact O-N 2.9Å
19	K	90.3	Very high	85.8	Confident	135 Å²	135	98 Å²	98	59%	0.587	52%	0.517	S	S	*	.	H	α-helix	trans	-59.1	-37.5	177.4	-76.6	-177.6	177.8	-173.2	0	113.1	N15 V21 E22 Q23	N15-K19 WeakPolarHBondContact O-CG 3.33Å; N15-K19 PolarHBondContact O-N 3.04Å; N15-K19 VanDerWaalsContact O-N 3.09Å; K19-V21 VanDerWaalsContact C-N 3.32Å; K19-E22 PolarHBondContact O-N 3.35Å; K19-Q23 WeakPolarHBondContact O-CB 3.46Å; K19-Q23 VanDerWaalsContact O-CG 3.3Å; K19-Q23 WeakPolarHBondContact O-CG 3.32Å; K19-Q23 PolarHBondContact O-N 2.84Å
20	T	90	Very high	84.8	Confident	81 Å²	81	98.7 Å²	98.7	50%	0.497	52%	0.523	S	S	.	.	H	α-helix	trans	-67.9	-36.7	178.8	-54.7	0	0	0	0	111	T16 A17 E18 A24	T16-T20 WeakPolarHBondContact O-CB 3.45Å; T16-T20 PolarHBondContact O-N 3.06Å; T16-T20 PolarHBondContact O-OG1 3.22Å; A17-T20 PolarHBondContact O-N 2.89Å; E18-T20 VanDerWaalsContact C-N 3.26Å; E18-T20 PolarHBondContact O-N 2.91Å; T20-A24 WeakPolarHBondContact O-CB 3.45Å; T20-A24 PolarHBondContact O-N 2.71Å; T20-A24 VanDerWaalsContact O-N 3.09Å
21	V	86	Confident	83.6	Confident	102 Å²	102	101 Å²	101	62%	0.618	53%	0.529	S	S	*	.	H	α-helix	trans	-68.4	-44.7	175.1	173	0	0	0	0	110.9	A17 E18 K19 A24 A25	A17-V21 WeakPolarHBondContact O-CG2 3.3Å; A17-V21 PolarHBondContact O-N 3.26Å; E18-V21 WeakPolarHBondContact O-CB 3.32Å; E18-V21 PolarHBondContact O-N 2.96Å; E18-V21 VanDerWaalsContact O-N 3.07Å; K19-V21 VanDerWaalsContact C-N 3.32Å; V21-A24 PolarHBondContact O-N 3.09Å; V21-A25 PolarHBondContact O-N 3.26Å
22	E	85.8	Confident	82.2	Confident	122 Å²	122	103.1 Å²	103.1	57%	0.57	54%	0.538	S	S	*	.	H	α-helix	trans	-59.2	-48.5	176	-72.8	176.3	170.8	0	0	111.9	E18 K19 A24 A25 E26	E18-E22 PolarHBondContact O-N 2.9Å; K19-E22 PolarHBondContact O-N 3.35Å; E22-A24 VanDerWaalsContact C-N 3.29Å; E22-A24 PolarHBondContact O-N 3.35Å; E22-A25 WeakPolarHBondContact O-CB 3.36Å; E22-A25 PolarHBondContact O-N 2.97Å; E22-A25 VanDerWaalsContact O-N 3.13Å; E22-E26 PolarHBondContact O-N 3.46Å
23	Q	84.4	Confident	80.5	Confident	121 Å²	121	104.2 Å²	104.2	57%	0.565	55%	0.545	S	S	*	.	H	α-helix	trans	-62.2	-36.6	177.5	-74.2	-179.8	-14.4	0	0	112.6	K19 A25 L27	K19-Q23 WeakPolarHBondContact O-CB 3.46Å; K19-Q23 VanDerWaalsContact O-CG 3.3Å; K19-Q23 WeakPolarHBondContact O-CG 3.32Å; K19-Q23 PolarHBondContact O-N 2.84Å; Q23-A25 VanDerWaalsContact C-N 3.34Å; Q23-L27 WeakPolarHBondContact O-CB 2.82Å; Q23-L27 WeakPolarHBondContact O-CG 2.86Å; Q23-L27 PolarHBondContact O-N 2.88Å; Q23-L27 VanDerWaalsContact O-N 3.09Å
24	A	82.2	Confident	79	Confident	56 Å²	56	105.5 Å²	105.5	46%	0.463	55%	0.551	S	S	.	*	H	α-helix	trans	-65.6	-39.2	175.5	0	0	0	0	0	111.6	T20 V21 E22 E28	T20-A24 WeakPolarHBondContact O-CB 3.45Å; T20-A24 PolarHBondContact O-N 2.71Å; T20-A24 VanDerWaalsContact O-N 3.09Å; V21-A24 PolarHBondContact O-N 3.09Å; E22-A24 VanDerWaalsContact C-N 3.29Å; E22-A24 PolarHBondContact O-N 3.35Å; A24-E28 WeakPolarHBondContact O-CB 3.43Å; A24-E28 PolarHBondContact O-N 3.27Å
25	A	77.7	Confident	77.5	Confident	53 Å²	53	105.8 Å²	105.8	44%	0.438	56%	0.562	S	S	.	*	H	α-helix	trans	-68.1	-43.5	175.7	0	0	0	0	0	112.2	V21 E22 Q23 L27 E28 E29	V21-A25 PolarHBondContact O-N 3.26Å; E22-A25 WeakPolarHBondContact O-CB 3.36Å; E22-A25 PolarHBondContact O-N 2.97Å; E22-A25 VanDerWaalsContact O-N 3.13Å; Q23-A25 VanDerWaalsContact C-N 3.34Å; A25-L27 PolarHBondContact O-N 3.21Å; A25-E28 WeakPolarHBondContact O-CA 3.17Å; A25-E28 VanDerWaalsContact O-CB 3.27Å; A25-E28 WeakPolarHBondContact O-CB 3.48Å; A25-E28 PolarHBondContact O-N 3.04Å; A25-E29 PolarHBondContact O-N 2.91Å; A25-E29 VanDerWaalsContact O-N 3.07Å
26	E	80.7	Confident	76	Confident	111 Å²	111	105.6 Å²	105.6	52%	0.519	58%	0.577	S	S	.	*	H	α-helix	trans	-63.4	-41.4	177.6	-76.4	-172.1	-169	0	0	113.3	E22 E28 K30	E22-E26 PolarHBondContact O-N 3.46Å; E26-E28 PolarHBondContact O-N 3.13Å; E26-K30 WeakPolarHBondContact O-CG 3.34Å; E26-K30 PolarHBondContact O-N 3.41Å
27	L	78.5	Confident	74.6	Confident	123 Å²	123	109.4 Å²	109.4	64%	0.644	59%	0.594	S	S	*	*	H	α-helix	trans	-63.6	-21.6	175.1	-78.8	171.9	0	0	0	112.1	Q23 A25	Q23-L27 WeakPolarHBondContact O-CB 2.82Å; Q23-L27 WeakPolarHBondContact O-CG 2.86Å; Q23-L27 PolarHBondContact O-N 2.88Å; Q23-L27 VanDerWaalsContact O-N 3.09Å; A25-L27 PolarHBondContact O-N 3.21Å
28	E	68.2	Low	73.7	Confident	62 Å²	62	108.6 Å²	108.6	29%	0.29	59%	0.585	S	S	.	*	H	α-helix	trans	-84.6	-45.8	-179.5	-172.1	163.6	163.2	0	0	113	A24 A25 E26 K30 K31 W46	A24-E28 WeakPolarHBondContact O-CB 3.43Å; A24-E28 PolarHBondContact O-N 3.27Å; A25-E28 WeakPolarHBondContact O-CA 3.17Å; A25-E28 VanDerWaalsContact O-CB 3.27Å; A25-E28 WeakPolarHBondContact O-CB 3.48Å; A25-E28 PolarHBondContact O-N 3.04Å; E26-E28 PolarHBondContact O-N 3.13Å; E28-K30 PolarHBondContact O-N 2.99Å; E28-K30 VanDerWaalsContact O-N 3.16Å; E28-K31 WeakPolarHBondContact O-CB 3.39Å; E28-K31 PolarHBondContact O-N 3.07Å; E28-W46 VanDerWaalsContact CD-NE1 3.29Å; E28-W46 WeakPolarHBondContact OE1-CH2 3.45Å; E28-W46 WeakPolarHBondContact OE1-CZ2 3.45Å; E28-W46 PolarHBondContact OE1-NE1 3.48Å; E28-W46 WeakPolarHBondContact OE2-CZ2 3.39Å; E28-W46 PolarHBondContact OE2-NE1 3.12Å
29	E	66.3	Low	72.9	Confident	177 Å²	177	109.2 Å²	109.2	83%	0.827	58%	0.583	S	S	*	*	H	α-helix	trans	-56.2	-32.4	173.8	-73.9	-169.4	164.1	0	0	112	A25 K31	A25-E29 PolarHBondContact O-N 2.91Å; A25-E29 VanDerWaalsContact O-N 3.07Å; E29-K31 PolarHBondContact O-N 3.03Å
30	K	71	Confident	72.5	Confident	151 Å²	151	109.6 Å²	109.6	66%	0.657	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.6	-11.1	178.5	-72.4	171.5	-178.3	161.9	0	114.3	E26 E28 K32	E26-K30 WeakPolarHBondContact O-CG 3.34Å; E26-K30 PolarHBondContact O-N 3.41Å; E28-K30 PolarHBondContact O-N 2.99Å; E28-K30 VanDerWaalsContact O-N 3.16Å; K30-K32 PolarHBondContact O-N 3.48Å
31	K	65.6	Low	72.3	Confident	141 Å²	141	112.2 Å²	112.2	61%	0.613	59%	0.589	S	S	*	*	S	Bend	trans	-76.2	95	175.3	-71.3	179.4	-176.4	167.2	0	110.2	E28 E29	E28-K31 WeakPolarHBondContact O-CB 3.39Å; E28-K31 PolarHBondContact O-N 3.07Å; E29-K31 PolarHBondContact O-N 3.03Å
32	K	61.8	Low	72.3	Confident	187 Å²	187	111.9 Å²	111.9	81%	0.813	58%	0.58	S	S	*	*			trans	-45.3	132.9	172.6	-69.7	-176.6	179	-178.3	0	111.2	K30 L34	K30-K32 PolarHBondContact O-N 3.48Å; K32-L34 PolarHBondContact O-N 3.49Å
33	P	56.5	Low	72.4	Confident	95 Å²	95	108.1 Å²	108.1	62%	0.617	57%	0.565	S	S	*	*			trans	-68.2	106.2	-179.7	23.9	-29.3	0	0	0	110	A35 Y39	P33-A35 PolarHBondContact O-N 3.09Å; P33-Y39 HydrophobicContact CB-CD2 3.59Å; P33-Y39 HydrophobicContact CB-CE2 3.86Å; P33-Y39 HydrophobicContact CB-CG 4.13Å
34	L	58.6	Low	72.6	Confident	108 Å²	108	106.8 Å²	106.8	57%	0.565	56%	0.561	S	S	*	*			trans	-71.3	97.3	172.5	-90.5	143.6	0	0	0	109.3	K32 S38 Y39	K32-L34 PolarHBondContact O-N 3.49Å; L34-S38 WeakPolarHBondContact CB-OG 3.33Å; L34-S38 CarbonylContact O-C 3.58Å; L34-S38 WeakPolarHBondContact O-CB 3.48Å; L34-S38 PolarHBondContact O-OG 3.37Å; L34-Y39 PolarHBondContact O-N 2.85Å
35	A	59.3	Low	72.9	Confident	85 Å²	85	108.2 Å²	108.2	70%	0.702	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	27.2	100.1	164	0	0	0	0	0	116	P33 L37 S38	P33-A35 PolarHBondContact O-N 3.09Å; A35-L37 PolarHBondContact O-N 3.06Å; A35-S38 PolarHBondContact O-N 3.48Å; A35-S38 VanDerWaalsContact O-N 3.15Å
36	G	61.6	Low	73.5	Confident	67 Å²	67	109.1 Å²	109.1	69%	0.691	55%	0.55	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.7	-74.7	155.2	0	0	0	0	0	117.9
37	L	63	Low	74	Confident	156 Å²	156	108.2 Å²	108.2	82%	0.817	55%	0.548	S	S	*	.	H	α-helix	trans	-90.8	-37.3	-175.7	-70.3	165	0	0	0	112.5	A35 Y39 K41	A35-L37 PolarHBondContact O-N 3.06Å; L37-Y39 VanDerWaalsContact C-N 3.28Å; L37-Y39 PolarHBondContact O-N 3.3Å; L37-K41 PolarHBondContact O-N 3.01Å
38	S	70.3	Confident	74.7	Confident	41 Å²	41	106.9 Å²	106.9	29%	0.287	55%	0.545	S	S	.	.	H	α-helix	trans	-66.7	-35.8	175.6	135	0	0	0	0	110.5	L34 A35 K42	L34-S38 WeakPolarHBondContact CB-OG 3.33Å; L34-S38 CarbonylContact O-C 3.58Å; L34-S38 WeakPolarHBondContact O-CB 3.48Å; L34-S38 PolarHBondContact O-OG 3.37Å; A35-S38 PolarHBondContact O-N 3.48Å; A35-S38 VanDerWaalsContact O-N 3.15Å; S38-K42 VanDerWaalsContact O-CB 3.26Å; S38-K42 WeakPolarHBondContact O-CB 3.48Å; S38-K42 WeakPolarHBondContact O-CG 3.46Å; S38-K42 PolarHBondContact O-N 2.77Å; S38-K42 PolarHBondContact OG-NZ 2.9Å
39	Y	73.8	Confident	75.9	Confident	120 Å²	120	111.9 Å²	111.9	47%	0.471	56%	0.561	S	S	.	*	H	α-helix	trans	-61.7	-55.8	177.3	-177.6	-105.6	0	0	0	111.3	P33 L34 L37 K41 K42 T43	P33-Y39 HydrophobicContact CB-CD2 3.59Å; P33-Y39 HydrophobicContact CB-CE2 3.86Å; P33-Y39 HydrophobicContact CB-CG 4.13Å; L34-Y39 PolarHBondContact O-N 2.85Å; L37-Y39 VanDerWaalsContact C-N 3.28Å; L37-Y39 PolarHBondContact O-N 3.3Å; Y39-K41 VanDerWaalsContact C-N 3.3Å; Y39-K41 PolarHBondContact O-N 3.07Å; Y39-K42 CarbonylContact O-C 3.59Å; Y39-K42 PolarHBondContact O-N 3.49Å; Y39-T43 WeakPolarHBondContact O-CB 3.36Å; Y39-T43 PolarHBondContact O-N 3.26Å; Y39-T43 PolarHBondContact O-OG1 2.85Å
40	K	82.1	Confident	77.1	Confident	143 Å²	143	105.7 Å²	105.7	62%	0.622	53%	0.532	S	S	*	.	H	α-helix	trans	-55.2	-44.9	179.4	-174.2	177.2	-178.8	179.6	0	112	T43 I44	K40-T43 PolarHBondContact O-N 3.25Å; K40-I44 HydrophobicContact CG-CD1 4.08Å; K40-I44 VanDerWaalsContact O-CG1 3.3Å; K40-I44 WeakPolarHBondContact O-CG1 3.33Å; K40-I44 PolarHBondContact O-N 2.88Å
41	K	85.4	Confident	78.2	Confident	136 Å²	136	105 Å²	105	59%	0.591	53%	0.529	S	S	*	.	H	α-helix	trans	-62.1	-47	176.7	-175.1	176.3	175.6	179.7	0	111.8	L37 Y39 T43 I44 E45	L37-K41 PolarHBondContact O-N 3.01Å; Y39-K41 VanDerWaalsContact C-N 3.3Å; Y39-K41 PolarHBondContact O-N 3.07Å; K41-T43 VanDerWaalsContact C-N 3.34Å; K41-T43 PolarHBondContact O-N 3.09Å; K41-I44 PolarHBondContact O-N 3.31Å; K41-E45 WeakPolarHBondContact CE-OE1 3.33Å; K41-E45 WeakPolarHBondContact O-CG 3.41Å; K41-E45 PolarHBondContact O-N 3.29Å
42	K	84.9	Confident	79.6	Confident	95 Å²	95	100.5 Å²	100.5	41%	0.413	52%	0.515	S	S	.	.	H	α-helix	trans	-62.7	-38.5	177.2	-77.5	170.6	177.5	155.8	0	112.6	S38 Y39 E45 W46	S38-K42 VanDerWaalsContact O-CB 3.26Å; S38-K42 WeakPolarHBondContact O-CB 3.48Å; S38-K42 WeakPolarHBondContact O-CG 3.46Å; S38-K42 PolarHBondContact O-N 2.77Å; S38-K42 PolarHBondContact OG-NZ 2.9Å; Y39-K42 CarbonylContact O-C 3.59Å; Y39-K42 PolarHBondContact O-N 3.49Å; K42-E45 PolarHBondContact O-N 2.97Å; K42-W46 WeakPolarHBondContact O-CB 3.4Å; K42-W46 PolarHBondContact O-N 3.13Å
43	T	88.2	Confident	81.1	Confident	43 Å²	43	98.5 Å²	98.5	26%	0.264	50%	0.503	S	S	.	.	H	α-helix	trans	-64.7	-44.5	175.3	-55.8	0	0	0	0	110.7	Y39 K40 K41 W46 L47	Y39-T43 WeakPolarHBondContact O-CB 3.36Å; Y39-T43 PolarHBondContact O-N 3.26Å; Y39-T43 PolarHBondContact O-OG1 2.85Å; K40-T43 PolarHBondContact O-N 3.25Å; K41-T43 VanDerWaalsContact C-N 3.34Å; K41-T43 PolarHBondContact O-N 3.09Å; T43-W46 PolarHBondContact O-N 2.89Å; T43-L47 HydrophobicContact CG2-CD1 4.26Å; T43-L47 WeakPolarHBondContact O-CB 3.44Å; T43-L47 WeakPolarHBondContact O-CG 3.36Å; T43-L47 PolarHBondContact O-N 2.97Å
44	I	88.4	Confident	82.9	Confident	92 Å²	92	98.4 Å²	98.4	47%	0.472	50%	0.496	S	S	.	.	H	α-helix	trans	-63.1	-47.5	175.7	-68.2	167	0	0	0	110.7	K40 K41 W46 L47 V48	K40-I44 HydrophobicContact CG-CD1 4.08Å; K40-I44 VanDerWaalsContact O-CG1 3.3Å; K40-I44 WeakPolarHBondContact O-CG1 3.33Å; K40-I44 PolarHBondContact O-N 2.88Å; K41-I44 PolarHBondContact O-N 3.31Å; I44-W46 VanDerWaalsContact C-N 3.27Å; I44-W46 PolarHBondContact O-N 3.26Å; I44-L47 PolarHBondContact O-N 3.15Å; I44-V48 HydrophobicContact CG2-CG2 4.47Å; I44-V48 VanDerWaalsContact O-CG2 3.32Å; I44-V48 WeakPolarHBondContact O-CG2 3.02Å; I44-V48 PolarHBondContact O-N 3.34Å
45	E	89.7	Confident	84.7	Confident	86 Å²	86	98 Å²	98	40%	0.402	49%	0.491	S	S	.	.	H	α-helix	trans	-59.6	-39.4	176.6	-75	175.6	-170.8	0	0	111.9	K41 K42 R49	K41-E45 WeakPolarHBondContact CE-OE1 3.33Å; K41-E45 WeakPolarHBondContact O-CG 3.41Å; K41-E45 PolarHBondContact O-N 3.29Å; K42-E45 PolarHBondContact O-N 2.97Å; E45-R49 WeakPolarHBondContact O-CG 3.47Å; E45-R49 PolarHBondContact O-N 3.33Å
46	W	89.6	Confident	86.4	Confident	73 Å²	73	100.6 Å²	100.6	28%	0.277	49%	0.487	S	S	.	.	H	α-helix	trans	-65.2	-46.9	174.7	174.7	91.7	0	0	0	111.6	E28 K42 T43 I44 V48 R49 Q50	E28-W46 VanDerWaalsContact CD-NE1 3.29Å; E28-W46 WeakPolarHBondContact OE1-CH2 3.45Å; E28-W46 WeakPolarHBondContact OE1-CZ2 3.45Å; E28-W46 PolarHBondContact OE1-NE1 3.48Å; E28-W46 WeakPolarHBondContact OE2-CZ2 3.39Å; E28-W46 PolarHBondContact OE2-NE1 3.12Å; K42-W46 WeakPolarHBondContact O-CB 3.4Å; K42-W46 PolarHBondContact O-N 3.13Å; T43-W46 PolarHBondContact O-N 2.89Å; I44-W46 VanDerWaalsContact C-N 3.27Å; I44-W46 PolarHBondContact O-N 3.26Å; W46-V48 VanDerWaalsContact C-N 3.31Å; W46-V48 PolarHBondContact O-N 2.99Å; W46-R49 WeakPolarHBondContact O-CB 3.42Å; W46-R49 PolarHBondContact O-N 3.12Å; W46-R49 VanDerWaalsContact O-N 3.09Å; W46-Q50 HydrophobicContact CD2-CG 3.93Å; W46-Q50 VanDerWaalsContact CE2-NE2 3.33Å; W46-Q50 HydrophobicContact CE3-CG 4.34Å; W46-Q50 HydrophobicContact CH2-CG 3.8Å; W46-Q50 HydrophobicContact CZ2-CG 3.27Å; W46-Q50 HydrophobicContact CZ3-CG 4.31Å; W46-Q50 VanDerWaalsContact NE1-NE2 3.11Å; W46-Q50 WeakPolarHBondContact O-CG 3.48Å; W46-Q50 PolarHBondContact O-N 3.1Å
47	L	92.3	Very high	88	Confident	92 Å²	92	102.8 Å²	102.8	48%	0.482	48%	0.479	S	S	.	.	H	α-helix	trans	-58.8	-41.6	176.4	-76.3	170.6	0	0	0	111.7	T43 I44 R49 Q50 K51	T43-L47 HydrophobicContact CG2-CD1 4.26Å; T43-L47 WeakPolarHBondContact O-CB 3.44Å; T43-L47 WeakPolarHBondContact O-CG 3.36Å; T43-L47 PolarHBondContact O-N 2.97Å; I44-L47 PolarHBondContact O-N 3.15Å; L47-R49 VanDerWaalsContact C-N 3.35Å; L47-R49 PolarHBondContact O-N 3.41Å; L47-Q50 PolarHBondContact O-N 2.84Å; L47-K51 WeakPolarHBondContact O-CB 3.5Å; L47-K51 PolarHBondContact O-N 3.2Å
48	V	92.8	Very high	89.5	Confident	95 Å²	95	99.1 Å²	99.1	58%	0.576	46%	0.463	S	S	*	.	H	α-helix	trans	-62.1	-42.9	175.5	170.3	0	0	0	0	111	I44 W46 K51 S52	I44-V48 HydrophobicContact CG2-CG2 4.47Å; I44-V48 VanDerWaalsContact O-CG2 3.32Å; I44-V48 WeakPolarHBondContact O-CG2 3.02Å; I44-V48 PolarHBondContact O-N 3.34Å; W46-V48 VanDerWaalsContact C-N 3.31Å; W46-V48 PolarHBondContact O-N 2.99Å; V48-K51 PolarHBondContact O-N 3.4Å; V48-S52 PolarHBondContact O-N 2.96Å
49	R	93.2	Very high	90.7	Very high	167 Å²	167	103.2 Å²	103.2	63%	0.63	48%	0.48	S	S	*	.	H	α-helix	trans	-64.7	-40.6	176.1	-72.7	174.8	-176	-173	3.2	112	E45 W46 L47 S52 R53	E45-R49 WeakPolarHBondContact O-CG 3.47Å; E45-R49 PolarHBondContact O-N 3.33Å; W46-R49 WeakPolarHBondContact O-CB 3.42Å; W46-R49 PolarHBondContact O-N 3.12Å; W46-R49 VanDerWaalsContact O-N 3.09Å; L47-R49 VanDerWaalsContact C-N 3.35Å; L47-R49 PolarHBondContact O-N 3.41Å; R49-S52 PolarHBondContact O-N 3.01Å; R49-R53 WeakPolarHBondContact O-CG 3.34Å; R49-R53 PolarHBondContact O-N 3.43Å
50	Q	92.2	Very high	91.8	Very high	46 Å²	46	103.4 Å²	103.4	22%	0.215	49%	0.487	C	S	.	.	H	α-helix	trans	-67.4	-44.6	177	-66	-56.5	-10.9	0	0	112	W46 L47 S52 R53 I54	W46-Q50 HydrophobicContact CD2-CG 3.93Å; W46-Q50 VanDerWaalsContact CE2-NE2 3.33Å; W46-Q50 HydrophobicContact CE3-CG 4.34Å; W46-Q50 HydrophobicContact CH2-CG 3.8Å; W46-Q50 HydrophobicContact CZ2-CG 3.27Å; W46-Q50 HydrophobicContact CZ3-CG 4.31Å; W46-Q50 VanDerWaalsContact NE1-NE2 3.11Å; W46-Q50 WeakPolarHBondContact O-CG 3.48Å; W46-Q50 PolarHBondContact O-N 3.1Å; L47-Q50 PolarHBondContact O-N 2.84Å; Q50-S52 VanDerWaalsContact C-N 3.28Å; Q50-S52 PolarHBondContact O-N 2.97Å; Q50-R53 WeakPolarHBondContact O-CB 3.44Å; Q50-R53 PolarHBondContact O-N 2.99Å; Q50-I54 WeakPolarHBondContact O-CG1 3.35Å; Q50-I54 PolarHBondContact O-N 3.48Å
51	K	93.5	Very high	92.4	Very high	136 Å²	136	101.2 Å²	101.2	59%	0.591	48%	0.481	S	S	*	.	H	α-helix	trans	-53	-48.8	174.2	-179.4	178.2	172.1	-179.9	0	110.8	L47 V48 R53 I54 E55	L47-K51 WeakPolarHBondContact O-CB 3.5Å; L47-K51 PolarHBondContact O-N 3.2Å; V48-K51 PolarHBondContact O-N 3.4Å; K51-R53 VanDerWaalsContact C-N 3.35Å; K51-R53 PolarHBondContact O-N 3.07Å; K51-I54 PolarHBondContact O-N 3.18Å; K51-E55 WeakPolarHBondContact CE-OE1 3.48Å; K51-E55 WeakPolarHBondContact O-CG 3.36Å; K51-E55 PolarHBondContact O-N 2.93Å
52	S	94.2	Very high	92.9	Very high	47 Å²	47	98.5 Å²	98.5	33%	0.329	48%	0.476	S	S	.	.	H	α-helix	trans	-63.4	-36.6	177.8	-176.3	0	0	0	0	113.4	V48 R49 Q50 K56	V48-S52 PolarHBondContact O-N 2.96Å; R49-S52 PolarHBondContact O-N 3.01Å; Q50-S52 VanDerWaalsContact C-N 3.28Å; Q50-S52 PolarHBondContact O-N 2.97Å; S52-K56 WeakPolarHBondContact O-CG 3.3Å; S52-K56 PolarHBondContact O-N 3.27Å; S52-K56 VanDerWaalsContact O-N 3.15Å
53	R	94.7	Very high	93.5	Very high	145 Å²	145	95.6 Å²	95.6	55%	0.547	47%	0.473	S	S	.	.	H	α-helix	trans	-66.2	-44.2	174.7	-74.9	171.4	176.8	-178	-5.1	111.7	R49 Q50 K51 K56 Q57	R49-R53 WeakPolarHBondContact O-CG 3.34Å; R49-R53 PolarHBondContact O-N 3.43Å; Q50-R53 WeakPolarHBondContact O-CB 3.44Å; Q50-R53 PolarHBondContact O-N 2.99Å; K51-R53 VanDerWaalsContact C-N 3.35Å; K51-R53 PolarHBondContact O-N 3.07Å; R53-K56 PolarHBondContact O-N 2.98Å; R53-Q57 WeakPolarHBondContact O-CG 3.43Å; R53-Q57 PolarHBondContact O-N 3.48Å
54	I	94.4	Very high	93.9	Very high	94 Å²	94	98.6 Å²	98.6	48%	0.482	49%	0.486	S	S	.	.	H	α-helix	trans	-63	-44.9	177.8	-68.1	166.9	0	0	0	109.9	Q50 K51 K56 Q57 V58	Q50-I54 WeakPolarHBondContact O-CG1 3.35Å; Q50-I54 PolarHBondContact O-N 3.48Å; K51-I54 PolarHBondContact O-N 3.18Å; I54-K56 VanDerWaalsContact C-N 3.31Å; I54-K56 PolarHBondContact O-N 3.22Å; I54-Q57 PolarHBondContact O-N 3.48Å; I54-Q57 VanDerWaalsContact O-N 3.12Å; I54-V58 HydrophobicContact CG2-CG2 4.28Å; I54-V58 WeakPolarHBondContact O-CG2 3.33Å; I54-V58 PolarHBondContact O-N 3.39Å
55	E	94.5	Very high	94.2	Very high	98 Å²	98	98.4 Å²	98.4	46%	0.458	49%	0.485	S	S	.	.	H	α-helix	trans	-56.3	-44.2	175.4	-75	168.9	173.2	0	0	111.9	K51 V58 I59	K51-E55 WeakPolarHBondContact CE-OE1 3.48Å; K51-E55 WeakPolarHBondContact O-CG 3.36Å; K51-E55 PolarHBondContact O-N 2.93Å; E55-V58 PolarHBondContact O-N 2.89Å; E55-I59 WeakPolarHBondContact O-CG1 3.45Å; E55-I59 PolarHBondContact O-N 3.25Å; E55-I59 VanDerWaalsContact O-N 3.07Å
56	K	95.6	Very high	94.6	Very high	140 Å²	140	97.7 Å²	97.7	61%	0.609	49%	0.49	S	S	*	.	H	α-helix	trans	-64.4	-40.5	175.7	-71.3	175.1	-176.8	-177.3	0	112.8	S52 R53 I54 I59 M60	S52-K56 WeakPolarHBondContact O-CG 3.3Å; S52-K56 PolarHBondContact O-N 3.27Å; S52-K56 VanDerWaalsContact O-N 3.15Å; R53-K56 PolarHBondContact O-N 2.98Å; I54-K56 VanDerWaalsContact C-N 3.31Å; I54-K56 PolarHBondContact O-N 3.22Å; K56-I59 PolarHBondContact O-N 3.38Å; K56-M60 PolarHBondContact O-N 3.01Å; K56-M60 VanDerWaalsContact O-N 3.1Å
57	Q	95.6	Very high	95	Very high	114 Å²	114	101.6 Å²	101.6	53%	0.533	51%	0.508	S	S	.	.	H	α-helix	trans	-65.7	-41.8	176.7	-73.7	176.6	-2.9	0	0	111.5	R53 I54 I59 M60 I61	R53-Q57 WeakPolarHBondContact O-CG 3.43Å; R53-Q57 PolarHBondContact O-N 3.48Å; I54-Q57 PolarHBondContact O-N 3.48Å; I54-Q57 VanDerWaalsContact O-N 3.12Å; Q57-I59 PolarHBondContact O-N 2.88Å; Q57-M60 WeakPolarHBondContact O-CB 3.49Å; Q57-M60 PolarHBondContact O-N 3.04Å; Q57-I61 VanDerWaalsContact O-CG1 3.3Å; Q57-I61 WeakPolarHBondContact O-CG1 3.29Å; Q57-I61 PolarHBondContact O-N 3.13Å
58	V	95	Very high	95.2	Very high	79 Å²	79	99.6 Å²	99.6	48%	0.479	51%	0.505	S	S	.	.	H	α-helix	trans	-59.5	-46.8	175.9	170.3	0	0	0	0	110.7	I54 E55 M60 I61 V62	I54-V58 HydrophobicContact CG2-CG2 4.28Å; I54-V58 WeakPolarHBondContact O-CG2 3.33Å; I54-V58 PolarHBondContact O-N 3.39Å; E55-V58 PolarHBondContact O-N 2.89Å; V58-M60 VanDerWaalsContact C-N 3.31Å; V58-M60 PolarHBondContact O-N 3.28Å; V58-I61 PolarHBondContact O-N 3.42Å; V58-V62 HydrophobicContact CG1-CG2 4.33Å; V58-V62 VanDerWaalsContact O-CG2 3.29Å; V58-V62 WeakPolarHBondContact O-CG2 3.37Å; V58-V62 PolarHBondContact O-N 2.9Å
59	I	95.7	Very high	95.4	Very high	126 Å²	126	99 Å²	99	65%	0.646	50%	0.499	S	S	*	.	H	α-helix	trans	-58.7	-43.9	176.9	-67.9	164.9	0	0	0	111.1	E55 K56 Q57 V62 G63	E55-I59 WeakPolarHBondContact O-CG1 3.45Å; E55-I59 PolarHBondContact O-N 3.25Å; E55-I59 VanDerWaalsContact O-N 3.07Å; K56-I59 PolarHBondContact O-N 3.38Å; Q57-I59 PolarHBondContact O-N 2.88Å; I59-V62 PolarHBondContact O-N 3.09Å; I59-G63 PolarHBondContact O-N 3.37Å
60	M	95.7	Very high	95.6	Very high	125 Å²	125	97.1 Å²	97.1	62%	0.616	50%	0.495	S	S	*	.	H	α-helix	trans	-62.8	-45.4	178.2	-170.5	-172.8	-53.7	0	0	111.8	K56 Q57 V58 G63 I64	K56-M60 PolarHBondContact O-N 3.01Å; K56-M60 VanDerWaalsContact O-N 3.1Å; Q57-M60 WeakPolarHBondContact O-CB 3.49Å; Q57-M60 PolarHBondContact O-N 3.04Å; V58-M60 VanDerWaalsContact C-N 3.31Å; V58-M60 PolarHBondContact O-N 3.28Å; M60-G63 PolarHBondContact O-N 2.85Å; M60-I64 HydrophobicContact CG-CD1 4.25Å; M60-I64 WeakPolarHBondContact O-CG1 3.4Å; M60-I64 PolarHBondContact O-N 3.19Å
61	I	95.3	Very high	95.8	Very high	96 Å²	96	100.1 Å²	100.1	49%	0.492	51%	0.512	S	S	.	.	H	α-helix	trans	-63.4	-45.4	178.9	-70.1	166.3	0	0	0	110.6	Q57 V58 G63 I64 I65	Q57-I61 VanDerWaalsContact O-CG1 3.3Å; Q57-I61 WeakPolarHBondContact O-CG1 3.29Å; Q57-I61 PolarHBondContact O-N 3.13Å; V58-I61 PolarHBondContact O-N 3.42Å; I61-G63 VanDerWaalsContact C-N 3.29Å; I61-G63 PolarHBondContact O-N 2.92Å; I61-I64 PolarHBondContact O-N 2.9Å; I61-I64 VanDerWaalsContact O-N 3.13Å; I61-I65 HydrophobicContact CG2-CD1 3.74Å; I61-I65 HydrophobicContact CG2-CG1 4.35Å; I61-I65 WeakPolarHBondContact O-CG1 3.35Å; I61-I65 PolarHBondContact O-N 3.33Å
62	V	95.7	Very high	96	Very high	80 Å²	80	99 Å²	99	49%	0.485	51%	0.509	S	S	.	.	H	α-helix	trans	-57.6	-44.4	175.6	170.2	0	0	0	0	110.5	V58 I59 I64 I65 S66	V58-V62 HydrophobicContact CG1-CG2 4.33Å; V58-V62 VanDerWaalsContact O-CG2 3.29Å; V58-V62 WeakPolarHBondContact O-CG2 3.37Å; V58-V62 PolarHBondContact O-N 2.9Å; I59-V62 PolarHBondContact O-N 3.09Å; V62-I64 VanDerWaalsContact C-N 3.34Å; V62-I64 PolarHBondContact O-N 2.91Å; V62-I65 PolarHBondContact O-N 3.19Å; V62-S66 PolarHBondContact O-N 3.37Å; V62-S66 PolarHBondContact O-OG 3.13Å; V62-S66 VanDerWaalsContact O-OG 3.13Å
63	G	96.7	Very high	96.1	Very high	34 Å²	34	101.2 Å²	101.2	35%	0.351	52%	0.516	S	S	.	.	H	α-helix	trans	-62.9	-36.7	176.4	0	0	0	0	0	113.9	I59 M60 I61 K67	I59-G63 PolarHBondContact O-N 3.37Å; M60-G63 PolarHBondContact O-N 2.85Å; I61-G63 VanDerWaalsContact C-N 3.29Å; I61-G63 PolarHBondContact O-N 2.92Å; G63-K67 WeakPolarHBondContact O-CG 3.46Å; G63-K67 PolarHBondContact O-N 3.28Å
64	I	96.8	Very high	96.1	Very high	106 Å²	106	97.9 Å²	97.9	54%	0.544	51%	0.507	S	S	.	.	H	α-helix	trans	-66.8	-46.2	174.5	-68.8	165.3	0	0	0	110.5	M60 I61 V62 S66 K67 A68	M60-I64 HydrophobicContact CG-CD1 4.25Å; M60-I64 WeakPolarHBondContact O-CG1 3.4Å; M60-I64 PolarHBondContact O-N 3.19Å; I61-I64 PolarHBondContact O-N 2.9Å; I61-I64 VanDerWaalsContact O-N 3.13Å; V62-I64 VanDerWaalsContact C-N 3.34Å; V62-I64 PolarHBondContact O-N 2.91Å; I64-S66 PolarHBondContact O-N 3.47Å; I64-K67 PolarHBondContact O-N 3.35Å; I64-A68 PolarHBondContact O-N 3.07Å
65	I	95.8	Very high	96.2	Very high	88 Å²	88	98.6 Å²	98.6	45%	0.451	51%	0.511	S	S	.	.	H	α-helix	trans	-60.1	-46	178.5	-67.9	168.3	0	0	0	110.4	I61 V62 K67 A68 N69	I61-I65 HydrophobicContact CG2-CD1 3.74Å; I61-I65 HydrophobicContact CG2-CG1 4.35Å; I61-I65 WeakPolarHBondContact O-CG1 3.35Å; I61-I65 PolarHBondContact O-N 3.33Å; V62-I65 PolarHBondContact O-N 3.19Å; I65-K67 VanDerWaalsContact C-N 3.31Å; I65-K67 PolarHBondContact O-N 3.22Å; I65-A68 PolarHBondContact O-N 3.04Å; I65-N69 VanDerWaalsContact O-CG 3.31Å; I65-N69 PolarHBondContact O-N 3.35Å; I65-N69 PolarHBondContact O-OD1 3.3Å
66	S	97.2	Very high	96.3	Very high	70 Å²	70	99.2 Å²	99.2	49%	0.49	51%	0.514	S	S	.	.	H	α-helix	trans	-60.1	-39.8	177.4	-61.3	0	0	0	0	112.8	V62 I64 K70	V62-S66 PolarHBondContact O-N 3.37Å; V62-S66 PolarHBondContact O-OG 3.13Å; V62-S66 VanDerWaalsContact O-OG 3.13Å; I64-S66 PolarHBondContact O-N 3.47Å; S66-K70 PolarHBondContact O-N 2.65Å; S66-K70 VanDerWaalsContact O-N 3.11Å
67	K	97.3	Very high	96.3	Very high	155 Å²	155	98.2 Å²	98.2	67%	0.674	51%	0.511	S	S	*	.	H	α-helix	trans	-67.2	-41.5	175.5	-74.7	178.6	-179.1	-176.6	0	112	G63 I64 I65 K70 L71	G63-K67 WeakPolarHBondContact O-CG 3.46Å; G63-K67 PolarHBondContact O-N 3.28Å; I64-K67 PolarHBondContact O-N 3.35Å; I65-K67 VanDerWaalsContact C-N 3.31Å; I65-K67 PolarHBondContact O-N 3.22Å; K67-K70 PolarHBondContact O-N 3.11Å; K67-L71 WeakPolarHBondContact O-CG 3.39Å; K67-L71 PolarHBondContact O-N 2.99Å
68	A	97.1	Very high	96.2	Very high	50 Å²	50	95.8 Å²	95.8	41%	0.413	51%	0.507	S	S	.	.	H	α-helix	trans	-61.4	-47.4	177.3	0	0	0	0	0	111.2	I64 I65 K70 L71 E72	I64-A68 PolarHBondContact O-N 3.07Å; I65-A68 PolarHBondContact O-N 3.04Å; A68-K70 VanDerWaalsContact C-N 3.31Å; A68-K70 PolarHBondContact O-N 2.92Å; A68-L71 PolarHBondContact O-N 3.36Å; A68-E72 PolarHBondContact O-N 3.17Å
69	N	96.7	Very high	96.2	Very high	83 Å²	83	96.3 Å²	96.3	44%	0.444	51%	0.507	S	S	.	.	H	α-helix	trans	-61.5	-38.5	177.5	-66.4	2.7	0	0	0	112.1	I65 E72 I73	I65-N69 VanDerWaalsContact O-CG 3.31Å; I65-N69 PolarHBondContact O-N 3.35Å; I65-N69 PolarHBondContact O-OD1 3.3Å; N69-E72 PolarHBondContact O-N 3.37Å; N69-I73 WeakPolarHBondContact O-CG1 3.37Å; N69-I73 PolarHBondContact O-N 3.5Å; N69-I73 VanDerWaalsContact O-N 3.1Å
70	K	97.1	Very high	96.1	Very high	128 Å²	128	95.7 Å²	95.7	56%	0.557	50%	0.501	S	S	*	.	H	α-helix	trans	-62.9	-44.6	175.4	-169.8	178.1	-171.3	-87.3	0	111.7	S66 K67 A68 E72 I73 E74	S66-K70 PolarHBondContact O-N 2.65Å; S66-K70 VanDerWaalsContact O-N 3.11Å; K67-K70 PolarHBondContact O-N 3.11Å; A68-K70 VanDerWaalsContact C-N 3.31Å; A68-K70 PolarHBondContact O-N 2.92Å; K70-E72 VanDerWaalsContact C-N 3.31Å; K70-E72 PolarHBondContact O-N 2.91Å; K70-I73 PolarHBondContact O-N 3.37Å; K70-E74 IonicContact NZ-OE1 2.65Å; K70-E74 PolarHBondContact NZ-OE1 3.18Å; K70-E74 WeakPolarHBondContact O-CG 3.36Å; K70-E74 PolarHBondContact O-N 3.3Å
71	L	97	Very high	95.9	Very high	109 Å²	109	95.1 Å²	95.1	57%	0.571	50%	0.5	S	S	*	.	H	α-helix	trans	-65.4	-35.3	177.5	-72.1	170.5	0	0	0	112.2	K67 A68 L75	K67-L71 WeakPolarHBondContact O-CG 3.39Å; K67-L71 PolarHBondContact O-N 2.99Å; A68-L71 PolarHBondContact O-N 3.36Å; L71-L75 VanDerWaalsContact O-CB 3.31Å; L71-L75 WeakPolarHBondContact O-CB 3.29Å; L71-L75 PolarHBondContact O-N 3.04Å
72	E	97.3	Very high	95.8	Very high	113 Å²	113	93.6 Å²	93.6	53%	0.528	50%	0.495	S	S	.	.	H	α-helix	trans	-62.3	-46.4	174.8	-173.1	169.2	-155.1	0	0	111	A68 N69 K70 L75 E76	A68-E72 PolarHBondContact O-N 3.17Å; N69-E72 PolarHBondContact O-N 3.37Å; K70-E72 VanDerWaalsContact C-N 3.31Å; K70-E72 PolarHBondContact O-N 2.91Å; E72-L75 WeakPolarHBondContact O-CB 3.47Å; E72-L75 PolarHBondContact O-N 2.98Å; E72-E76 WeakPolarHBondContact O-CG 3.41Å; E72-E76 PolarHBondContact O-N 3.1Å
73	I	96.5	Very high	95.6	Very high	92 Å²	92	95 Å²	95	47%	0.472	50%	0.495	S	S	.	.	H	α-helix	trans	-61.6	-48.7	175.2	-65.6	165.6	0	0	0	111.3	N69 K70 L75 E76 E77	N69-I73 WeakPolarHBondContact O-CG1 3.37Å; N69-I73 PolarHBondContact O-N 3.5Å; N69-I73 VanDerWaalsContact O-N 3.1Å; K70-I73 PolarHBondContact O-N 3.37Å; I73-L75 PolarHBondContact O-N 2.75Å; I73-E76 PolarHBondContact O-N 2.94Å; I73-E76 VanDerWaalsContact O-N 3.11Å; I73-E77 HydrophobicContact CG2-CG 4.4Å; I73-E77 WeakPolarHBondContact O-CG 3.46Å; I73-E77 PolarHBondContact O-N 3.39Å
74	E	95.8	Very high	95.2	Very high	76 Å²	76	97.3 Å²	97.3	36%	0.355	50%	0.499	S	S	.	.	H	α-helix	trans	-59.9	-34.9	179.2	-73.7	172.1	-172	0	0	112	K70 S78	K70-E74 IonicContact NZ-OE1 2.65Å; K70-E74 PolarHBondContact NZ-OE1 3.18Å; K70-E74 WeakPolarHBondContact O-CG 3.36Å; K70-E74 PolarHBondContact O-N 3.3Å; E74-S78 WeakPolarHBondContact O-CB 3.36Å; E74-S78 PolarHBondContact O-N 2.98Å; E74-S78 PolarHBondContact O-OG 3.41Å
75	L	96.5	Very high	94.8	Very high	109 Å²	109	99.1 Å²	99.1	57%	0.571	51%	0.505	S	S	*	.	H	α-helix	trans	-69.1	-43.4	175	-179.8	63.7	0	0	0	111.8	L71 E72 I73 S78 L79	L71-L75 VanDerWaalsContact O-CB 3.31Å; L71-L75 WeakPolarHBondContact O-CB 3.29Å; L71-L75 PolarHBondContact O-N 3.04Å; E72-L75 WeakPolarHBondContact O-CB 3.47Å; E72-L75 PolarHBondContact O-N 2.98Å; I73-L75 PolarHBondContact O-N 2.75Å; L75-S78 PolarHBondContact O-N 3.11Å; L75-L79 HydrophobicContact CG-CD1 4.27Å; L75-L79 WeakPolarHBondContact O-CB 3.49Å; L75-L79 VanDerWaalsContact O-CG 3.29Å; L75-L79 WeakPolarHBondContact O-CG 3.31Å; L75-L79 PolarHBondContact O-N 2.93Å
76	E	96	Very high	94.3	Very high	111 Å²	111	102.1 Å²	102.1	52%	0.519	52%	0.519	S	S	.	.	H	α-helix	trans	-61.6	-45.2	175.9	-73.3	-177.6	162.8	0	0	111.9	E72 I73 S78 L79 H80	E72-E76 WeakPolarHBondContact O-CG 3.41Å; E72-E76 PolarHBondContact O-N 3.1Å; I73-E76 PolarHBondContact O-N 2.94Å; I73-E76 VanDerWaalsContact O-N 3.11Å; E76-S78 PolarHBondContact O-N 3.41Å; E76-L79 PolarHBondContact O-N 3.26Å; E76-H80 PolarHBondContact O-CD2 3.26Å; E76-H80 PolarHBondContact O-N 3.33Å
77	E	95.3	Very high	93.5	Very high	118 Å²	118	108.5 Å²	108.5	55%	0.551	53%	0.532	S	S	*	.	H	α-helix	trans	-60.1	-45.7	175.7	-72	177.7	170.1	0	0	111.4	I73 L79 H80 L81	I73-E77 HydrophobicContact CG2-CG 4.4Å; I73-E77 WeakPolarHBondContact O-CG 3.46Å; I73-E77 PolarHBondContact O-N 3.39Å; E77-L79 VanDerWaalsContact C-N 3.33Å; E77-L79 PolarHBondContact O-N 3.49Å; E77-H80 WeakPolarHBondContact O-CB 3.45Å; E77-H80 PolarHBondContact O-N 3.26Å; E77-H80 VanDerWaalsContact O-N 3.15Å; E77-L81 WeakPolarHBondContact O-CG 3.46Å; E77-L81 PolarHBondContact O-N 3.08Å
78	S	94.7	Very high	92.2	Very high	64 Å²	64	112.2 Å²	112.2	45%	0.448	55%	0.552	S	S	.	*	H	α-helix	trans	-61.9	-40.1	177	-59.9	0	0	0	0	112.2	E74 L75 E76 H80 L81 V82	E74-S78 WeakPolarHBondContact O-CB 3.36Å; E74-S78 PolarHBondContact O-N 2.98Å; E74-S78 PolarHBondContact O-OG 3.41Å; L75-S78 PolarHBondContact O-N 3.11Å; E76-S78 PolarHBondContact O-N 3.41Å; S78-H80 VanDerWaalsContact C-N 3.31Å; S78-H80 PolarHBondContact O-N 3.49Å; S78-L81 PolarHBondContact O-N 3.15Å; S78-V82 WeakPolarHBondContact O-CG2 3.45Å; S78-V82 PolarHBondContact O-N 2.96Å; S78-V82 VanDerWaalsContact O-N 3.08Å
79	L	95	Very high	92	Very high	90 Å²	90	115.3 Å²	115.3	47%	0.471	56%	0.559	S	S	.	*	H	α-helix	trans	-67.2	-32.6	176.1	-75.1	171.7	0	0	0	112.4	L75 E76 E77 K83	L75-L79 HydrophobicContact CG-CD1 4.27Å; L75-L79 WeakPolarHBondContact O-CB 3.49Å; L75-L79 VanDerWaalsContact O-CG 3.29Å; L75-L79 WeakPolarHBondContact O-CG 3.31Å; L75-L79 PolarHBondContact O-N 2.93Å; E76-L79 PolarHBondContact O-N 3.26Å; E77-L79 VanDerWaalsContact C-N 3.33Å; E77-L79 PolarHBondContact O-N 3.49Å; L79-K83 WeakPolarHBondContact O-CD 3.25Å; L79-K83 VanDerWaalsContact O-CG 3.25Å; L79-K83 WeakPolarHBondContact O-CG 3.47Å; L79-K83 PolarHBondContact O-N 2.99Å
80	H	92.7	Very high	91.7	Very high	112 Å²	112	117 Å²	117	52%	0.519	57%	0.565	S	S	.	*	H	α-helix	trans	-66.8	-48.2	173.1	-91.7	-74	0	0	0	111.4	E76 E77 S78 V82 K83 D84	E76-H80 PolarHBondContact O-CD2 3.26Å; E76-H80 PolarHBondContact O-N 3.33Å; E77-H80 WeakPolarHBondContact O-CB 3.45Å; E77-H80 PolarHBondContact O-N 3.26Å; E77-H80 VanDerWaalsContact O-N 3.15Å; S78-H80 VanDerWaalsContact C-N 3.31Å; S78-H80 PolarHBondContact O-N 3.49Å; H80-V82 PolarHBondContact O-N 3.1Å; H80-K83 WeakPolarHBondContact O-CB 3.45Å; H80-K83 PolarHBondContact O-N 3.4Å; H80-K83 VanDerWaalsContact O-N 3.1Å; H80-D84 PolarHBondContact O-N 2.98Å
81	L	92	Very high	91.4	Very high	113 Å²	113	116.4 Å²	116.4	59%	0.592	57%	0.565	S	S	*	*	H	α-helix	trans	-57.7	-46.5	178.1	-69.5	171.2	0	0	0	112.4	E77 S78 K83 D84 E85	E77-L81 WeakPolarHBondContact O-CG 3.46Å; E77-L81 PolarHBondContact O-N 3.08Å; S78-L81 PolarHBondContact O-N 3.15Å; L81-K83 VanDerWaalsContact C-N 3.28Å; L81-K83 PolarHBondContact O-N 3.15Å; L81-D84 PolarHBondContact O-N 3.34Å; L81-D84 VanDerWaalsContact O-N 3.15Å; L81-E85 PolarHBondContact O-N 3.03Å
82	V	92.6	Very high	91.1	Very high	65 Å²	65	116.8 Å²	116.8	39%	0.394	57%	0.565	S	S	.	*	H	α-helix	trans	-62	-36.2	177.6	172	0	0	0	0	111.9	S78 H80 D84 M86	S78-V82 WeakPolarHBondContact O-CG2 3.45Å; S78-V82 PolarHBondContact O-N 2.96Å; S78-V82 VanDerWaalsContact O-N 3.08Å; H80-V82 PolarHBondContact O-N 3.1Å; V82-D84 VanDerWaalsContact C-N 3.35Å; V82-M86 HydrophobicContact CG1-CE 3.87Å; V82-M86 HydrophobicContact CG1-SD 4.41Å; V82-M86 WeakPolarHBondContact O-CG 3.46Å; V82-M86 PolarHBondContact O-N 3.11Å; V82-M86 VanDerWaalsContact O-N 3.11Å
83	K	91.6	Very high	90.7	Very high	109 Å²	109	117.1 Å²	117.1	47%	0.474	57%	0.567	S	S	.	*	H	α-helix	trans	-69.3	-34.4	176.9	-76.1	169.9	-175.6	170.4	0	112.3	L79 H80 L81 R87	L79-K83 WeakPolarHBondContact O-CD 3.25Å; L79-K83 VanDerWaalsContact O-CG 3.25Å; L79-K83 WeakPolarHBondContact O-CG 3.47Å; L79-K83 PolarHBondContact O-N 2.99Å; H80-K83 WeakPolarHBondContact O-CB 3.45Å; H80-K83 PolarHBondContact O-N 3.4Å; H80-K83 VanDerWaalsContact O-N 3.1Å; L81-K83 VanDerWaalsContact C-N 3.28Å; L81-K83 PolarHBondContact O-N 3.15Å; K83-R87 WeakPolarHBondContact O-CG 3.32Å; K83-R87 PolarHBondContact O-N 3.29Å
84	D	88.6	Confident	90.3	Very high	83 Å²	83	118.7 Å²	118.7	44%	0.444	57%	0.574	S	S	.	*	H	α-helix	trans	-71.4	-43	177.6	-67.8	-21.1	0	0	0	110.3	H80 L81 V82 M86 R87 E88	H80-D84 PolarHBondContact O-N 2.98Å; L81-D84 PolarHBondContact O-N 3.34Å; L81-D84 VanDerWaalsContact O-N 3.15Å; V82-D84 VanDerWaalsContact C-N 3.35Å; D84-M86 VanDerWaalsContact C-N 3.26Å; D84-M86 PolarHBondContact O-N 3.36Å; D84-R87 PolarHBondContact O-N 3.38Å; D84-E88 PolarHBondContact O-N 3.05Å
85	E	88.5	Confident	89.9	Confident	143 Å²	143	121.8 Å²	121.8	67%	0.668	59%	0.589	S	S	*	*	H	α-helix	trans	-59.8	-32.4	172.4	-72.5	-179.1	174.8	0	0	113.4	L81 R87	L81-E85 PolarHBondContact O-N 3.03Å; E85-R87 VanDerWaalsContact C-N 3.33Å
86	M	85.6	Confident	89.4	Confident	151 Å²	151	122.8 Å²	122.8	74%	0.744	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.3	-12.2	176.7	-74.3	-174.8	-179.2	0	0	114.1	V82 D84	V82-M86 HydrophobicContact CG1-CE 3.87Å; V82-M86 HydrophobicContact CG1-SD 4.41Å; V82-M86 WeakPolarHBondContact O-CG 3.46Å; V82-M86 PolarHBondContact O-N 3.11Å; V82-M86 VanDerWaalsContact O-N 3.11Å; D84-M86 VanDerWaalsContact C-N 3.26Å; D84-M86 PolarHBondContact O-N 3.36Å
87	R	80.4	Confident	88.9	Confident	205 Å²	205	123.8 Å²	123.8	77%	0.774	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.3	-22.8	177.9	-78.8	-177.8	-165.2	175.8	6.7	113.3	K83 D84 E85	K83-R87 WeakPolarHBondContact O-CG 3.32Å; K83-R87 PolarHBondContact O-N 3.29Å; D84-R87 PolarHBondContact O-N 3.38Å; E85-R87 VanDerWaalsContact C-N 3.33Å
88	E	69.5	Low	88.3	Confident	232 Å²	232	124.3 Å²	124.3	100%	1.084	60%	0.601	S	S	*	*			trans	-74.6	0	171.1	-68	-172	170.7	0	0	111.6	D84	D84-E88 PolarHBondContact O-N 3.05Å

Retrieved 88 of 88 residues in 227.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).