A0A044U5D6_ONCVO Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A044U5D6, Species ONCVO (Onchocerca volvulus), Gene n/a, Length 120 aa.

						>A0A044U5D6_ONCVO|A0A044U5D6
MISDDEAPNAELACRLAHACYILSNFRLSKENERYRLLEEAYQLCKMTYKPESKNAELLKWSAIIIGILAELESLNHTERVVYMKEFKEFLDKALACTPDASVYHMNGRFCYRVRHSFLH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.5	Very low	53.9	Low	247 Å²	247	119.9 Å²	119.9	100%	1.217	66%	0.663	S	S	*	*				0	100.6	0	-70	170	113.8	0	0	105.5
2	I	37.8	Very low	56.8	Low	159 Å²	159	118.6 Å²	118.6	82%	0.815	65%	0.653	S	S	*	*			cis	-99.5	151	8.6	-70.6	151.5	0	0	0	108.3	D4	I2-D4 PolarHBondContact O-N 3.23Å
3	S	36.9	Very low	59.4	Low	94 Å²	94	109.5 Å²	109.5	66%	0.657	60%	0.603	S	S	*	*			trans	-75.8	110.8	-179	44.3	0	0	0	0	111	D5	S3-D5 PolarHBondContact O-N 3.11Å
4	D	45.7	Very low	61.7	Low	155 Å²	155	102.1 Å²	102.1	83%	0.829	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.7	12.8	175.9	-79.6	-33.9	0	0	0	114.9	I2	I2-D4 PolarHBondContact O-N 3.23Å
5	D	47	Very low	63.8	Low	140 Å²	140	105.7 Å²	105.7	75%	0.749	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.4	4.4	-171.6	-138.3	12.9	0	0	0	114.2	S3 P8	S3-D5 PolarHBondContact O-N 3.11Å; D5-P8 WeakPolarHBondContact O-CD 3.49Å
6	E	47.8	Very low	65.6	Low	140 Å²	140	103.6 Å²	103.6	65%	0.654	55%	0.553	S	S	*	*	S	Bend	trans	-103.9	-11.9	174.7	-78.4	-153.4	136.6	0	0	114.7	K50	E6-K50 IonicContact OE1-NZ 3.62Å; E6-K50 PolarHBondContact OE1-NZ 2.49Å; E6-K50 IonicContact OE2-NZ 3.88Å; E6-K50 PolarHBondContact OE2-NZ 2.77Å
7	A	43.8	Very low	67.3	Low	83 Å²	83	97.6 Å²	97.6	69%	0.686	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.9	-1.9	175.1	0	0	0	0	0	117.5	N9	A7-N9 PolarHBondContact O-N 3.29Å
8	P	51	Low	68.9	Low	71 Å²	71	96.5 Å²	96.5	46%	0.461	51%	0.512	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.7	-19.4	177.9	-22.6	33	0	0	0	116.5	D5 L12	D5-P8 WeakPolarHBondContact O-CD 3.49Å; P8-L12 VanDerWaalsContact O-CD1 3.29Å; P8-L12 WeakPolarHBondContact O-CD1 3.42Å; P8-L12 WeakPolarHBondContact O-CG 3.45Å
9	N	74	Confident	70.3	Confident	93 Å²	93	93.5 Å²	93.5	50%	0.497	50%	0.502	S	S	.	.	H	α-helix	trans	-99.1	-30.3	-161.9	-132	-5.2	0	0	0	115.3	A7 A13 T48	A7-N9 PolarHBondContact O-N 3.29Å; N9-A13 WeakPolarHBondContact O-CB 3.35Å; N9-A13 PolarHBondContact O-N 2.9Å; N9-T48 HydrophobicContact CB-CG2 4.31Å
10	A	84.1	Confident	71.5	Confident	24 Å²	24	89 Å²	89	20%	0.198	48%	0.478	C	S	.	.	H	α-helix	trans	-71.7	-43.5	-172.9	0	0	0	0	0	113.6	A13 C14 T48 N55	A10-A13 PolarHBondContact O-N 2.9Å; A10-C14 PolarHBondContact O-N 3.46Å; A10-C14 PolarHBondContact O-SG 3.11Å; A10-T48 VanDerWaalsContact CA-CG2 3.47Å; A10-T48 HydrophobicContact CB-CG2 3.91Å; A10-N55 WeakPolarHBondContact CB-ND2 3.41Å
11	E	86.8	Confident	72.6	Confident	113 Å²	113	88.3 Å²	88.3	53%	0.528	47%	0.47	S	S	.	.	H	α-helix	trans	-68.4	-41.9	177.2	-172.7	176.2	-179.7	0	0	111.4	A13 C14 R15	E11-A13 VanDerWaalsContact C-N 3.34Å; E11-A13 PolarHBondContact O-N 2.98Å; E11-C14 PolarHBondContact O-N 2.99Å; E11-R15 WeakPolarHBondContact O-CG 3.08Å; E11-R15 PolarHBondContact O-N 3.37Å; E11-R15 IonicContact OE1-CZ 3.27Å; E11-R15 VanDerWaalsContact OE1-CZ 3.27Å; E11-R15 IonicContact OE1-NE 3.36Å; E11-R15 PolarHBondContact OE1-NE 3.1Å; E11-R15 IonicContact OE1-NH2 2.64Å; E11-R15 PolarHBondContact OE1-NH2 3.27Å
12	L	88.9	Confident	75.3	Confident	104 Å²	104	80 Å²	80	55%	0.545	43%	0.429	S	S	.	.	H	α-helix	trans	-61.3	-43.1	174.3	-72.9	179.2	0	0	0	111.5	P8 C14 R15 L16	P8-L12 VanDerWaalsContact O-CD1 3.29Å; P8-L12 WeakPolarHBondContact O-CD1 3.42Å; P8-L12 WeakPolarHBondContact O-CG 3.45Å; L12-C14 PolarHBondContact O-N 3.13Å; L12-R15 PolarHBondContact O-N 3.22Å; L12-L16 PolarHBondContact O-N 3.05Å
13	A	90.3	Very high	78	Confident	1 Å²	1	76.4 Å²	76.4	1%	0.008	41%	0.411	C	S	.	.	H	α-helix	trans	-59.9	-44.1	174.7	0	0	0	0	0	112.1	N9 A10 E11 R15 L16 A17 L44 T48 L58	N9-A13 WeakPolarHBondContact O-CB 3.35Å; N9-A13 PolarHBondContact O-N 2.9Å; A10-A13 PolarHBondContact O-N 2.9Å; E11-A13 VanDerWaalsContact C-N 3.34Å; E11-A13 PolarHBondContact O-N 2.98Å; A13-R15 PolarHBondContact O-N 2.84Å; A13-L16 PolarHBondContact O-N 2.84Å; A13-A17 VanDerWaalsContact O-CB 3.29Å; A13-A17 WeakPolarHBondContact O-CB 3.48Å; A13-A17 PolarHBondContact O-N 3.45Å; A13-L44 HydrophobicContact CB-CD1 4.38Å; A13-L44 HydrophobicContact CB-CD2 4.06Å; A13-L44 HydrophobicContact CB-CG 3.83Å; A13-T48 HydrophobicContact CB-CG2 3.98Å; A13-T48 WeakPolarHBondContact CB-OG1 3.48Å; A13-L58 HydrophobicContact CB-CD1 4.32Å
14	C	92.5	Very high	80.7	Confident	5 Å²	5	72 Å²	72	3%	0.034	38%	0.38	C	S	.	.	H	α-helix	trans	-61.5	-44.7	176.1	-66.9	0	0	0	0	111.6	A10 E11 L12 A17 H18 E57 L58	A10-C14 PolarHBondContact O-N 3.46Å; A10-C14 PolarHBondContact O-SG 3.11Å; E11-C14 PolarHBondContact O-N 2.99Å; L12-C14 PolarHBondContact O-N 3.13Å; C14-A17 PolarHBondContact O-N 3.44Å; C14-H18 WeakPolarHBondContact O-CB 3.45Å; C14-H18 PolarHBondContact O-N 3.41Å; C14-E57 HydrophobicContact CB-CG 4.08Å; C14-L58 WeakPolarHBondContact SG-CA 3.48Å; C14-L58 PolarHBondContact SG-N 3.33Å; C14-L58 VanDerWaalsContact SG-N 3.42Å
15	R	92.9	Very high	82.8	Confident	157 Å²	157	67.5 Å²	67.5	59%	0.592	36%	0.356	S	S	*	.	H	α-helix	trans	-65.1	-40.1	178.7	-71	175.8	-178.1	-167.2	1.6	111.8	E11 L12 A13 H18 A19	E11-R15 WeakPolarHBondContact O-CG 3.08Å; E11-R15 PolarHBondContact O-N 3.37Å; E11-R15 IonicContact OE1-CZ 3.27Å; E11-R15 VanDerWaalsContact OE1-CZ 3.27Å; E11-R15 IonicContact OE1-NE 3.36Å; E11-R15 PolarHBondContact OE1-NE 3.1Å; E11-R15 IonicContact OE1-NH2 2.64Å; E11-R15 PolarHBondContact OE1-NH2 3.27Å; L12-R15 PolarHBondContact O-N 3.22Å; A13-R15 PolarHBondContact O-N 2.84Å; R15-H18 PolarHBondContact O-N 3.33Å; R15-A19 PolarHBondContact O-N 2.72Å
16	L	93.2	Very high	84.9	Confident	72 Å²	72	67.8 Å²	67.8	38%	0.377	35%	0.351	S	S	.	.	H	α-helix	trans	-69.1	-43.4	176.3	-169.9	66.9	0	0	0	111.5	L12 A13 H18 A19 C20 L44	L12-L16 PolarHBondContact O-N 3.05Å; A13-L16 PolarHBondContact O-N 2.84Å; L16-H18 VanDerWaalsContact C-N 3.27Å; L16-H18 PolarHBondContact O-N 3.5Å; L16-A19 WeakPolarHBondContact O-CB 3.37Å; L16-A19 PolarHBondContact O-N 3.4Å; L16-C20 PolarHBondContact O-N 3.2Å; L16-C20 PolarHBondContact O-SG 3.22Å; L16-L44 HydrophobicContact CB-CD2 3.89Å; L16-L44 HydrophobicContact CD2-CD2 3.33Å; L16-L44 HydrophobicContact CG-CD2 4.13Å
17	A	94.5	Very high	86.8	Confident	1 Å²	1	66.1 Å²	66.1	1%	0.008	34%	0.339	C	S	.	.	H	α-helix	trans	-57.1	-43.8	174.8	0	0	0	0	0	111.1	A13 C14 A19 C20 Y21 A41 W61 I65	A13-A17 VanDerWaalsContact O-CB 3.29Å; A13-A17 WeakPolarHBondContact O-CB 3.48Å; A13-A17 PolarHBondContact O-N 3.45Å; C14-A17 PolarHBondContact O-N 3.44Å; A17-A19 PolarHBondContact O-N 2.96Å; A17-C20 PolarHBondContact O-N 2.94Å; A17-Y21 WeakPolarHBondContact O-CB 2.97Å; A17-Y21 PolarHBondContact O-N 3.36Å; A17-A41 HydrophobicContact CB-CB 4.29Å; A17-W61 HydrophobicContact CB-CB 4.08Å; A17-I65 HydrophobicContact CB-CG1 4.18Å
18	H	94.7	Very high	88.5	Confident	78 Å²	78	67.4 Å²	67.4	36%	0.361	33%	0.333	S	S	.	.	H	α-helix	trans	-60.7	-44.2	173.8	-172.8	-169.8	0	0	0	112.3	C14 R15 L16 Y21 I22 W61	C14-H18 WeakPolarHBondContact O-CB 3.45Å; C14-H18 PolarHBondContact O-N 3.41Å; R15-H18 PolarHBondContact O-N 3.33Å; L16-H18 VanDerWaalsContact C-N 3.27Å; L16-H18 PolarHBondContact O-N 3.5Å; H18-Y21 WeakPolarHBondContact O-CB 3.4Å; H18-Y21 PolarHBondContact O-N 3.36Å; H18-I22 WeakPolarHBondContact NE2-CD1 3.3Å; H18-I22 WeakPolarHBondContact O-CG1 3.28Å; H18-I22 PolarHBondContact O-N 3.17Å; H18-W61 HydrophobicContact CB-CD2 4.22Å; H18-W61 HydrophobicContact CB-CE3 4.23Å; H18-W61 HydrophobicContact CB-CH2 3.74Å; H18-W61 HydrophobicContact CB-CZ2 3.67Å; H18-W61 HydrophobicContact CB-CZ3 4.01Å; H18-W61 AromaticContact CD2-CH2 3.04Å; H18-W61 WeakPolarHBondContact CD2-CH2 3.19Å; H18-W61 AromaticContact CD2-CZ2 3.62Å; H18-W61 AromaticContact CD2-CZ3 3.68Å; H18-W61 AromaticContact CG-CH2 3.34Å; H18-W61 AromaticContact CG-CZ2 3.42Å; H18-W61 VanDerWaalsContact CG-CZ2 3.42Å; H18-W61 AromaticContact ND1-CH2 3.97Å; H18-W61 AromaticContact ND1-CZ2 3.72Å; H18-W61 AromaticContact NE2-CH2 3.55Å
19	A	95.4	Very high	90.1	Very high	39 Å²	39	69.7 Å²	69.7	32%	0.322	35%	0.351	S	S	.	.	H	α-helix	trans	-62.6	-45.4	177	0	0	0	0	0	112.2	R15 L16 A17 Y21 I22 L23	R15-A19 PolarHBondContact O-N 2.72Å; L16-A19 WeakPolarHBondContact O-CB 3.37Å; L16-A19 PolarHBondContact O-N 3.4Å; A17-A19 PolarHBondContact O-N 2.96Å; A19-Y21 VanDerWaalsContact C-N 3.32Å; A19-Y21 PolarHBondContact O-N 2.95Å; A19-I22 PolarHBondContact O-N 3.16Å; A19-L23 WeakPolarHBondContact O-CB 3.49Å; A19-L23 VanDerWaalsContact O-CG 3.31Å; A19-L23 WeakPolarHBondContact O-CG 3.49Å; A19-L23 PolarHBondContact O-N 3.04Å
20	C	94.4	Very high	90.9	Very high	4 Å²	4	70 Å²	70	3%	0.027	35%	0.348	C	S	.	.	H	α-helix	trans	-61.3	-41.1	175.4	-71.4	0	0	0	0	111.7	L16 A17 L23 S24 L37 A41	L16-C20 PolarHBondContact O-N 3.2Å; L16-C20 PolarHBondContact O-SG 3.22Å; A17-C20 PolarHBondContact O-N 2.94Å; C20-L23 PolarHBondContact O-N 2.94Å; C20-S24 VanDerWaalsContact O-CB 3.29Å; C20-S24 WeakPolarHBondContact O-CB 3.41Å; C20-S24 PolarHBondContact O-N 3.2Å; C20-L37 WeakPolarHBondContact CB-O 3.15Å; C20-A41 HydrophobicContact CB-CB 3.68Å
21	Y	94.5	Very high	91.1	Very high	75 Å²	75	71.2 Å²	71.2	29%	0.294	35%	0.35	S	S	.	.	H	α-helix	trans	-57.4	-52.9	173.6	168.4	-117.2	0	0	0	111.3	A17 H18 A19 L23 S24 N25 W61 I64 I68	A17-Y21 WeakPolarHBondContact O-CB 2.97Å; A17-Y21 PolarHBondContact O-N 3.36Å; H18-Y21 WeakPolarHBondContact O-CB 3.4Å; H18-Y21 PolarHBondContact O-N 3.36Å; A19-Y21 VanDerWaalsContact C-N 3.32Å; A19-Y21 PolarHBondContact O-N 2.95Å; Y21-L23 PolarHBondContact O-N 3.1Å; Y21-S24 PolarHBondContact O-N 3.45Å; Y21-S24 PolarHBondContact O-OG 3.13Å; Y21-N25 WeakPolarHBondContact CE2-ND2 3.41Å; Y21-N25 PolarHBondContact O-N 3.42Å; Y21-N25 PolarHBondContact O-ND2 3.45Å; Y21-W61 HydrophobicContact CD1-CH2 4.42Å; Y21-W61 AromaticContact CD1-CZ3 3.94Å; Y21-W61 HydrophobicContact CD1-CZ3 3.94Å; Y21-W61 HydrophobicContact CG-CZ3 4.31Å; Y21-I64 HydrophobicContact CD2-CG2 4.14Å; Y21-I64 HydrophobicContact CE2-CG2 4.31Å; Y21-I64 HydrophobicContact CG-CG2 4.34Å; Y21-I68 HydrophobicContact CD2-CD1 3.14Å; Y21-I68 HydrophobicContact CE2-CD1 3.16Å; Y21-I68 HydrophobicContact CE2-CG1 4.43Å; Y21-I68 HydrophobicContact CG-CD1 4.36Å
22	I	95.1	Very high	91.3	Very high	71 Å²	71	71.5 Å²	71.5	36%	0.364	36%	0.355	S	S	.	.	H	α-helix	trans	-57.4	-49.8	178.3	-69.6	170.1	0	0	0	110.5	H18 A19 S24 N25 F26	H18-I22 WeakPolarHBondContact NE2-CD1 3.3Å; H18-I22 WeakPolarHBondContact O-CG1 3.28Å; H18-I22 PolarHBondContact O-N 3.17Å; A19-I22 PolarHBondContact O-N 3.16Å; I22-S24 VanDerWaalsContact C-N 3.32Å; I22-S24 PolarHBondContact O-N 3.38Å; I22-N25 WeakPolarHBondContact O-CB 3.28Å; I22-N25 PolarHBondContact O-N 3.38Å; I22-N25 VanDerWaalsContact O-N 3.15Å; I22-F26 HydrophobicContact CG2-CD2 4.06Å; I22-F26 HydrophobicContact CG2-CE2 3.57Å; I22-F26 WeakPolarHBondContact O-CD2 3.44Å; I22-F26 PolarHBondContact O-N 3.47Å
23	L	94.2	Very high	91.4	Very high	85 Å²	85	70.2 Å²	70.2	45%	0.445	35%	0.346	S	S	.	.	H	α-helix	trans	-62	-38.5	-179.8	-71.9	172.5	0	0	0	112.2	A19 C20 Y21 N25 F26 R27 L37	A19-L23 WeakPolarHBondContact O-CB 3.49Å; A19-L23 VanDerWaalsContact O-CG 3.31Å; A19-L23 WeakPolarHBondContact O-CG 3.49Å; A19-L23 PolarHBondContact O-N 3.04Å; C20-L23 PolarHBondContact O-N 2.94Å; Y21-L23 PolarHBondContact O-N 3.1Å; L23-N25 PolarHBondContact O-N 2.9Å; L23-F26 PolarHBondContact O-N 2.99Å; L23-R27 WeakPolarHBondContact O-CG 3.36Å; L23-R27 PolarHBondContact O-N 3.04Å; L23-L37 HydrophobicContact CB-CD1 4Å
24	S	93	Very high	91.6	Very high	0 Å²	0	72 Å²	72	0%	0	35%	0.353	C	S	.	.	H	α-helix	trans	-61.6	-34.3	177.3	81	0	0	0	0	112.1	C20 Y21 I22 F26 R27 R34	C20-S24 VanDerWaalsContact O-CB 3.29Å; C20-S24 WeakPolarHBondContact O-CB 3.41Å; C20-S24 PolarHBondContact O-N 3.2Å; Y21-S24 PolarHBondContact O-N 3.45Å; Y21-S24 PolarHBondContact O-OG 3.13Å; I22-S24 VanDerWaalsContact C-N 3.32Å; I22-S24 PolarHBondContact O-N 3.38Å; S24-F26 VanDerWaalsContact C-N 3.27Å; S24-F26 PolarHBondContact O-N 3.22Å; S24-R27 PolarHBondContact O-N 2.97Å; S24-R27 VanDerWaalsContact O-N 3.14Å; S24-R34 WeakPolarHBondContact O-CD 3.44Å; S24-R34 WeakPolarHBondContact O-CG 3.44Å; S24-R34 PolarHBondContact O-NE 2.93Å
25	N	91.1	Very high	91.7	Very high	62 Å²	62	75.2 Å²	75.2	33%	0.332	37%	0.365	S	S	.	.	H	α-helix	trans	-70.6	-22.1	176.6	-70.7	-34.4	0	0	0	112.8	Y21 I22 L23 R27 L28	Y21-N25 WeakPolarHBondContact CE2-ND2 3.41Å; Y21-N25 PolarHBondContact O-N 3.42Å; Y21-N25 PolarHBondContact O-ND2 3.45Å; I22-N25 WeakPolarHBondContact O-CB 3.28Å; I22-N25 PolarHBondContact O-N 3.38Å; I22-N25 VanDerWaalsContact O-N 3.15Å; L23-N25 PolarHBondContact O-N 2.9Å; N25-R27 VanDerWaalsContact C-N 3.3Å; N25-L28 WeakPolarHBondContact O-CG 3.43Å
26	F	91.3	Very high	91.7	Very high	146 Å²	146	76.5 Å²	76.5	64%	0.64	37%	0.37	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.9	3	172.6	-68.6	-70.7	0	0	0	113.7	I22 L23 S24	I22-F26 HydrophobicContact CG2-CD2 4.06Å; I22-F26 HydrophobicContact CG2-CE2 3.57Å; I22-F26 WeakPolarHBondContact O-CD2 3.44Å; I22-F26 PolarHBondContact O-N 3.47Å; L23-F26 PolarHBondContact O-N 2.99Å; S24-F26 VanDerWaalsContact C-N 3.27Å; S24-F26 PolarHBondContact O-N 3.22Å
27	R	86.5	Confident	91.8	Very high	104 Å²	104	75 Å²	75	39%	0.392	36%	0.361	S	S	.	.	T	Hydrogen-bonded Turn	trans	-123.5	26.2	-175.3	-64.7	-65.6	-175.8	-101.5	-1.5	112.8	L23 S24 N25 S29 K30 E33 R34	L23-R27 WeakPolarHBondContact O-CG 3.36Å; L23-R27 PolarHBondContact O-N 3.04Å; S24-R27 PolarHBondContact O-N 2.97Å; S24-R27 VanDerWaalsContact O-N 3.14Å; N25-R27 VanDerWaalsContact C-N 3.3Å; R27-S29 PolarHBondContact O-N 3.03Å; R27-S29 VanDerWaalsContact O-N 3.09Å; R27-K30 CarbonylContact O-C 3.51Å; R27-K30 WeakPolarHBondContact O-CA 3.46Å; R27-K30 PolarHBondContact O-N 3.44Å; R27-E33 WeakPolarHBondContact CD-OE2 3.43Å; R27-E33 IonicContact NE-OE2 3.05Å; R27-E33 PolarHBondContact NE-OE2 2.75Å; R27-R34 HydrophobicContact CB-CG 3.72Å; R27-R34 WeakPolarHBondContact O-CD 3.28Å; R27-R34 VanDerWaalsContact O-CG 3.26Å; R27-R34 WeakPolarHBondContact O-CG 3.48Å
28	L	80.9	Confident	91.8	Very high	110 Å²	110	74.9 Å²	74.9	58%	0.576	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	-49.7	-39.4	-175.1	-64.4	178.7	0	0	0	114.2	N25 K30	N25-L28 WeakPolarHBondContact O-CG 3.43Å; L28-K30 VanDerWaalsContact C-N 3.29Å; L28-K30 PolarHBondContact O-N 3.38Å
29	S	84.3	Confident	91.8	Very high	120 Å²	120	72.9 Å²	72.9	84%	0.839	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.7	-5.1	179.1	55.1	0	0	0	0	114.9	R27	R27-S29 PolarHBondContact O-N 3.03Å; R27-S29 VanDerWaalsContact O-N 3.09Å
30	K	89.8	Confident	91.7	Very high	98 Å²	98	76.3 Å²	76.3	43%	0.426	36%	0.361	S	S	.	.			trans	-122.8	73.1	-175.4	-63	-166.4	179.2	-175.5	0	110.6	R27 L28 N32 E33 R34	R27-K30 CarbonylContact O-C 3.51Å; R27-K30 WeakPolarHBondContact O-CA 3.46Å; R27-K30 PolarHBondContact O-N 3.44Å; L28-K30 VanDerWaalsContact C-N 3.29Å; L28-K30 PolarHBondContact O-N 3.38Å; K30-N32 VanDerWaalsContact C-N 3.32Å; K30-N32 PolarHBondContact O-N 3.06Å; K30-E33 HydrophobicContact CB-CB 4.1Å; K30-E33 HydrophobicContact CB-CG 4.23Å; K30-E33 HydrophobicContact CD-CG 4.25Å; K30-E33 WeakPolarHBondContact CD-OE1 3.43Å; K30-E33 VanDerWaalsContact CD-OE2 3.27Å; K30-E33 WeakPolarHBondContact CD-OE2 3.29Å; K30-E33 IonicContact NZ-OE1 2.77Å; K30-E33 PolarHBondContact NZ-OE1 2.57Å; K30-E33 IonicContact NZ-OE2 2.91Å; K30-E33 PolarHBondContact NZ-OE2 3.26Å; K30-E33 PolarHBondContact O-N 2.78Å; K30-R34 PolarHBondContact O-N 2.85Å
31	E	88.9	Confident	91.7	Very high	50 Å²	50	76.1 Å²	76.1	23%	0.234	36%	0.36	C	S	.	.	H	α-helix	trans	-58.5	-40.8	-171.3	-165.4	167.2	127.5	0	0	113.7	E33 R34 Y35 L72 E73 S74	E31-E33 VanDerWaalsContact C-N 3.3Å; E31-E33 PolarHBondContact O-N 3.31Å; E31-R34 WeakPolarHBondContact O-CB 3.47Å; E31-R34 PolarHBondContact O-N 3.27Å; E31-R34 VanDerWaalsContact O-N 3.11Å; E31-Y35 PolarHBondContact O-N 3.41Å; E31-L72 HydrophobicContact CG-CD2 4.22Å; E31-E73 PolarHBondContact OE1-N 3.49Å; E31-S74 WeakPolarHBondContact OE1-CA 3.37Å; E31-S74 WeakPolarHBondContact OE1-CB 3.26Å; E31-S74 PolarHBondContact OE1-N 3.06Å; E31-S74 PolarHBondContact OE1-OG 3.44Å
32	N	90.9	Very high	91.8	Very high	120 Å²	120	73.2 Å²	73.2	64%	0.642	35%	0.348	S	S	*	.	H	α-helix	trans	-61.5	-35.8	176.4	-71.2	-24.3	0	0	0	113.1	K30 R36	K30-N32 VanDerWaalsContact C-N 3.32Å; K30-N32 PolarHBondContact O-N 3.06Å; N32-R36 WeakPolarHBondContact O-CG 3.05Å; N32-R36 PolarHBondContact O-N 3.42Å
33	E	92.2	Very high	91.7	Very high	76 Å²	76	73.7 Å²	73.7	36%	0.355	35%	0.349	S	S	.	.	H	α-helix	trans	-70.8	-39.4	175.1	-68.7	-177.4	-161.4	0	0	110.5	R27 K30 E31 R36 L37	R27-E33 WeakPolarHBondContact CD-OE2 3.43Å; R27-E33 IonicContact NE-OE2 3.05Å; R27-E33 PolarHBondContact NE-OE2 2.75Å; K30-E33 HydrophobicContact CB-CB 4.1Å; K30-E33 HydrophobicContact CB-CG 4.23Å; K30-E33 HydrophobicContact CD-CG 4.25Å; K30-E33 WeakPolarHBondContact CD-OE1 3.43Å; K30-E33 VanDerWaalsContact CD-OE2 3.27Å; K30-E33 WeakPolarHBondContact CD-OE2 3.29Å; K30-E33 IonicContact NZ-OE1 2.77Å; K30-E33 PolarHBondContact NZ-OE1 2.57Å; K30-E33 IonicContact NZ-OE2 2.91Å; K30-E33 PolarHBondContact NZ-OE2 3.26Å; K30-E33 PolarHBondContact O-N 2.78Å; E31-E33 VanDerWaalsContact C-N 3.3Å; E31-E33 PolarHBondContact O-N 3.31Å; E33-R36 PolarHBondContact O-N 2.92Å; E33-L37 WeakPolarHBondContact O-CG 2.92Å; E33-L37 PolarHBondContact O-N 2.94Å; E33-L37 VanDerWaalsContact O-N 3.12Å
34	R	93.6	Very high	91.5	Very high	39 Å²	39	71.6 Å²	71.6	15%	0.147	34%	0.338	C	S	.	.	H	α-helix	trans	-61.3	-47.8	174.9	-69.9	179.8	70.6	-162.7	1.5	111.9	S24 R27 K30 E31 R36 L37 L38 L72	S24-R34 WeakPolarHBondContact O-CD 3.44Å; S24-R34 WeakPolarHBondContact O-CG 3.44Å; S24-R34 PolarHBondContact O-NE 2.93Å; R27-R34 HydrophobicContact CB-CG 3.72Å; R27-R34 WeakPolarHBondContact O-CD 3.28Å; R27-R34 VanDerWaalsContact O-CG 3.26Å; R27-R34 WeakPolarHBondContact O-CG 3.48Å; K30-R34 PolarHBondContact O-N 2.85Å; E31-R34 WeakPolarHBondContact O-CB 3.47Å; E31-R34 PolarHBondContact O-N 3.27Å; E31-R34 VanDerWaalsContact O-N 3.11Å; R34-R36 VanDerWaalsContact C-N 3.33Å; R34-R36 PolarHBondContact O-N 2.94Å; R34-L37 PolarHBondContact O-N 2.99Å; R34-L38 WeakPolarHBondContact O-CB 3.23Å; R34-L38 VanDerWaalsContact O-CG 3.28Å; R34-L38 WeakPolarHBondContact O-CG 3.24Å; R34-L38 PolarHBondContact O-N 3.37Å; R34-L72 HydrophobicContact CB-CD2 4.44Å
35	Y	93.7	Very high	91.5	Very high	73 Å²	73	71.7 Å²	71.7	29%	0.286	34%	0.339	S	S	.	.	H	α-helix	trans	-55.3	-49.8	177.9	176.7	-96.8	0	0	0	110.7	E31 L37 L38 E39 L69 L72	E31-Y35 PolarHBondContact O-N 3.41Å; Y35-L37 PolarHBondContact O-N 3.24Å; Y35-L38 PolarHBondContact O-N 3.48Å; Y35-E39 HydrophobicContact CE1-CB 4.31Å; Y35-E39 HydrophobicContact CE1-CG 4.4Å; Y35-E39 WeakPolarHBondContact O-CB 3.4Å; Y35-E39 PolarHBondContact O-N 2.62Å; Y35-L69 HydrophobicContact CD2-CD2 4.1Å; Y35-L69 HydrophobicContact CE2-CD2 4.3Å; Y35-L72 HydrophobicContact CD2-CD1 3.76Å; Y35-L72 HydrophobicContact CG-CD1 4.37Å
36	R	94	Very high	91.4	Very high	184 Å²	184	72.7 Å²	72.7	69%	0.694	34%	0.34	S	S	*	.	H	α-helix	trans	-59.6	-45.7	-179.8	-71.7	175.5	-174.5	-172.7	1.4	113	N32 E33 R34 E40	N32-R36 WeakPolarHBondContact O-CG 3.05Å; N32-R36 PolarHBondContact O-N 3.42Å; E33-R36 PolarHBondContact O-N 2.92Å; R34-R36 VanDerWaalsContact C-N 3.33Å; R34-R36 PolarHBondContact O-N 2.94Å; R36-E40 WeakPolarHBondContact O-CB 3.39Å; R36-E40 PolarHBondContact O-N 3.31Å
37	L	94.5	Very high	91.3	Very high	39 Å²	39	73.3 Å²	73.3	20%	0.204	35%	0.347	C	S	.	.	H	α-helix	trans	-63.5	-42.8	179.2	-73	168.5	0	0	0	112.2	C20 L23 E33 R34 Y35 A41	C20-L37 WeakPolarHBondContact CB-O 3.15Å; L23-L37 HydrophobicContact CB-CD1 4Å; E33-L37 WeakPolarHBondContact O-CG 2.92Å; E33-L37 PolarHBondContact O-N 2.94Å; E33-L37 VanDerWaalsContact O-N 3.12Å; R34-L37 PolarHBondContact O-N 2.99Å; Y35-L37 PolarHBondContact O-N 3.24Å; L37-A41 PolarHBondContact O-N 2.7Å
38	L	95.1	Very high	91.4	Very high	0 Å²	0	69.2 Å²	69.2	0%	0	33%	0.333	C	S	.	.	H	α-helix	trans	-72.8	-38.8	-179.3	-68.6	168.1	0	0	0	111.5	R34 Y35 A41 Y42 I65 I68 L69 L72	R34-L38 WeakPolarHBondContact O-CB 3.23Å; R34-L38 VanDerWaalsContact O-CG 3.28Å; R34-L38 WeakPolarHBondContact O-CG 3.24Å; R34-L38 PolarHBondContact O-N 3.37Å; Y35-L38 PolarHBondContact O-N 3.48Å; L38-A41 PolarHBondContact O-N 3.15Å; L38-Y42 WeakPolarHBondContact O-CB 3.49Å; L38-Y42 PolarHBondContact O-N 3.23Å; L38-I65 HydrophobicContact CD2-CD1 3.87Å; L38-I65 HydrophobicContact CD2-CG2 4.45Å; L38-I65 VanDerWaalsContact O-CG2 3.25Å; L38-I65 WeakPolarHBondContact O-CG2 3.37Å; L38-I68 HydrophobicContact CD1-CB 4.32Å; L38-I68 HydrophobicContact CD1-CG2 3.57Å; L38-I68 HydrophobicContact CD2-CB 4.37Å; L38-I68 HydrophobicContact CD2-CG2 4.15Å; L38-L69 HydrophobicContact CB-CD1 4.42Å; L38-L69 HydrophobicContact CB-CD2 3.49Å; L38-L69 VanDerWaalsContact CB-CD2 3.49Å; L38-L69 HydrophobicContact CB-CG 3.74Å; L38-L69 HydrophobicContact CD1-CD2 4.36Å; L38-L72 HydrophobicContact CD1-CD1 4.32Å; L38-L72 HydrophobicContact CD1-CD2 4.5Å
39	E	94.4	Very high	91.7	Very high	35 Å²	35	66.3 Å²	66.3	16%	0.164	32%	0.315	C	S	.	.	H	α-helix	trans	-65	-40.8	176.3	-174.6	58.4	-155.8	0	0	110.8	Y35 A41 Y42 Q43 Y83	Y35-E39 HydrophobicContact CE1-CB 4.31Å; Y35-E39 HydrophobicContact CE1-CG 4.4Å; Y35-E39 WeakPolarHBondContact O-CB 3.4Å; Y35-E39 PolarHBondContact O-N 2.62Å; E39-A41 PolarHBondContact O-N 2.98Å; E39-Y42 PolarHBondContact O-N 3.12Å; E39-Q43 WeakPolarHBondContact O-CG 3.27Å; E39-Q43 PolarHBondContact O-N 2.62Å; E39-Q43 PolarHBondContact OE1-NE2 3.3Å; E39-Y83 PolarHBondContact OE2-OH 3.38Å
40	E	94.2	Very high	91.6	Very high	112 Å²	112	64.9 Å²	64.9	52%	0.523	29%	0.294	S	S	.	.	H	α-helix	trans	-58.5	-47.8	172.7	-178.2	178.4	-173.5	0	0	111.8	R36 Y42 Q43 L44	R36-E40 WeakPolarHBondContact O-CB 3.39Å; R36-E40 PolarHBondContact O-N 3.31Å; E40-Y42 VanDerWaalsContact C-N 3.32Å; E40-Y42 PolarHBondContact O-N 3.47Å; E40-Q43 PolarHBondContact O-N 3.39Å; E40-L44 PolarHBondContact O-N 2.87Å; E40-L44 VanDerWaalsContact O-N 3.08Å
41	A	94.8	Very high	90.9	Very high	0 Å²	0	65 Å²	65	0%	0	31%	0.305	C	S	.	.	H	α-helix	trans	-62.7	-39.1	176.9	0	0	0	0	0	112.6	A17 C20 L37 L38 E39 C45 I65	A17-A41 HydrophobicContact CB-CB 4.29Å; C20-A41 HydrophobicContact CB-CB 3.68Å; L37-A41 PolarHBondContact O-N 2.7Å; L38-A41 PolarHBondContact O-N 3.15Å; E39-A41 PolarHBondContact O-N 2.98Å; A41-C45 WeakPolarHBondContact O-CB 3.36Å; A41-C45 PolarHBondContact O-N 2.92Å; A41-C45 PolarHBondContact O-SG 3.37Å; A41-I65 HydrophobicContact CB-CD1 3.9Å; A41-I65 HydrophobicContact CB-CG1 4.03Å; A41-I65 HydrophobicContact CB-CG2 4.02Å
42	Y	94.6	Very high	89.9	Confident	13 Å²	13	70.5 Å²	70.5	5%	0.051	33%	0.33	C	S	.	.	H	α-helix	trans	-64.5	-48.4	178.4	166.4	-113.9	0	0	0	111.8	L38 E39 E40 L44 C45 K46 I66 L69 Y83 E86	L38-Y42 WeakPolarHBondContact O-CB 3.49Å; L38-Y42 PolarHBondContact O-N 3.23Å; E39-Y42 PolarHBondContact O-N 3.12Å; E40-Y42 VanDerWaalsContact C-N 3.32Å; E40-Y42 PolarHBondContact O-N 3.47Å; Y42-L44 VanDerWaalsContact C-N 3.32Å; Y42-L44 PolarHBondContact O-N 2.91Å; Y42-C45 PolarHBondContact O-N 3.42Å; Y42-K46 HydrophobicContact CE1-CD 4.16Å; Y42-K46 HydrophobicContact CE2-CD 3.98Å; Y42-K46 HydrophobicContact CE2-CG 4.12Å; Y42-K46 PolarHBondContact O-N 3.22Å; Y42-K46 WeakPolarHBondContact OH-CE 3.14Å; Y42-K46 PolarHBondContact OH-NZ 2.93Å; Y42-I66 HydrophobicContact CD2-CD1 3.97Å; Y42-I66 HydrophobicContact CD2-CG1 3.47Å; Y42-I66 VanDerWaalsContact CD2-CG1 3.47Å; Y42-I66 HydrophobicContact CE2-CD1 3.79Å; Y42-I66 HydrophobicContact CE2-CG1 3.66Å; Y42-L69 HydrophobicContact CD1-CD1 4.37Å; Y42-L69 HydrophobicContact CG-CD1 3.98Å; Y42-Y83 HydrophobicContact CD1-CE1 4.23Å; Y42-Y83 AromaticContact CE1-CE1 3.86Å; Y42-Y83 HydrophobicContact CE1-CE1 3.86Å; Y42-Y83 HydrophobicContact CE2-CE1 4.5Å; Y42-Y83 AromaticContact CZ-CE1 3.97Å; Y42-E86 VanDerWaalsContact CE2-OE2 3.25Å; Y42-E86 WeakPolarHBondContact CE2-OE2 3.34Å; Y42-E86 VanDerWaalsContact CZ-OE2 3.26Å; Y42-E86 PolarHBondContact OH-OE1 3.34Å; Y42-E86 PolarHBondContact OH-OE2 3.14Å
43	Q	93.3	Very high	88.8	Confident	82 Å²	82	66.7 Å²	66.7	38%	0.383	31%	0.313	S	S	.	.	H	α-helix	trans	-61.4	-42.2	178	-67.4	-58.5	-30.1	0	0	111.4	E39 E40 C45 K46 M47	E39-Q43 WeakPolarHBondContact O-CG 3.27Å; E39-Q43 PolarHBondContact O-N 2.62Å; E39-Q43 PolarHBondContact OE1-NE2 3.3Å; E40-Q43 PolarHBondContact O-N 3.39Å; Q43-C45 PolarHBondContact O-N 3.4Å; Q43-K46 PolarHBondContact O-N 2.85Å; Q43-M47 WeakPolarHBondContact O-CB 3.44Å; Q43-M47 VanDerWaalsContact O-CG 3.28Å; Q43-M47 WeakPolarHBondContact O-CG 3.41Å; Q43-M47 PolarHBondContact O-N 3.24Å
44	L	91.6	Very high	88	Confident	41 Å²	41	72.1 Å²	72.1	22%	0.215	34%	0.335	C	S	.	.	H	α-helix	trans	-62.3	-44.9	175.8	-178.4	60.6	0	0	0	112.1	A13 L16 E40 Y42 K46 M47 T48	A13-L44 HydrophobicContact CB-CD1 4.38Å; A13-L44 HydrophobicContact CB-CD2 4.06Å; A13-L44 HydrophobicContact CB-CG 3.83Å; L16-L44 HydrophobicContact CB-CD2 3.89Å; L16-L44 HydrophobicContact CD2-CD2 3.33Å; L16-L44 HydrophobicContact CG-CD2 4.13Å; E40-L44 PolarHBondContact O-N 2.87Å; E40-L44 VanDerWaalsContact O-N 3.08Å; Y42-L44 VanDerWaalsContact C-N 3.32Å; Y42-L44 PolarHBondContact O-N 2.91Å; L44-K46 VanDerWaalsContact C-N 3.32Å; L44-K46 PolarHBondContact O-N 3.33Å; L44-M47 PolarHBondContact O-N 3.43Å; L44-T48 WeakPolarHBondContact O-CB 3.48Å; L44-T48 PolarHBondContact O-N 2.84Å; L44-T48 PolarHBondContact O-OG1 3.33Å
45	C	91.2	Very high	87.6	Confident	1 Å²	1	72.6 Å²	72.6	1%	0.007	34%	0.341	C	S	.	.	H	α-helix	trans	-59.8	-43.5	175.9	-71.9	0	0	0	0	111.5	A41 Y42 Q43 T48 Y49 L58 S62	A41-C45 WeakPolarHBondContact O-CB 3.36Å; A41-C45 PolarHBondContact O-N 2.92Å; A41-C45 PolarHBondContact O-SG 3.37Å; Y42-C45 PolarHBondContact O-N 3.42Å; Q43-C45 PolarHBondContact O-N 3.4Å; C45-T48 PolarHBondContact O-N 3.13Å; C45-Y49 VanDerWaalsContact O-CB 3.31Å; C45-Y49 WeakPolarHBondContact O-CB 3.26Å; C45-Y49 PolarHBondContact O-N 3.35Å; C45-L58 HydrophobicContact CB-CD1 4.46Å; C45-S62 WeakPolarHBondContact CB-OG 3.39Å
46	K	89.9	Confident	87.4	Confident	84 Å²	84	70.4 Å²	70.4	37%	0.365	34%	0.338	S	S	.	.	H	α-helix	trans	-62.3	-46.6	176.9	-104.6	-167.1	160.3	172.2	0	112.8	Y42 Q43 L44 T48 Y49 E86	Y42-K46 HydrophobicContact CE1-CD 4.16Å; Y42-K46 HydrophobicContact CE2-CD 3.98Å; Y42-K46 HydrophobicContact CE2-CG 4.12Å; Y42-K46 PolarHBondContact O-N 3.22Å; Y42-K46 WeakPolarHBondContact OH-CE 3.14Å; Y42-K46 PolarHBondContact OH-NZ 2.93Å; Q43-K46 PolarHBondContact O-N 2.85Å; L44-K46 VanDerWaalsContact C-N 3.32Å; L44-K46 PolarHBondContact O-N 3.33Å; K46-T48 PolarHBondContact O-N 3.01Å; K46-Y49 PolarHBondContact O-N 3.09Å; K46-E86 WeakPolarHBondContact CE-OE1 3.33Å; K46-E86 WeakPolarHBondContact CE-OE2 3.27Å; K46-E86 IonicContact NZ-OE1 2.8Å; K46-E86 PolarHBondContact NZ-OE1 3.23Å; K46-E86 IonicContact NZ-OE2 2.86Å; K46-E86 PolarHBondContact NZ-OE2 3.09Å
47	M	88.6	Confident	87.2	Confident	158 Å²	158	65.6 Å²	65.6	78%	0.778	32%	0.324	S	S	*	.	H	α-helix	trans	-64.5	-31.6	178.4	-70.9	176.2	70.2	0	0	112.2	Q43 L44	Q43-M47 WeakPolarHBondContact O-CB 3.44Å; Q43-M47 VanDerWaalsContact O-CG 3.28Å; Q43-M47 WeakPolarHBondContact O-CG 3.41Å; Q43-M47 PolarHBondContact O-N 3.24Å; L44-M47 PolarHBondContact O-N 3.43Å
48	T	88.7	Confident	87.1	Confident	18 Å²	18	63.8 Å²	63.8	11%	0.11	31%	0.314	C	S	.	.	H	α-helix	trans	-85.8	-21.2	-178.8	-49	0	0	0	0	112.6	N9 A10 A13 L44 C45 K46 K50 L58	N9-T48 HydrophobicContact CB-CG2 4.31Å; A10-T48 VanDerWaalsContact CA-CG2 3.47Å; A10-T48 HydrophobicContact CB-CG2 3.91Å; A13-T48 HydrophobicContact CB-CG2 3.98Å; A13-T48 WeakPolarHBondContact CB-OG1 3.48Å; L44-T48 WeakPolarHBondContact O-CB 3.48Å; L44-T48 PolarHBondContact O-N 2.84Å; L44-T48 PolarHBondContact O-OG1 3.33Å; C45-T48 PolarHBondContact O-N 3.13Å; K46-T48 PolarHBondContact O-N 3.01Å; T48-K50 PolarHBondContact O-N 3.43Å; T48-L58 HydrophobicContact CG2-CD1 4.48Å; T48-L58 HydrophobicContact CG2-CD2 4.14Å
49	Y	87.3	Confident	87	Confident	50 Å²	50	64.1 Å²	64.1	20%	0.196	32%	0.316	C	S	.	.			trans	-70.4	115.7	179.3	177.6	-110.8	0	0	0	110.9	C45 K46 L59 F90 K93	C45-Y49 VanDerWaalsContact O-CB 3.31Å; C45-Y49 WeakPolarHBondContact O-CB 3.26Å; C45-Y49 PolarHBondContact O-N 3.35Å; K46-Y49 PolarHBondContact O-N 3.09Å; Y49-L59 HydrophobicContact CD2-CD2 4.2Å; Y49-L59 HydrophobicContact CE2-CD2 3.74Å; Y49-F90 HydrophobicContact CD1-CE1 4.22Å; Y49-F90 HydrophobicContact CD1-CZ 4.17Å; Y49-F90 AromaticContact CD2-CE1 3.9Å; Y49-F90 HydrophobicContact CD2-CE1 3.9Å; Y49-F90 HydrophobicContact CE2-CE1 4.24Å; Y49-F90 AromaticContact CG-CE1 3.9Å; Y49-F90 HydrophobicContact CG-CE1 3.9Å; Y49-F90 HydrophobicContact CG-CZ 4.18Å; Y49-K93 PolarHBondContact OH-NZ 3.37Å
50	K	82.7	Confident	86.9	Confident	89 Å²	89	63.3 Å²	63.3	39%	0.387	31%	0.311	S	S	.	.			trans	-105.7	131.6	168.2	-65.4	-175.8	178.2	-174.2	0	108	E6 T48 E52 S53	E6-K50 IonicContact OE1-NZ 3.62Å; E6-K50 PolarHBondContact OE1-NZ 2.49Å; E6-K50 IonicContact OE2-NZ 3.88Å; E6-K50 PolarHBondContact OE2-NZ 2.77Å; T48-K50 PolarHBondContact O-N 3.43Å; K50-E52 PolarHBondContact O-N 2.81Å; K50-E52 VanDerWaalsContact O-N 3.13Å; K50-S53 PolarHBondContact O-N 3.3Å; K50-S53 PolarHBondContact O-OG 3.42Å
51	P	74.5	Confident	86.9	Confident	101 Å²	101	59 Å²	59	66%	0.656	29%	0.291	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.2	-32.1	-178.5	-25.6	33.8	0	0	0	114	S53	P51-S53 VanDerWaalsContact C-N 3.34Å
52	E	68.1	Low	86.9	Confident	165 Å²	165	59 Å²	59	77%	0.771	29%	0.291	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.3	-13.7	176.9	-53.6	91.1	-177.6	0	0	113.7	K50 K54	K50-E52 PolarHBondContact O-N 2.81Å; K50-E52 VanDerWaalsContact O-N 3.13Å; E52-K54 PolarHBondContact O-N 3.42Å
53	S	68	Low	87	Confident	40 Å²	40	58.4 Å²	58.4	28%	0.28	29%	0.288	S	S	.	.			trans	-82.8	113.7	-176.7	90.4	0	0	0	0	111.2	K50 P51 N55	K50-S53 PolarHBondContact O-N 3.3Å; K50-S53 PolarHBondContact O-OG 3.42Å; P51-S53 VanDerWaalsContact C-N 3.34Å; S53-N55 PolarHBondContact O-N 3.41Å; S53-N55 VanDerWaalsContact O-N 3.11Å
54	K	74.4	Confident	87.1	Confident	190 Å²	190	55.7 Å²	55.7	83%	0.826	28%	0.276	S	S	*	.			trans	-83	42.3	172.5	-66.8	-175	177.1	-178.3	0	111.8	E52 A56	E52-K54 PolarHBondContact O-N 3.42Å; K54-A56 PolarHBondContact O-N 3.24Å
55	N	85.9	Confident	87.3	Confident	49 Å²	49	53.7 Å²	53.7	26%	0.262	27%	0.266	S	S	.	.			trans	-77.9	94	178.2	-170.8	-25.5	0	0	0	109.7	A10 S53 E57 L58 L59	A10-N55 WeakPolarHBondContact CB-ND2 3.41Å; S53-N55 PolarHBondContact O-N 3.41Å; S53-N55 VanDerWaalsContact O-N 3.11Å; N55-E57 PolarHBondContact O-N 2.83Å; N55-E57 WeakPolarHBondContact OD1-CB 3.15Å; N55-E57 PolarHBondContact OD1-N 3.06Å; N55-E57 VanDerWaalsContact OD1-N 3.12Å; N55-L58 HydrophobicContact CB-CB 3.93Å; N55-L58 PolarHBondContact O-N 3.33Å; N55-L58 VanDerWaalsContact O-N 3.17Å; N55-L58 PolarHBondContact OD1-N 3.02Å; N55-L58 VanDerWaalsContact OD1-N 3.15Å; N55-L59 WeakPolarHBondContact O-CG 3.44Å; N55-L59 PolarHBondContact O-N 2.8Å
56	A	89.1	Confident	87.5	Confident	27 Å²	27	53.7 Å²	53.7	22%	0.223	27%	0.266	C	S	.	.	H	α-helix	trans	-57.1	-35.8	-179.3	0	0	0	0	0	112.7	K54 L59 K60 C97	K54-A56 PolarHBondContact O-N 3.24Å; A56-L59 PolarHBondContact O-N 2.99Å; A56-K60 VanDerWaalsContact O-CB 3.27Å; A56-K60 WeakPolarHBondContact O-CB 3.44Å; A56-K60 PolarHBondContact O-N 3.11Å; A56-C97 HydrophobicContact CB-CB 3.88Å
57	E	90.6	Very high	87.7	Confident	84 Å²	84	50.2 Å²	50.2	39%	0.393	25%	0.253	S	S	.	.	H	α-helix	trans	-65.4	-45.5	178.3	-162.9	70.3	-152.9	0	0	110.5	C14 N55 K60 W61	C14-E57 HydrophobicContact CB-CG 4.08Å; N55-E57 PolarHBondContact O-N 2.83Å; N55-E57 WeakPolarHBondContact OD1-CB 3.15Å; N55-E57 PolarHBondContact OD1-N 3.06Å; N55-E57 VanDerWaalsContact OD1-N 3.12Å; E57-K60 WeakPolarHBondContact O-CB 3.25Å; E57-K60 PolarHBondContact O-N 2.75Å; E57-K60 WeakPolarHBondContact OE1-CE 3.32Å; E57-K60 IonicContact OE1-NZ 3.43Å; E57-K60 PolarHBondContact OE1-NZ 3.48Å; E57-K60 IonicContact OE2-NZ 3.15Å; E57-K60 PolarHBondContact OE2-NZ 3.25Å; E57-W61 PolarHBondContact O-N 3.31Å; E57-W61 PolarHBondContact OE1-NE1 3.12Å
58	L	91.7	Very high	87.9	Confident	1 Å²	1	43.6 Å²	43.6	1%	0.005	22%	0.221	C	C	.	.	H	α-helix	trans	-64.6	-44.1	177.8	-176.3	66.7	0	0	0	111.4	A13 C14 C45 T48 N55 K60 W61 S62	A13-L58 HydrophobicContact CB-CD1 4.32Å; C14-L58 WeakPolarHBondContact SG-CA 3.48Å; C14-L58 PolarHBondContact SG-N 3.33Å; C14-L58 VanDerWaalsContact SG-N 3.42Å; C45-L58 HydrophobicContact CB-CD1 4.46Å; T48-L58 HydrophobicContact CG2-CD1 4.48Å; T48-L58 HydrophobicContact CG2-CD2 4.14Å; N55-L58 HydrophobicContact CB-CB 3.93Å; N55-L58 PolarHBondContact O-N 3.33Å; N55-L58 VanDerWaalsContact O-N 3.17Å; N55-L58 PolarHBondContact OD1-N 3.02Å; N55-L58 VanDerWaalsContact OD1-N 3.15Å; L58-K60 VanDerWaalsContact C-N 3.32Å; L58-K60 PolarHBondContact O-N 2.92Å; L58-W61 PolarHBondContact O-N 3.44Å; L58-S62 VanDerWaalsContact O-CB 3.28Å; L58-S62 WeakPolarHBondContact O-CB 3.42Å; L58-S62 PolarHBondContact O-N 3.01Å; L58-S62 PolarHBondContact O-OG 3.47Å
59	L	92.7	Very high	88.2	Confident	6 Å²	6	42.8 Å²	42.8	3%	0.031	22%	0.216	C	C	.	.	H	α-helix	trans	-60.4	-43.8	176.9	-68.3	169.5	0	0	0	111.2	Y49 N55 A56 S62 A63 F90 K93 A94	Y49-L59 HydrophobicContact CD2-CD2 4.2Å; Y49-L59 HydrophobicContact CE2-CD2 3.74Å; N55-L59 WeakPolarHBondContact O-CG 3.44Å; N55-L59 PolarHBondContact O-N 2.8Å; A56-L59 PolarHBondContact O-N 2.99Å; L59-S62 PolarHBondContact O-N 3.38Å; L59-A63 WeakPolarHBondContact O-CB 3.34Å; L59-A63 PolarHBondContact O-N 3.37Å; L59-F90 HydrophobicContact CD2-CD1 3.68Å; L59-F90 HydrophobicContact CD2-CE1 4.14Å; L59-K93 HydrophobicContact CD1-CB 3.9Å; L59-K93 HydrophobicContact CD2-CB 3.86Å; L59-K93 HydrophobicContact CD2-CD 4.17Å; L59-K93 HydrophobicContact CG-CB 4.46Å; L59-A94 HydrophobicContact CB-CB 4Å
60	K	93.8	Very high	88.4	Confident	18 Å²	18	40.5 Å²	40.5	8%	0.078	21%	0.207	C	C	.	.	H	α-helix	trans	-60.4	-53.2	176.8	177	-176	77	-167.5	0	111.6	A56 E57 L58 S62 A63 I64 D100 S102 V103 M106	A56-K60 VanDerWaalsContact O-CB 3.27Å; A56-K60 WeakPolarHBondContact O-CB 3.44Å; A56-K60 PolarHBondContact O-N 3.11Å; E57-K60 WeakPolarHBondContact O-CB 3.25Å; E57-K60 PolarHBondContact O-N 2.75Å; E57-K60 WeakPolarHBondContact OE1-CE 3.32Å; E57-K60 IonicContact OE1-NZ 3.43Å; E57-K60 PolarHBondContact OE1-NZ 3.48Å; E57-K60 IonicContact OE2-NZ 3.15Å; E57-K60 PolarHBondContact OE2-NZ 3.25Å; L58-K60 VanDerWaalsContact C-N 3.32Å; L58-K60 PolarHBondContact O-N 2.92Å; K60-S62 VanDerWaalsContact C-N 3.34Å; K60-S62 PolarHBondContact O-N 2.97Å; K60-A63 PolarHBondContact O-N 2.94Å; K60-I64 HydrophobicContact CG-CD1 4.04Å; K60-I64 WeakPolarHBondContact O-CG1 3.16Å; K60-I64 PolarHBondContact O-N 2.88Å; K60-D100 WeakPolarHBondContact CD-OD2 3.15Å; K60-D100 IonicContact NZ-OD2 2.82Å; K60-D100 PolarHBondContact NZ-OD2 2.98Å; K60-S102 WeakPolarHBondContact CD-OG 3.47Å; K60-V103 HydrophobicContact CB-CG2 4.21Å; K60-V103 HydrophobicContact CD-CG2 4.22Å; K60-V103 HydrophobicContact CG-CG2 3.95Å; K60-M106 HydrophobicContact CG-CE 4.31Å
61	W	94.5	Very high	88.8	Confident	22 Å²	22	40 Å²	40	8%	0.083	21%	0.207	C	C	.	.	H	α-helix	trans	-65.6	-37.2	-179.5	-76.5	111.8	0	0	0	112.5	A17 H18 Y21 E57 L58 A63 I64 I65	A17-W61 HydrophobicContact CB-CB 4.08Å; H18-W61 HydrophobicContact CB-CD2 4.22Å; H18-W61 HydrophobicContact CB-CE3 4.23Å; H18-W61 HydrophobicContact CB-CH2 3.74Å; H18-W61 HydrophobicContact CB-CZ2 3.67Å; H18-W61 HydrophobicContact CB-CZ3 4.01Å; H18-W61 AromaticContact CD2-CH2 3.04Å; H18-W61 WeakPolarHBondContact CD2-CH2 3.19Å; H18-W61 AromaticContact CD2-CZ2 3.62Å; H18-W61 AromaticContact CD2-CZ3 3.68Å; H18-W61 AromaticContact CG-CH2 3.34Å; H18-W61 AromaticContact CG-CZ2 3.42Å; H18-W61 VanDerWaalsContact CG-CZ2 3.42Å; H18-W61 AromaticContact ND1-CH2 3.97Å; H18-W61 AromaticContact ND1-CZ2 3.72Å; H18-W61 AromaticContact NE2-CH2 3.55Å; Y21-W61 HydrophobicContact CD1-CH2 4.42Å; Y21-W61 AromaticContact CD1-CZ3 3.94Å; Y21-W61 HydrophobicContact CD1-CZ3 3.94Å; Y21-W61 HydrophobicContact CG-CZ3 4.31Å; E57-W61 PolarHBondContact O-N 3.31Å; E57-W61 PolarHBondContact OE1-NE1 3.12Å; L58-W61 PolarHBondContact O-N 3.44Å; W61-A63 VanDerWaalsContact C-N 3.34Å; W61-A63 PolarHBondContact O-N 3.21Å; W61-I64 HydrophobicContact CD2-CD1 4.33Å; W61-I64 HydrophobicContact CE3-CB 4.3Å; W61-I64 HydrophobicContact CE3-CD1 3.79Å; W61-I64 HydrophobicContact CE3-CG2 4.31Å; W61-I64 HydrophobicContact CH2-CD1 4.33Å; W61-I64 HydrophobicContact CZ3-CD1 3.8Å; W61-I64 HydrophobicContact CZ3-CG2 4.24Å; W61-I64 PolarHBondContact O-N 3.26Å; W61-I65 VanDerWaalsContact O-CG1 3.31Å; W61-I65 WeakPolarHBondContact O-CG1 3.34Å; W61-I65 PolarHBondContact O-N 3.48Å
62	S	94.7	Very high	89.6	Confident	1 Å²	1	35.4 Å²	35.4	1%	0.007	18%	0.176	C	C	.	.	H	α-helix	trans	-57.7	-48.5	172.6	-56.3	0	0	0	0	110.8	C45 L58 L59 K60 I64 I65 I66	C45-S62 WeakPolarHBondContact CB-OG 3.39Å; L58-S62 VanDerWaalsContact O-CB 3.28Å; L58-S62 WeakPolarHBondContact O-CB 3.42Å; L58-S62 PolarHBondContact O-N 3.01Å; L58-S62 PolarHBondContact O-OG 3.47Å; L59-S62 PolarHBondContact O-N 3.38Å; K60-S62 VanDerWaalsContact C-N 3.34Å; K60-S62 PolarHBondContact O-N 2.97Å; S62-I64 PolarHBondContact O-N 2.94Å; S62-I65 PolarHBondContact O-N 2.87Å; S62-I66 WeakPolarHBondContact O-CB 3.36Å; S62-I66 WeakPolarHBondContact O-CD1 3.48Å; S62-I66 WeakPolarHBondContact O-CG1 3.32Å; S62-I66 PolarHBondContact O-N 3.47Å
63	A	95.3	Very high	90.5	Very high	0 Å²	0	35.6 Å²	35.6	0%	0	18%	0.177	C	C	.	.	H	α-helix	trans	-61.8	-43.2	176.9	0	0	0	0	0	112.1	L59 K60 W61 G67 F87 F90 M106	L59-A63 WeakPolarHBondContact O-CB 3.34Å; L59-A63 PolarHBondContact O-N 3.37Å; K60-A63 PolarHBondContact O-N 2.94Å; W61-A63 VanDerWaalsContact C-N 3.34Å; W61-A63 PolarHBondContact O-N 3.21Å; A63-G67 PolarHBondContact O-N 3.42Å; A63-F87 HydrophobicContact CB-CD2 4.31Å; A63-F87 HydrophobicContact CB-CE2 4.25Å; A63-F87 WeakPolarHBondContact O-CD2 3.43Å; A63-F87 WeakPolarHBondContact O-CE2 3.31Å; A63-F90 HydrophobicContact CB-CB 4.1Å; A63-M106 HydrophobicContact CB-CE 4.24Å; A63-M106 HydrophobicContact CB-SD 4.33Å
64	I	95.5	Very high	91.4	Very high	24 Å²	24	37 Å²	37	12%	0.123	19%	0.187	C	C	.	.	H	α-helix	trans	-59.1	-51.6	177.6	-69.3	168.3	0	0	0	110.7	Y21 K60 W61 S62 G67 I68 M106	Y21-I64 HydrophobicContact CD2-CG2 4.14Å; Y21-I64 HydrophobicContact CE2-CG2 4.31Å; Y21-I64 HydrophobicContact CG-CG2 4.34Å; K60-I64 HydrophobicContact CG-CD1 4.04Å; K60-I64 WeakPolarHBondContact O-CG1 3.16Å; K60-I64 PolarHBondContact O-N 2.88Å; W61-I64 HydrophobicContact CD2-CD1 4.33Å; W61-I64 HydrophobicContact CE3-CB 4.3Å; W61-I64 HydrophobicContact CE3-CD1 3.79Å; W61-I64 HydrophobicContact CE3-CG2 4.31Å; W61-I64 HydrophobicContact CH2-CD1 4.33Å; W61-I64 HydrophobicContact CZ3-CD1 3.8Å; W61-I64 HydrophobicContact CZ3-CG2 4.24Å; W61-I64 PolarHBondContact O-N 3.26Å; S62-I64 PolarHBondContact O-N 2.94Å; I64-G67 PolarHBondContact O-N 3.5Å; I64-I68 HydrophobicContact CG2-CD1 3.78Å; I64-I68 WeakPolarHBondContact O-CD1 3.27Å; I64-I68 VanDerWaalsContact O-CG1 3.26Å; I64-I68 WeakPolarHBondContact O-CG1 3.13Å; I64-I68 PolarHBondContact O-N 2.94Å; I64-I68 VanDerWaalsContact O-N 3.13Å; I64-M106 HydrophobicContact CB-SD 4.3Å; I64-M106 HydrophobicContact CD1-CE 4.4Å; I64-M106 HydrophobicContact CD1-SD 4.46Å; I64-M106 HydrophobicContact CG1-CE 3.77Å; I64-M106 HydrophobicContact CG1-SD 3.36Å; I64-M106 WeakPolarHBondContact CG1-SD 3.33Å
65	I	96.2	Very high	92.1	Very high	0 Å²	0	28.4 Å²	28.4	0%	0	15%	0.15	C	C	.	.	H	α-helix	trans	-63.2	-47.7	-176.4	-66	-63.4	0	0	0	111.3	A17 L38 A41 W61 S62 G67 I68 L69	A17-I65 HydrophobicContact CB-CG1 4.18Å; L38-I65 HydrophobicContact CD2-CD1 3.87Å; L38-I65 HydrophobicContact CD2-CG2 4.45Å; L38-I65 VanDerWaalsContact O-CG2 3.25Å; L38-I65 WeakPolarHBondContact O-CG2 3.37Å; A41-I65 HydrophobicContact CB-CD1 3.9Å; A41-I65 HydrophobicContact CB-CG1 4.03Å; A41-I65 HydrophobicContact CB-CG2 4.02Å; W61-I65 VanDerWaalsContact O-CG1 3.31Å; W61-I65 WeakPolarHBondContact O-CG1 3.34Å; W61-I65 PolarHBondContact O-N 3.48Å; S62-I65 PolarHBondContact O-N 2.87Å; I65-G67 VanDerWaalsContact C-N 3.31Å; I65-G67 PolarHBondContact O-N 2.89Å; I65-I68 PolarHBondContact O-N 3.15Å; I65-L69 HydrophobicContact CG2-CD1 4.2Å; I65-L69 PolarHBondContact O-N 2.98Å
66	I	95.6	Very high	92.4	Very high	1 Å²	1	29.7 Å²	29.7	1%	0.005	16%	0.157	C	C	.	.	H	α-helix	trans	-63.6	-39.9	179.6	-61.4	164.9	0	0	0	110.7	Y42 S62 I68 L69 A70 Y83 E86 F87 F90	Y42-I66 HydrophobicContact CD2-CD1 3.97Å; Y42-I66 HydrophobicContact CD2-CG1 3.47Å; Y42-I66 VanDerWaalsContact CD2-CG1 3.47Å; Y42-I66 HydrophobicContact CE2-CD1 3.79Å; Y42-I66 HydrophobicContact CE2-CG1 3.66Å; S62-I66 WeakPolarHBondContact O-CB 3.36Å; S62-I66 WeakPolarHBondContact O-CD1 3.48Å; S62-I66 WeakPolarHBondContact O-CG1 3.32Å; S62-I66 PolarHBondContact O-N 3.47Å; I66-I68 VanDerWaalsContact C-N 3.26Å; I66-I68 PolarHBondContact O-N 3.22Å; I66-L69 PolarHBondContact O-N 2.66Å; I66-A70 WeakPolarHBondContact O-CB 3.41Å; I66-A70 PolarHBondContact O-N 2.71Å; I66-Y83 HydrophobicContact CG2-CD1 4.07Å; I66-Y83 HydrophobicContact CG2-CG 4.43Å; I66-Y83 WeakPolarHBondContact CG2-O 3.46Å; I66-E86 HydrophobicContact CD1-CB 4.24Å; I66-E86 HydrophobicContact CG2-CB 4.42Å; I66-F87 HydrophobicContact CB-CB 4.34Å; I66-F87 HydrophobicContact CG2-CB 3.79Å; I66-F90 HydrophobicContact CD1-CD2 3.5Å; I66-F90 VanDerWaalsContact CD1-CD2 3.5Å; I66-F90 HydrophobicContact CD1-CE2 3.79Å; I66-F90 HydrophobicContact CD1-CG 4.35Å
67	G	94.1	Very high	92.4	Very high	10 Å²	10	34.9 Å²	34.9	10%	0.103	18%	0.176	C	C	.	.	H	α-helix	trans	-60.5	-36.9	178	0	0	0	0	0	112.7	A63 I64 I65 E71	A63-G67 PolarHBondContact O-N 3.42Å; I64-G67 PolarHBondContact O-N 3.5Å; I65-G67 VanDerWaalsContact C-N 3.31Å; I65-G67 PolarHBondContact O-N 2.89Å; G67-E71 WeakPolarHBondContact O-CG 3.36Å; G67-E71 PolarHBondContact O-N 3.14Å
68	I	93.4	Very high	92.5	Very high	20 Å²	20	35.8 Å²	35.8	10%	0.103	19%	0.188	C	C	.	.	H	α-helix	trans	-78.9	-39	178.5	-60.1	160.6	0	0	0	111.2	Y21 L38 I64 I65 I66 A70 E71 L72	Y21-I68 HydrophobicContact CD2-CD1 3.14Å; Y21-I68 HydrophobicContact CE2-CD1 3.16Å; Y21-I68 HydrophobicContact CE2-CG1 4.43Å; Y21-I68 HydrophobicContact CG-CD1 4.36Å; L38-I68 HydrophobicContact CD1-CB 4.32Å; L38-I68 HydrophobicContact CD1-CG2 3.57Å; L38-I68 HydrophobicContact CD2-CB 4.37Å; L38-I68 HydrophobicContact CD2-CG2 4.15Å; I64-I68 HydrophobicContact CG2-CD1 3.78Å; I64-I68 WeakPolarHBondContact O-CD1 3.27Å; I64-I68 VanDerWaalsContact O-CG1 3.26Å; I64-I68 WeakPolarHBondContact O-CG1 3.13Å; I64-I68 PolarHBondContact O-N 2.94Å; I64-I68 VanDerWaalsContact O-N 3.13Å; I65-I68 PolarHBondContact O-N 3.15Å; I66-I68 VanDerWaalsContact C-N 3.26Å; I66-I68 PolarHBondContact O-N 3.22Å; I68-A70 VanDerWaalsContact C-N 3.27Å; I68-A70 PolarHBondContact O-N 3.33Å; I68-E71 WeakPolarHBondContact O-CB 3.47Å; I68-E71 PolarHBondContact O-N 3.4Å; I68-L72 PolarHBondContact O-N 3.25Å
69	L	93.7	Very high	92.5	Very high	0 Å²	0	39.7 Å²	39.7	0%	0	21%	0.206	C	C	.	.	H	α-helix	trans	-53	-50.2	170.7	-81.7	168.9	0	0	0	109.9	Y35 L38 Y42 I65 I66 E71 L72 L75 Y83	Y35-L69 HydrophobicContact CD2-CD2 4.1Å; Y35-L69 HydrophobicContact CE2-CD2 4.3Å; L38-L69 HydrophobicContact CB-CD1 4.42Å; L38-L69 HydrophobicContact CB-CD2 3.49Å; L38-L69 VanDerWaalsContact CB-CD2 3.49Å; L38-L69 HydrophobicContact CB-CG 3.74Å; L38-L69 HydrophobicContact CD1-CD2 4.36Å; Y42-L69 HydrophobicContact CD1-CD1 4.37Å; Y42-L69 HydrophobicContact CG-CD1 3.98Å; I65-L69 HydrophobicContact CG2-CD1 4.2Å; I65-L69 PolarHBondContact O-N 2.98Å; I66-L69 PolarHBondContact O-N 2.66Å; L69-E71 PolarHBondContact O-N 3.39Å; L69-L72 HydrophobicContact CD2-CD1 3.97Å; L69-L72 WeakPolarHBondContact O-CB 3.47Å; L69-L72 WeakPolarHBondContact O-CG 3.49Å; L69-L72 PolarHBondContact O-N 2.84Å; L69-L75 WeakPolarHBondContact O-CD1 3.22Å; L69-Y83 HydrophobicContact CD1-CE1 4.01Å
70	A	92.9	Very high	92.5	Very high	2 Å²	2	43.4 Å²	43.4	2%	0.017	22%	0.22	C	C	.	.	T	Hydrogen-bonded Turn	trans	-64.6	-12.5	-179.7	0	0	0	0	0	114.5	I66 I68 R80 M84	I66-A70 WeakPolarHBondContact O-CB 3.41Å; I66-A70 PolarHBondContact O-N 2.71Å; I68-A70 VanDerWaalsContact C-N 3.27Å; I68-A70 PolarHBondContact O-N 3.33Å; A70-R80 WeakPolarHBondContact O-CG 3.29Å; A70-M84 HydrophobicContact CB-CE 3.48Å; A70-M84 VanDerWaalsContact CB-CE 3.48Å; A70-M84 HydrophobicContact CB-CG 4.07Å; A70-M84 HydrophobicContact CB-SD 3.98Å
71	E	90.1	Very high	92.4	Very high	80 Å²	80	46.3 Å²	46.3	37%	0.374	24%	0.239	S	C	.	.	T	Hydrogen-bonded Turn	trans	-92.7	-5.3	174.8	-74.7	177.9	-171	0	0	113.7	G67 I68 L69 R109 R113	G67-E71 WeakPolarHBondContact O-CG 3.36Å; G67-E71 PolarHBondContact O-N 3.14Å; I68-E71 WeakPolarHBondContact O-CB 3.47Å; I68-E71 PolarHBondContact O-N 3.4Å; L69-E71 PolarHBondContact O-N 3.39Å; E71-R109 IonicContact OE1-CZ 2.62Å; E71-R109 IonicContact OE1-NH2 2.7Å; E71-R109 PolarHBondContact OE1-NH2 2.86Å; E71-R109 VanDerWaalsContact OE1-NH2 3.15Å; E71-R109 IonicContact OE2-NH2 2.62Å; E71-R113 VanDerWaalsContact CG-NH1 3.32Å; E71-R113 IonicContact OE1-CZ 3.25Å; E71-R113 VanDerWaalsContact OE1-CZ 3.25Å; E71-R113 IonicContact OE1-NH1 2.94Å; E71-R113 PolarHBondContact OE1-NH1 2.86Å; E71-R113 IonicContact OE1-NH2 2.75Å; E71-R113 PolarHBondContact OE1-NH2 3.26Å
72	L	91.2	Very high	92.4	Very high	3 Å²	3	48.9 Å²	48.9	2%	0.016	26%	0.257	C	S	.	.			trans	-69.1	140.8	176.3	-61	172.8	0	0	0	111.5	E31 R34 Y35 L38 I68 L69 L75	E31-L72 HydrophobicContact CG-CD2 4.22Å; R34-L72 HydrophobicContact CB-CD2 4.44Å; Y35-L72 HydrophobicContact CD2-CD1 3.76Å; Y35-L72 HydrophobicContact CG-CD1 4.37Å; L38-L72 HydrophobicContact CD1-CD1 4.32Å; L38-L72 HydrophobicContact CD1-CD2 4.5Å; I68-L72 PolarHBondContact O-N 3.25Å; L69-L72 HydrophobicContact CD2-CD1 3.97Å; L69-L72 WeakPolarHBondContact O-CB 3.47Å; L69-L72 WeakPolarHBondContact O-CG 3.49Å; L69-L72 PolarHBondContact O-N 2.84Å; L72-L75 HydrophobicContact CB-CD1 4.19Å; L72-L75 HydrophobicContact CD1-CD1 4.45Å; L72-L75 WeakPolarHBondContact O-CB 3.36Å
73	E	87.5	Confident	92.4	Very high	169 Å²	169	49.9 Å²	49.9	79%	0.79	26%	0.26	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.1	-35.3	-174.9	-65	-174.1	177	0	0	112.3	E31 L75	E31-E73 PolarHBondContact OE1-N 3.49Å; E73-L75 PolarHBondContact O-N 2.89Å
74	S	86.5	Confident	92.3	Very high	71 Å²	71	51.7 Å²	51.7	50%	0.497	27%	0.269	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.8	-16.1	175.8	48.6	0	0	0	0	114.3	E31 N76	E31-S74 WeakPolarHBondContact OE1-CA 3.37Å; E31-S74 WeakPolarHBondContact OE1-CB 3.26Å; E31-S74 PolarHBondContact OE1-N 3.06Å; E31-S74 PolarHBondContact OE1-OG 3.44Å; S74-N76 PolarHBondContact O-N 3.44Å
75	L	89.6	Confident	92.3	Very high	8 Å²	8	57.1 Å²	57.1	4%	0.042	29%	0.292	C	S	.	.	S	Bend	trans	-75.3	125.8	-176	-114.2	158.1	0	0	0	110.9	L69 L72 E73 E79 R80 Y83	L69-L75 WeakPolarHBondContact O-CD1 3.22Å; L72-L75 HydrophobicContact CB-CD1 4.19Å; L72-L75 HydrophobicContact CD1-CD1 4.45Å; L72-L75 WeakPolarHBondContact O-CB 3.36Å; E73-L75 PolarHBondContact O-N 2.89Å; L75-E79 HydrophobicContact CD2-CB 3.11Å; L75-E79 HydrophobicContact CD2-CG 4.1Å; L75-E79 VanDerWaalsContact CD2-OE2 3.3Å; L75-E79 WeakPolarHBondContact CD2-OE2 3.44Å; L75-R80 PolarHBondContact O-NH2 3.17Å; L75-Y83 HydrophobicContact CD1-CD2 3.88Å; L75-Y83 HydrophobicContact CD1-CE2 3.75Å; L75-Y83 HydrophobicContact CD2-CD2 3.86Å; L75-Y83 HydrophobicContact CD2-CE2 3.69Å; L75-Y83 HydrophobicContact CG-CE2 4.35Å
76	N	91.8	Very high	92.2	Very high	76 Å²	76	58.7 Å²	58.7	41%	0.406	30%	0.3	S	S	.	.			trans	-70.8	162.5	178.9	73.5	53.4	0	0	0	111.1	S74 T78 E79 R80	S74-N76 PolarHBondContact O-N 3.44Å; N76-T78 VanDerWaalsContact C-N 3.29Å; N76-T78 PolarHBondContact O-N 3.49Å; N76-T78 WeakPolarHBondContact OD1-CB 3.25Å; N76-T78 PolarHBondContact OD1-N 2.96Å; N76-T78 VanDerWaalsContact OD1-N 3.11Å; N76-E79 PolarHBondContact N-OE2 3.27Å; N76-E79 WeakPolarHBondContact ND2-CG 3.39Å; N76-E79 PolarHBondContact ND2-OE1 3.32Å; N76-E79 PolarHBondContact ND2-OE2 2.9Å; N76-E79 PolarHBondContact O-N 3.42Å; N76-E79 WeakPolarHBondContact OD1-CG 3.28Å; N76-E79 PolarHBondContact OD1-N 3.22Å; N76-R80 WeakPolarHBondContact O-CB 3.28Å; N76-R80 PolarHBondContact O-N 3.25Å
77	H	89.7	Confident	92.1	Very high	136 Å²	136	59.1 Å²	59.1	63%	0.63	30%	0.301	S	S	*	.	H	α-helix	trans	-58.9	-40.7	-174.5	-174.3	75.3	0	0	0	112.7	R80 V81	H77-R80 PolarHBondContact O-N 2.87Å; H77-V81 WeakPolarHBondContact O-CG2 3.44Å; H77-V81 PolarHBondContact O-N 3.48Å
78	T	92.8	Very high	92.2	Very high	104 Å²	104	61.8 Å²	61.8	64%	0.638	31%	0.31	S	S	*	.	H	α-helix	trans	-64.9	-50.5	-178.3	-53.7	0	0	0	0	111.4	N76 R80 V81 V82	N76-T78 VanDerWaalsContact C-N 3.29Å; N76-T78 PolarHBondContact O-N 3.49Å; N76-T78 WeakPolarHBondContact OD1-CB 3.25Å; N76-T78 PolarHBondContact OD1-N 2.96Å; N76-T78 VanDerWaalsContact OD1-N 3.11Å; T78-R80 VanDerWaalsContact C-N 3.32Å; T78-R80 PolarHBondContact O-N 3.16Å; T78-V81 PolarHBondContact O-N 3.45Å; T78-V82 WeakPolarHBondContact O-CG2 3.44Å; T78-V82 PolarHBondContact O-N 3.33Å; T78-V82 VanDerWaalsContact O-N 3.11Å
79	E	91.9	Very high	92.2	Very high	83 Å²	83	64.8 Å²	64.8	39%	0.388	32%	0.324	S	S	.	.	H	α-helix	trans	-62.7	-40.1	177.8	-69.6	169.6	156.9	0	0	111.4	L75 N76 V81 V82 Y83	L75-E79 HydrophobicContact CD2-CB 3.11Å; L75-E79 HydrophobicContact CD2-CG 4.1Å; L75-E79 VanDerWaalsContact CD2-OE2 3.3Å; L75-E79 WeakPolarHBondContact CD2-OE2 3.44Å; N76-E79 PolarHBondContact N-OE2 3.27Å; N76-E79 WeakPolarHBondContact ND2-CG 3.39Å; N76-E79 PolarHBondContact ND2-OE1 3.32Å; N76-E79 PolarHBondContact ND2-OE2 2.9Å; N76-E79 PolarHBondContact O-N 3.42Å; N76-E79 WeakPolarHBondContact OD1-CG 3.28Å; N76-E79 PolarHBondContact OD1-N 3.22Å; E79-V81 VanDerWaalsContact C-N 3.3Å; E79-V81 PolarHBondContact O-N 3.45Å; E79-V82 WeakPolarHBondContact O-CB 3.31Å; E79-V82 PolarHBondContact O-N 3.37Å; E79-V82 VanDerWaalsContact O-N 3.13Å; E79-Y83 VanDerWaalsContact O-CD2 3.28Å; E79-Y83 WeakPolarHBondContact O-CD2 3.31Å; E79-Y83 PolarHBondContact O-N 3.43Å
80	R	91.9	Very high	92.2	Very high	83 Å²	83	65.3 Å²	65.3	31%	0.313	33%	0.326	S	S	.	.	H	α-helix	trans	-58.6	-42.5	175.3	-173.7	-178.7	-63.4	133.6	6.5	111.8	A70 L75 N76 H77 T78 V82 Y83 M84	A70-R80 WeakPolarHBondContact O-CG 3.29Å; L75-R80 PolarHBondContact O-NH2 3.17Å; N76-R80 WeakPolarHBondContact O-CB 3.28Å; N76-R80 PolarHBondContact O-N 3.25Å; H77-R80 PolarHBondContact O-N 2.87Å; T78-R80 VanDerWaalsContact C-N 3.32Å; T78-R80 PolarHBondContact O-N 3.16Å; R80-V82 VanDerWaalsContact C-N 3.34Å; R80-Y83 PolarHBondContact O-N 3.32Å; R80-M84 HydrophobicContact CG-CG 4.49Å; R80-M84 WeakPolarHBondContact O-CB 3.39Å; R80-M84 VanDerWaalsContact O-CG 3.28Å; R80-M84 WeakPolarHBondContact O-CG 3.28Å; R80-M84 PolarHBondContact O-N 2.89Å
81	V	92	Very high	92.3	Very high	80 Å²	80	65.2 Å²	65.2	49%	0.485	33%	0.325	S	S	.	.	H	α-helix	trans	-64.4	-39.9	176.9	170.2	0	0	0	0	111.2	H77 T78 E79 M84 K85	H77-V81 WeakPolarHBondContact O-CG2 3.44Å; H77-V81 PolarHBondContact O-N 3.48Å; T78-V81 PolarHBondContact O-N 3.45Å; E79-V81 VanDerWaalsContact C-N 3.3Å; E79-V81 PolarHBondContact O-N 3.45Å; V81-M84 PolarHBondContact O-N 2.7Å; V81-K85 PolarHBondContact O-N 2.95Å
82	V	94.5	Very high	92.5	Very high	75 Å²	75	64.6 Å²	64.6	46%	0.455	33%	0.325	S	S	.	.	H	α-helix	trans	-60.7	-51.1	175.7	173.2	0	0	0	0	110.7	T78 E79 R80 M84 K85 E86	T78-V82 WeakPolarHBondContact O-CG2 3.44Å; T78-V82 PolarHBondContact O-N 3.33Å; T78-V82 VanDerWaalsContact O-N 3.11Å; E79-V82 WeakPolarHBondContact O-CB 3.31Å; E79-V82 PolarHBondContact O-N 3.37Å; E79-V82 VanDerWaalsContact O-N 3.13Å; R80-V82 VanDerWaalsContact C-N 3.34Å; V82-M84 VanDerWaalsContact C-N 3.34Å; V82-M84 PolarHBondContact O-N 3.08Å; V82-K85 PolarHBondContact O-N 3.48Å; V82-E86 PolarHBondContact O-N 3.44Å
83	Y	94.2	Very high	92.6	Very high	22 Å²	22	68.2 Å²	68.2	9%	0.086	34%	0.34	C	S	.	.	H	α-helix	trans	-62.4	-40.2	177.5	-71.5	-56.3	0	0	0	112.1	E39 Y42 I66 L69 L75 E79 R80 K85 E86 F87	E39-Y83 PolarHBondContact OE2-OH 3.38Å; Y42-Y83 HydrophobicContact CD1-CE1 4.23Å; Y42-Y83 AromaticContact CE1-CE1 3.86Å; Y42-Y83 HydrophobicContact CE1-CE1 3.86Å; Y42-Y83 HydrophobicContact CE2-CE1 4.5Å; Y42-Y83 AromaticContact CZ-CE1 3.97Å; I66-Y83 HydrophobicContact CG2-CD1 4.07Å; I66-Y83 HydrophobicContact CG2-CG 4.43Å; I66-Y83 WeakPolarHBondContact CG2-O 3.46Å; L69-Y83 HydrophobicContact CD1-CE1 4.01Å; L75-Y83 HydrophobicContact CD1-CD2 3.88Å; L75-Y83 HydrophobicContact CD1-CE2 3.75Å; L75-Y83 HydrophobicContact CD2-CD2 3.86Å; L75-Y83 HydrophobicContact CD2-CE2 3.69Å; L75-Y83 HydrophobicContact CG-CE2 4.35Å; E79-Y83 VanDerWaalsContact O-CD2 3.28Å; E79-Y83 WeakPolarHBondContact O-CD2 3.31Å; E79-Y83 PolarHBondContact O-N 3.43Å; R80-Y83 PolarHBondContact O-N 3.32Å; Y83-K85 VanDerWaalsContact C-N 3.3Å; Y83-K85 PolarHBondContact O-N 3.27Å; Y83-E86 PolarHBondContact O-N 2.86Å; Y83-F87 VanDerWaalsContact O-CB 3.24Å; Y83-F87 WeakPolarHBondContact O-CB 3.34Å; Y83-F87 PolarHBondContact O-N 3Å
84	M	93.5	Very high	92.9	Very high	38 Å²	38	60.2 Å²	60.2	19%	0.187	30%	0.303	C	S	.	.	H	α-helix	trans	-63.6	-35.8	177.2	-76.5	-64.5	177.8	0	0	112.9	A70 R80 V81 V82 K88	A70-M84 HydrophobicContact CB-CE 3.48Å; A70-M84 VanDerWaalsContact CB-CE 3.48Å; A70-M84 HydrophobicContact CB-CG 4.07Å; A70-M84 HydrophobicContact CB-SD 3.98Å; R80-M84 HydrophobicContact CG-CG 4.49Å; R80-M84 WeakPolarHBondContact O-CB 3.39Å; R80-M84 VanDerWaalsContact O-CG 3.28Å; R80-M84 WeakPolarHBondContact O-CG 3.28Å; R80-M84 PolarHBondContact O-N 2.89Å; V81-M84 PolarHBondContact O-N 2.7Å; V82-M84 VanDerWaalsContact C-N 3.34Å; V82-M84 PolarHBondContact O-N 3.08Å; M84-K88 PolarHBondContact O-N 3.45Å; M84-K88 VanDerWaalsContact O-N 3.13Å
85	K	94.2	Very high	93.3	Very high	139 Å²	139	59 Å²	59	60%	0.604	29%	0.29	S	S	*	.	H	α-helix	trans	-64.9	-50.8	174.2	-176.1	-175.2	173.3	-170.4	0	110.7	V81 V82 Y83 F87 K88 E89	V81-K85 PolarHBondContact O-N 2.95Å; V82-K85 PolarHBondContact O-N 3.48Å; Y83-K85 VanDerWaalsContact C-N 3.3Å; Y83-K85 PolarHBondContact O-N 3.27Å; K85-F87 VanDerWaalsContact C-N 3.34Å; K85-F87 PolarHBondContact O-N 3.32Å; K85-K88 PolarHBondContact O-N 2.98Å; K85-E89 VanDerWaalsContact CE-OE1 3.29Å; K85-E89 WeakPolarHBondContact CE-OE1 3.38Å; K85-E89 WeakPolarHBondContact O-CG 3.49Å; K85-E89 PolarHBondContact O-N 3.45Å; K85-E89 VanDerWaalsContact O-N 3.1Å
86	E	94.2	Very high	93.5	Very high	33 Å²	33	62.7 Å²	62.7	15%	0.154	32%	0.323	C	S	.	.	H	α-helix	trans	-62.6	-42	178.9	-68.2	-164.6	177.2	0	0	111.8	Y42 K46 I66 V82 Y83 K88 E89 F90	Y42-E86 VanDerWaalsContact CE2-OE2 3.25Å; Y42-E86 WeakPolarHBondContact CE2-OE2 3.34Å; Y42-E86 VanDerWaalsContact CZ-OE2 3.26Å; Y42-E86 PolarHBondContact OH-OE1 3.34Å; Y42-E86 PolarHBondContact OH-OE2 3.14Å; K46-E86 WeakPolarHBondContact CE-OE1 3.33Å; K46-E86 WeakPolarHBondContact CE-OE2 3.27Å; K46-E86 IonicContact NZ-OE1 2.8Å; K46-E86 PolarHBondContact NZ-OE1 3.23Å; K46-E86 IonicContact NZ-OE2 2.86Å; K46-E86 PolarHBondContact NZ-OE2 3.09Å; I66-E86 HydrophobicContact CD1-CB 4.24Å; I66-E86 HydrophobicContact CG2-CB 4.42Å; V82-E86 PolarHBondContact O-N 3.44Å; Y83-E86 PolarHBondContact O-N 2.86Å; E86-K88 VanDerWaalsContact C-N 3.28Å; E86-K88 PolarHBondContact O-N 2.89Å; E86-E89 WeakPolarHBondContact O-CB 3.41Å; E86-E89 PolarHBondContact O-N 3.36Å; E86-E89 VanDerWaalsContact O-N 3.12Å; E86-F90 VanDerWaalsContact O-CD2 3.27Å; E86-F90 WeakPolarHBondContact O-CD2 3.04Å; E86-F90 PolarHBondContact O-N 2.94Å
87	F	95.2	Very high	93.4	Very high	10 Å²	10	61.2 Å²	61.2	4%	0.044	32%	0.317	C	S	.	.	H	α-helix	trans	-50.4	-49.9	173.2	166.8	-98	0	0	0	111.2	A63 I66 Y83 K85 E89 F90 L91 M106 F110	A63-F87 HydrophobicContact CB-CD2 4.31Å; A63-F87 HydrophobicContact CB-CE2 4.25Å; A63-F87 WeakPolarHBondContact O-CD2 3.43Å; A63-F87 WeakPolarHBondContact O-CE2 3.31Å; I66-F87 HydrophobicContact CB-CB 4.34Å; I66-F87 HydrophobicContact CG2-CB 3.79Å; Y83-F87 VanDerWaalsContact O-CB 3.24Å; Y83-F87 WeakPolarHBondContact O-CB 3.34Å; Y83-F87 PolarHBondContact O-N 3Å; K85-F87 VanDerWaalsContact C-N 3.34Å; K85-F87 PolarHBondContact O-N 3.32Å; F87-E89 VanDerWaalsContact C-N 3.35Å; F87-E89 PolarHBondContact O-N 3.2Å; F87-F90 PolarHBondContact O-N 3.23Å; F87-L91 HydrophobicContact CE1-CD2 3.74Å; F87-L91 HydrophobicContact CZ-CB 4.47Å; F87-L91 HydrophobicContact CZ-CD2 3.78Å; F87-L91 VanDerWaalsContact O-CB 3.23Å; F87-L91 WeakPolarHBondContact O-CB 3.15Å; F87-L91 PolarHBondContact O-N 3.16Å; F87-M106 HydrophobicContact CE2-SD 4.41Å; F87-M106 HydrophobicContact CZ-CB 4.46Å; F87-F110 AromaticContact CD1-CD2 3.88Å; F87-F110 HydrophobicContact CD1-CD2 3.88Å; F87-F110 HydrophobicContact CD1-CE2 4.17Å; F87-F110 HydrophobicContact CE1-CB 3.87Å; F87-F110 AromaticContact CE1-CD2 3.49Å; F87-F110 HydrophobicContact CE1-CD2 3.49Å; F87-F110 VanDerWaalsContact CE1-CD2 3.49Å; F87-F110 HydrophobicContact CE1-CE2 4.21Å; F87-F110 AromaticContact CE1-CG 3.79Å; F87-F110 HydrophobicContact CE1-CG 3.79Å; F87-F110 HydrophobicContact CZ-CB 4.4Å
88	K	95	Very high	93.4	Very high	66 Å²	66	60.5 Å²	60.5	29%	0.287	32%	0.323	S	S	.	.	H	α-helix	trans	-64.2	-40.3	-179.2	-175.3	57.2	163.9	74.3	0	111.8	M84 K85 E86 L91 D92 F110	M84-K88 PolarHBondContact O-N 3.45Å; M84-K88 VanDerWaalsContact O-N 3.13Å; K85-K88 PolarHBondContact O-N 2.98Å; E86-K88 VanDerWaalsContact C-N 3.28Å; E86-K88 PolarHBondContact O-N 2.89Å; K88-L91 PolarHBondContact O-N 2.55Å; K88-D92 IonicContact NZ-OD1 3.45Å; K88-D92 PolarHBondContact NZ-OD1 3.46Å; K88-D92 IonicContact NZ-OD2 3.45Å; K88-D92 PolarHBondContact NZ-OD2 3.46Å; K88-D92 WeakPolarHBondContact O-CB 3.38Å; K88-D92 VanDerWaalsContact O-CG 3.27Å; K88-D92 PolarHBondContact O-N 3.17Å; K88-F110 HydrophobicContact CB-CZ 4.47Å; K88-F110 HydrophobicContact CD-CD1 4.16Å; K88-F110 HydrophobicContact CD-CE1 3.67Å; K88-F110 HydrophobicContact CD-CZ 4.08Å; K88-F110 HydrophobicContact CG-CE1 4.45Å; K88-F110 HydrophobicContact CG-CZ 4.43Å
89	E	93.9	Very high	93.2	Very high	82 Å²	82	57 Å²	57	38%	0.383	30%	0.302	S	S	.	.	H	α-helix	trans	-61.8	-45.2	176.9	-69.4	176.8	-168.3	0	0	112.1	K85 E86 F87 K93	K85-E89 VanDerWaalsContact CE-OE1 3.29Å; K85-E89 WeakPolarHBondContact CE-OE1 3.38Å; K85-E89 WeakPolarHBondContact O-CG 3.49Å; K85-E89 PolarHBondContact O-N 3.45Å; K85-E89 VanDerWaalsContact O-N 3.1Å; E86-E89 WeakPolarHBondContact O-CB 3.41Å; E86-E89 PolarHBondContact O-N 3.36Å; E86-E89 VanDerWaalsContact O-N 3.12Å; F87-E89 VanDerWaalsContact C-N 3.35Å; F87-E89 PolarHBondContact O-N 3.2Å; E89-K93 VanDerWaalsContact O-CG 3.28Å; E89-K93 WeakPolarHBondContact O-CG 3.27Å; E89-K93 PolarHBondContact O-N 3.49Å
90	F	93.8	Very high	93.3	Very high	12 Å²	12	55.8 Å²	55.8	5%	0.053	30%	0.298	C	S	.	.	H	α-helix	trans	-68.1	-40.8	176.4	-80.8	-78.4	0	0	0	112.1	Y49 L59 A63 I66 E86 F87 K93 A94	Y49-F90 HydrophobicContact CD1-CE1 4.22Å; Y49-F90 HydrophobicContact CD1-CZ 4.17Å; Y49-F90 AromaticContact CD2-CE1 3.9Å; Y49-F90 HydrophobicContact CD2-CE1 3.9Å; Y49-F90 HydrophobicContact CE2-CE1 4.24Å; Y49-F90 AromaticContact CG-CE1 3.9Å; Y49-F90 HydrophobicContact CG-CE1 3.9Å; Y49-F90 HydrophobicContact CG-CZ 4.18Å; L59-F90 HydrophobicContact CD2-CD1 3.68Å; L59-F90 HydrophobicContact CD2-CE1 4.14Å; A63-F90 HydrophobicContact CB-CB 4.1Å; I66-F90 HydrophobicContact CD1-CD2 3.5Å; I66-F90 VanDerWaalsContact CD1-CD2 3.5Å; I66-F90 HydrophobicContact CD1-CE2 3.79Å; I66-F90 HydrophobicContact CD1-CG 4.35Å; E86-F90 VanDerWaalsContact O-CD2 3.27Å; E86-F90 WeakPolarHBondContact O-CD2 3.04Å; E86-F90 PolarHBondContact O-N 2.94Å; F87-F90 PolarHBondContact O-N 3.23Å; F90-K93 PolarHBondContact O-N 3.34Å; F90-A94 WeakPolarHBondContact O-CB 3.49Å; F90-A94 PolarHBondContact O-N 3.11Å
91	L	94.9	Very high	93.4	Very high	0 Å²	0	55.8 Å²	55.8	0%	0	32%	0.316	C	S	.	.	H	α-helix	trans	-62.1	-44.7	178	179.7	65.4	0	0	0	111.7	F87 K88 K93 A94 L95 V103 M106 N107	F87-L91 HydrophobicContact CE1-CD2 3.74Å; F87-L91 HydrophobicContact CZ-CB 4.47Å; F87-L91 HydrophobicContact CZ-CD2 3.78Å; F87-L91 VanDerWaalsContact O-CB 3.23Å; F87-L91 WeakPolarHBondContact O-CB 3.15Å; F87-L91 PolarHBondContact O-N 3.16Å; K88-L91 PolarHBondContact O-N 2.55Å; L91-K93 VanDerWaalsContact C-N 3.34Å; L91-K93 PolarHBondContact O-N 3.37Å; L91-A94 WeakPolarHBondContact O-CB 3.46Å; L91-A94 PolarHBondContact O-N 3.01Å; L91-L95 HydrophobicContact CD1-CD1 4.48Å; L91-L95 HydrophobicContact CG-CD1 4.11Å; L91-L95 WeakPolarHBondContact O-CB 3.45Å; L91-L95 WeakPolarHBondContact O-CG 3.43Å; L91-L95 PolarHBondContact O-N 3.28Å; L91-V103 HydrophobicContact CD1-CG1 3.92Å; L91-M106 HydrophobicContact CD1-CB 4.04Å; L91-M106 HydrophobicContact CD1-CE 4.44Å; L91-N107 HydrophobicContact CD1-CB 4.4Å; L91-N107 HydrophobicContact CD2-CB 4.09Å
92	D	94.8	Very high	93.4	Very high	67 Å²	67	54 Å²	54	36%	0.358	31%	0.307	S	S	.	.	H	α-helix	trans	-63.4	-41.3	178.2	-74.5	-21.1	0	0	0	111.9	K88 A94 L95 A96	K88-D92 IonicContact NZ-OD1 3.45Å; K88-D92 PolarHBondContact NZ-OD1 3.46Å; K88-D92 IonicContact NZ-OD2 3.45Å; K88-D92 PolarHBondContact NZ-OD2 3.46Å; K88-D92 WeakPolarHBondContact O-CB 3.38Å; K88-D92 VanDerWaalsContact O-CG 3.27Å; K88-D92 PolarHBondContact O-N 3.17Å; D92-A94 VanDerWaalsContact C-N 3.34Å; D92-L95 PolarHBondContact O-N 3.17Å; D92-A96 WeakPolarHBondContact O-CB 3.41Å; D92-A96 PolarHBondContact O-N 2.96Å
93	K	93.5	Very high	93.4	Very high	78 Å²	78	50.6 Å²	50.6	34%	0.339	29%	0.287	S	S	.	.	H	α-helix	trans	-64.5	-40.2	174.7	-69.9	170.5	-175.1	172.8	0	111.3	Y49 L59 E89 F90 L91 A96 C97	Y49-K93 PolarHBondContact OH-NZ 3.37Å; L59-K93 HydrophobicContact CD1-CB 3.9Å; L59-K93 HydrophobicContact CD2-CB 3.86Å; L59-K93 HydrophobicContact CD2-CD 4.17Å; L59-K93 HydrophobicContact CG-CB 4.46Å; E89-K93 VanDerWaalsContact O-CG 3.28Å; E89-K93 WeakPolarHBondContact O-CG 3.27Å; E89-K93 PolarHBondContact O-N 3.49Å; F90-K93 PolarHBondContact O-N 3.34Å; L91-K93 VanDerWaalsContact C-N 3.34Å; L91-K93 PolarHBondContact O-N 3.37Å; K93-A96 PolarHBondContact O-N 3.42Å; K93-C97 PolarHBondContact O-N 3.32Å; K93-C97 PolarHBondContact O-SG 3.45Å
94	A	93.5	Very high	93.5	Very high	2 Å²	2	56.1 Å²	56.1	2%	0.017	31%	0.308	C	S	.	.	H	α-helix	trans	-64.4	-41.2	175.8	0	0	0	0	0	111.7	L59 F90 L91 D92 A96 C97 V103	L59-A94 HydrophobicContact CB-CB 4Å; F90-A94 WeakPolarHBondContact O-CB 3.49Å; F90-A94 PolarHBondContact O-N 3.11Å; L91-A94 WeakPolarHBondContact O-CB 3.46Å; L91-A94 PolarHBondContact O-N 3.01Å; D92-A94 VanDerWaalsContact C-N 3.34Å; A94-A96 VanDerWaalsContact C-N 3.3Å; A94-A96 PolarHBondContact O-N 3.15Å; A94-C97 PolarHBondContact O-N 2.89Å; A94-V103 HydrophobicContact CB-CG1 3.93Å; A94-V103 HydrophobicContact CB-CG2 4.26Å
95	L	94.7	Very high	93.6	Very high	44 Å²	44	60.1 Å²	60.1	23%	0.23	33%	0.326	C	S	.	.	H	α-helix	trans	-63.9	-33.5	175.1	-74.8	167	0	0	0	112.7	L91 D92 C97 P99 V103 Y104 N107	L91-L95 HydrophobicContact CD1-CD1 4.48Å; L91-L95 HydrophobicContact CG-CD1 4.11Å; L91-L95 WeakPolarHBondContact O-CB 3.45Å; L91-L95 WeakPolarHBondContact O-CG 3.43Å; L91-L95 PolarHBondContact O-N 3.28Å; D92-L95 PolarHBondContact O-N 3.17Å; L95-C97 VanDerWaalsContact C-N 3.26Å; L95-C97 PolarHBondContact O-N 3.44Å; L95-P99 HydrophobicContact CD2-CB 4.35Å; L95-V103 HydrophobicContact CD2-CG1 3.73Å; L95-V103 HydrophobicContact CG-CG1 3.84Å; L95-Y104 HydrophobicContact CD2-CD1 4.13Å; L95-Y104 HydrophobicContact CD2-CE1 4.17Å; L95-N107 HydrophobicContact CD1-CB 4.18Å; L95-N107 HydrophobicContact CD2-CB 4.49Å
96	A	93.5	Very high	93.7	Very high	87 Å²	87	54.7 Å²	54.7	72%	0.719	30%	0.303	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.7	-8.8	177.1	0	0	0	0	0	114.2	D92 K93 A94	D92-A96 WeakPolarHBondContact O-CB 3.41Å; D92-A96 PolarHBondContact O-N 2.96Å; K93-A96 PolarHBondContact O-N 3.42Å; A94-A96 VanDerWaalsContact C-N 3.3Å; A94-A96 PolarHBondContact O-N 3.15Å
97	C	90.1	Very high	93.7	Very high	44 Å²	44	55.3 Å²	55.3	30%	0.297	31%	0.307	S	S	.	.	S	Bend	trans	-92.4	-133.2	176.4	-64.5	0	0	0	0	110.4	A56 K93 A94 L95 P99	A56-C97 HydrophobicContact CB-CB 3.88Å; K93-C97 PolarHBondContact O-N 3.32Å; K93-C97 PolarHBondContact O-SG 3.45Å; A94-C97 PolarHBondContact O-N 2.89Å; L95-C97 VanDerWaalsContact C-N 3.26Å; L95-C97 PolarHBondContact O-N 3.44Å; C97-P99 VanDerWaalsContact C-CD 3.43Å; C97-P99 WeakPolarHBondContact O-CD 3.37Å
98	T	89.3	Confident	93.7	Very high	121 Å²	121	56.8 Å²	56.8	74%	0.742	33%	0.326	S	S	*	.			trans	-106	81	169.8	52.2	0	0	0	0	108.8
99	P	89.5	Confident	93.6	Very high	31 Å²	31	59.5 Å²	59.5	20%	0.201	33%	0.334	C	S	.	.			trans	-64.9	136.1	-175.9	26.1	-35.2	0	0	0	111.5	L95 C97 V103 Y104	L95-P99 HydrophobicContact CD2-CB 4.35Å; C97-P99 VanDerWaalsContact C-CD 3.43Å; C97-P99 WeakPolarHBondContact O-CD 3.37Å; P99-V103 HydrophobicContact CB-CB 3.95Å; P99-V103 HydrophobicContact CB-CG1 3.9Å; P99-Y104 HydrophobicContact CB-CD2 4.5Å; P99-Y104 HydrophobicContact CB-CE1 4.49Å; P99-Y104 HydrophobicContact CB-CE2 4.02Å; P99-Y104 HydrophobicContact CG-CE1 4.22Å; P99-Y104 HydrophobicContact CG-CE2 3.91Å; P99-Y104 WeakPolarHBondContact CG-OH 3.43Å
100	D	92.5	Very high	93.5	Very high	57 Å²	57	57.3 Å²	57.3	31%	0.305	32%	0.324	S	S	.	.			trans	-91.9	177.3	170.5	69.8	23.9	0	0	0	111.3	K60 S102 V103 Y104	K60-D100 WeakPolarHBondContact CD-OD2 3.15Å; K60-D100 IonicContact NZ-OD2 2.82Å; K60-D100 PolarHBondContact NZ-OD2 2.98Å; D100-S102 PolarHBondContact O-N 3.47Å; D100-S102 VanDerWaalsContact O-N 3.16Å; D100-S102 WeakPolarHBondContact OD1-CA 3.5Å; D100-S102 VanDerWaalsContact OD1-CB 3.31Å; D100-S102 WeakPolarHBondContact OD1-CB 3.29Å; D100-S102 PolarHBondContact OD1-N 3.35Å; D100-S102 PolarHBondContact OD1-OG 2.93Å; D100-V103 PolarHBondContact O-N 3.39Å; D100-V103 VanDerWaalsContact O-N 3.14Å; D100-V103 PolarHBondContact OD1-N 3.48Å; D100-V103 VanDerWaalsContact OD1-N 3.09Å; D100-Y104 VanDerWaalsContact O-CD2 3.27Å; D100-Y104 WeakPolarHBondContact O-CD2 3.31Å; D100-Y104 PolarHBondContact O-N 3.41Å
101	A	94.5	Very high	93.4	Very high	83 Å²	83	60 Å²	60	69%	0.686	34%	0.343	S	S	*	.	H	α-helix	trans	-57.1	-30.6	179.7	0	0	0	0	0	113.1	H105	A101-H105 WeakPolarHBondContact O-CB 3.16Å; A101-H105 PolarHBondContact O-N 3.28Å
102	S	92.4	Very high	93.3	Very high	43 Å²	43	67.2 Å²	67.2	30%	0.301	37%	0.372	S	S	.	.	H	α-helix	trans	-71.5	-38.6	179.6	78.6	0	0	0	0	111.7	K60 D100 H105 M106	K60-S102 WeakPolarHBondContact CD-OG 3.47Å; D100-S102 PolarHBondContact O-N 3.47Å; D100-S102 VanDerWaalsContact O-N 3.16Å; D100-S102 WeakPolarHBondContact OD1-CA 3.5Å; D100-S102 VanDerWaalsContact OD1-CB 3.31Å; D100-S102 WeakPolarHBondContact OD1-CB 3.29Å; D100-S102 PolarHBondContact OD1-N 3.35Å; D100-S102 PolarHBondContact OD1-OG 2.93Å; S102-H105 PolarHBondContact O-N 3.13Å; S102-M106 WeakPolarHBondContact O-CG 3.12Å; S102-M106 PolarHBondContact O-N 3.26Å
103	V	95.1	Very high	92.9	Very high	4 Å²	4	67.3 Å²	67.3	2%	0.024	37%	0.367	C	S	.	.	H	α-helix	trans	-63.4	-44.8	175.4	-178.5	0	0	0	0	110.5	K60 L91 A94 L95 P99 D100 H105 M106 N107	K60-V103 HydrophobicContact CB-CG2 4.21Å; K60-V103 HydrophobicContact CD-CG2 4.22Å; K60-V103 HydrophobicContact CG-CG2 3.95Å; L91-V103 HydrophobicContact CD1-CG1 3.92Å; A94-V103 HydrophobicContact CB-CG1 3.93Å; A94-V103 HydrophobicContact CB-CG2 4.26Å; L95-V103 HydrophobicContact CD2-CG1 3.73Å; L95-V103 HydrophobicContact CG-CG1 3.84Å; P99-V103 HydrophobicContact CB-CB 3.95Å; P99-V103 HydrophobicContact CB-CG1 3.9Å; D100-V103 PolarHBondContact O-N 3.39Å; D100-V103 VanDerWaalsContact O-N 3.14Å; D100-V103 PolarHBondContact OD1-N 3.48Å; D100-V103 VanDerWaalsContact OD1-N 3.09Å; V103-H105 PolarHBondContact O-N 3.23Å; V103-M106 HydrophobicContact CB-CE 4.49Å; V103-M106 HydrophobicContact CG2-CE 4.24Å; V103-M106 PolarHBondContact O-N 3.44Å; V103-N107 PolarHBondContact O-N 2.85Å
104	Y	96.3	Very high	92.6	Very high	138 Å²	138	66.2 Å²	66.2	54%	0.541	37%	0.367	S	S	.	.	H	α-helix	trans	-62.3	-42.2	174.6	-71.7	-60.7	0	0	0	112.5	L95 P99 D100 N107 G108	L95-Y104 HydrophobicContact CD2-CD1 4.13Å; L95-Y104 HydrophobicContact CD2-CE1 4.17Å; P99-Y104 HydrophobicContact CB-CD2 4.5Å; P99-Y104 HydrophobicContact CB-CE1 4.49Å; P99-Y104 HydrophobicContact CB-CE2 4.02Å; P99-Y104 HydrophobicContact CG-CE1 4.22Å; P99-Y104 HydrophobicContact CG-CE2 3.91Å; P99-Y104 WeakPolarHBondContact CG-OH 3.43Å; D100-Y104 VanDerWaalsContact O-CD2 3.27Å; D100-Y104 WeakPolarHBondContact O-CD2 3.31Å; D100-Y104 PolarHBondContact O-N 3.41Å; Y104-N107 PolarHBondContact O-N 2.88Å; Y104-G108 PolarHBondContact O-N 3.48Å
105	H	95.1	Very high	92.1	Very high	122 Å²	122	75.1 Å²	75.1	57%	0.565	40%	0.4	S	S	*	.	H	α-helix	trans	-61.8	-45.2	177	179.9	72.2	0	0	0	112	A101 S102 V103 N107 G108 R109	A101-H105 WeakPolarHBondContact O-CB 3.16Å; A101-H105 PolarHBondContact O-N 3.28Å; S102-H105 PolarHBondContact O-N 3.13Å; V103-H105 PolarHBondContact O-N 3.23Å; H105-N107 VanDerWaalsContact C-N 3.33Å; H105-N107 PolarHBondContact O-N 2.87Å; H105-G108 PolarHBondContact O-N 3.49Å; H105-R109 WeakPolarHBondContact NE2-CD 3.36Å; H105-R109 PolarHBondContact O-N 3.06Å
106	M	94.9	Very high	91.4	Very high	25 Å²	25	76.5 Å²	76.5	12%	0.123	41%	0.405	C	S	.	.	H	α-helix	trans	-58.5	-44.7	175.1	-75.2	-169.6	-70.9	0	0	111.8	K60 A63 I64 F87 L91 S102 V103 G108 R109 F110	K60-M106 HydrophobicContact CG-CE 4.31Å; A63-M106 HydrophobicContact CB-CE 4.24Å; A63-M106 HydrophobicContact CB-SD 4.33Å; I64-M106 HydrophobicContact CB-SD 4.3Å; I64-M106 HydrophobicContact CD1-CE 4.4Å; I64-M106 HydrophobicContact CD1-SD 4.46Å; I64-M106 HydrophobicContact CG1-CE 3.77Å; I64-M106 HydrophobicContact CG1-SD 3.36Å; I64-M106 WeakPolarHBondContact CG1-SD 3.33Å; F87-M106 HydrophobicContact CE2-SD 4.41Å; F87-M106 HydrophobicContact CZ-CB 4.46Å; L91-M106 HydrophobicContact CD1-CB 4.04Å; L91-M106 HydrophobicContact CD1-CE 4.44Å; S102-M106 WeakPolarHBondContact O-CG 3.12Å; S102-M106 PolarHBondContact O-N 3.26Å; V103-M106 HydrophobicContact CB-CE 4.49Å; V103-M106 HydrophobicContact CG2-CE 4.24Å; V103-M106 PolarHBondContact O-N 3.44Å; M106-G108 PolarHBondContact O-N 2.84Å; M106-R109 PolarHBondContact O-N 2.98Å; M106-F110 WeakPolarHBondContact O-CB 3.49Å; M106-F110 PolarHBondContact O-N 2.77Å
107	N	95.1	Very high	90.4	Very high	45 Å²	45	75.9 Å²	75.9	24%	0.241	40%	0.395	C	S	.	.	H	α-helix	trans	-62.1	-43.4	177.2	-169.7	49.3	0	0	0	112	L91 L95 V103 Y104 H105 R109 F110 C111	L91-N107 HydrophobicContact CD1-CB 4.4Å; L91-N107 HydrophobicContact CD2-CB 4.09Å; L95-N107 HydrophobicContact CD1-CB 4.18Å; L95-N107 HydrophobicContact CD2-CB 4.49Å; V103-N107 PolarHBondContact O-N 2.85Å; Y104-N107 PolarHBondContact O-N 2.88Å; H105-N107 VanDerWaalsContact C-N 3.33Å; H105-N107 PolarHBondContact O-N 2.87Å; N107-R109 PolarHBondContact O-N 3.43Å; N107-F110 PolarHBondContact O-N 3.36Å; N107-C111 PolarHBondContact O-N 3.12Å; N107-C111 PolarHBondContact O-SG 3.09Å; N107-C111 VanDerWaalsContact O-SG 3.37Å
108	G	95.3	Very high	88.6	Confident	42 Å²	42	82 Å²	82	43%	0.433	42%	0.417	S	S	.	.	H	α-helix	trans	-58.4	-47.6	174.3	0	0	0	0	0	112.7	Y104 H105 M106 F110 C111 Y112	Y104-G108 PolarHBondContact O-N 3.48Å; H105-G108 PolarHBondContact O-N 3.49Å; M106-G108 PolarHBondContact O-N 2.84Å; G108-F110 VanDerWaalsContact C-N 3.32Å; G108-F110 PolarHBondContact O-N 3.05Å; G108-C111 PolarHBondContact O-N 3.01Å; G108-Y112 WeakPolarHBondContact O-CB 3.35Å; G108-Y112 PolarHBondContact O-N 3.44Å
109	R	92.9	Very high	86.4	Confident	123 Å²	123	81.8 Å²	81.8	46%	0.464	41%	0.411	S	S	.	.	H	α-helix	trans	-60.7	-40.2	176.2	-75	-168.9	67.6	-153.7	-5.1	112.1	E71 H105 M106 N107 R113	E71-R109 IonicContact OE1-CZ 2.62Å; E71-R109 IonicContact OE1-NH2 2.7Å; E71-R109 PolarHBondContact OE1-NH2 2.86Å; E71-R109 VanDerWaalsContact OE1-NH2 3.15Å; E71-R109 IonicContact OE2-NH2 2.62Å; H105-R109 WeakPolarHBondContact NE2-CD 3.36Å; H105-R109 PolarHBondContact O-N 3.06Å; M106-R109 PolarHBondContact O-N 2.98Å; N107-R109 PolarHBondContact O-N 3.43Å; R109-R113 WeakPolarHBondContact O-CB 3.29Å; R109-R113 PolarHBondContact O-N 2.97Å
110	F	92.4	Very high	84	Confident	36 Å²	36	91.4 Å²	91.4	16%	0.158	45%	0.452	C	S	.	.	H	α-helix	trans	-64.8	-50.8	177.6	-179.9	-102	0	0	0	111.7	F87 K88 M106 N107 G108 Y112 R113 V114	F87-F110 AromaticContact CD1-CD2 3.88Å; F87-F110 HydrophobicContact CD1-CD2 3.88Å; F87-F110 HydrophobicContact CD1-CE2 4.17Å; F87-F110 HydrophobicContact CE1-CB 3.87Å; F87-F110 AromaticContact CE1-CD2 3.49Å; F87-F110 HydrophobicContact CE1-CD2 3.49Å; F87-F110 VanDerWaalsContact CE1-CD2 3.49Å; F87-F110 HydrophobicContact CE1-CE2 4.21Å; F87-F110 AromaticContact CE1-CG 3.79Å; F87-F110 HydrophobicContact CE1-CG 3.79Å; F87-F110 HydrophobicContact CZ-CB 4.4Å; K88-F110 HydrophobicContact CB-CZ 4.47Å; K88-F110 HydrophobicContact CD-CD1 4.16Å; K88-F110 HydrophobicContact CD-CE1 3.67Å; K88-F110 HydrophobicContact CD-CZ 4.08Å; K88-F110 HydrophobicContact CG-CE1 4.45Å; K88-F110 HydrophobicContact CG-CZ 4.43Å; M106-F110 WeakPolarHBondContact O-CB 3.49Å; M106-F110 PolarHBondContact O-N 2.77Å; N107-F110 PolarHBondContact O-N 3.36Å; G108-F110 VanDerWaalsContact C-N 3.32Å; G108-F110 PolarHBondContact O-N 3.05Å; F110-Y112 VanDerWaalsContact C-N 3.31Å; F110-Y112 PolarHBondContact O-N 2.91Å; F110-R113 WeakPolarHBondContact O-CB 3.39Å; F110-R113 PolarHBondContact O-N 2.82Å; F110-R113 VanDerWaalsContact O-N 3.16Å; F110-V114 HydrophobicContact CD1-CG2 4.22Å; F110-V114 HydrophobicContact CD2-CG2 4.28Å; F110-V114 HydrophobicContact CE1-CG2 3.77Å; F110-V114 HydrophobicContact CE2-CG2 3.86Å; F110-V114 HydrophobicContact CG-CG2 4.46Å; F110-V114 HydrophobicContact CZ-CG2 3.59Å; F110-V114 WeakPolarHBondContact O-CG2 3.42Å; F110-V114 PolarHBondContact O-N 3.02Å
111	C	92.1	Very high	83.6	Confident	69 Å²	69	93.1 Å²	93.1	47%	0.466	46%	0.46	S	S	.	.	H	α-helix	trans	-58.9	-41.5	178	-69	0	0	0	0	112.5	N107 G108 R115	N107-C111 PolarHBondContact O-N 3.12Å; N107-C111 PolarHBondContact O-SG 3.09Å; N107-C111 VanDerWaalsContact O-SG 3.37Å; G108-C111 PolarHBondContact O-N 3.01Å; C111-R115 PolarHBondContact O-N 2.93Å
112	Y	92	Very high	83	Confident	151 Å²	151	93.6 Å²	93.6	59%	0.592	45%	0.448	S	S	*	.	H	α-helix	trans	-60.8	-48.2	175.4	-178.5	-92.8	0	0	0	111.4	G108 F110 R115 H116	G108-Y112 WeakPolarHBondContact O-CB 3.35Å; G108-Y112 PolarHBondContact O-N 3.44Å; F110-Y112 VanDerWaalsContact C-N 3.31Å; F110-Y112 PolarHBondContact O-N 2.91Å; Y112-R115 PolarHBondContact O-N 3.47Å; Y112-H116 AromaticContact CD2-CD2 3.89Å; Y112-H116 AromaticContact CE1-CD2 3.66Å; Y112-H116 AromaticContact CE2-CD2 3.5Å; Y112-H116 AromaticContact CE2-NE2 3.41Å; Y112-H116 WeakPolarHBondContact CE2-NE2 3.43Å; Y112-H116 AromaticContact CZ-CD2 3.37Å; Y112-H116 AromaticContact CZ-NE2 3.46Å; Y112-H116 PolarHBondContact O-CD2 3.38Å; Y112-H116 PolarHBondContact O-N 3.49Å; Y112-H116 VanDerWaalsContact O-N 3.1Å
113	R	86.9	Confident	82.5	Confident	68 Å²	68	96.4 Å²	96.4	26%	0.257	46%	0.456	S	S	.	.	H	α-helix	trans	-59.3	-54.2	179.8	-168.7	-171.8	-37.4	-146.4	-1.2	111.4	E71 R109 F110 R115 H116 S117	E71-R113 VanDerWaalsContact CG-NH1 3.32Å; E71-R113 IonicContact OE1-CZ 3.25Å; E71-R113 VanDerWaalsContact OE1-CZ 3.25Å; E71-R113 IonicContact OE1-NH1 2.94Å; E71-R113 PolarHBondContact OE1-NH1 2.86Å; E71-R113 IonicContact OE1-NH2 2.75Å; E71-R113 PolarHBondContact OE1-NH2 3.26Å; R109-R113 WeakPolarHBondContact O-CB 3.29Å; R109-R113 PolarHBondContact O-N 2.97Å; F110-R113 WeakPolarHBondContact O-CB 3.39Å; F110-R113 PolarHBondContact O-N 2.82Å; F110-R113 VanDerWaalsContact O-N 3.16Å; R113-R115 PolarHBondContact O-N 3.26Å; R113-H116 CarbonylContact O-C 3.58Å; R113-H116 PolarHBondContact O-N 2.85Å; R113-S117 PolarHBondContact O-N 2.64Å; R113-S117 PolarHBondContact O-OG 3.36Å
114	V	86.1	Confident	81.7	Confident	56 Å²	56	101.9 Å²	101.9	34%	0.339	48%	0.482	S	S	.	.	H	α-helix	trans	-55.4	-41.6	-178.9	173.6	0	0	0	0	111.1	F110 F118	F110-V114 HydrophobicContact CD1-CG2 4.22Å; F110-V114 HydrophobicContact CD2-CG2 4.28Å; F110-V114 HydrophobicContact CE1-CG2 3.77Å; F110-V114 HydrophobicContact CE2-CG2 3.86Å; F110-V114 HydrophobicContact CG-CG2 4.46Å; F110-V114 HydrophobicContact CZ-CG2 3.59Å; F110-V114 WeakPolarHBondContact O-CG2 3.42Å; F110-V114 PolarHBondContact O-N 3.02Å; V114-F118 HydrophobicContact CG1-CE2 3.99Å; V114-F118 WeakPolarHBondContact O-CD2 3.44Å
115	R	83	Confident	80.8	Confident	188 Å²	188	99.6 Å²	99.6	71%	0.709	48%	0.478	S	S	*	.	H	α-helix	trans	-64	-40.1	176.7	-179.6	179	-78.1	157.5	-5.1	112.7	C111 Y112 R113	C111-R115 PolarHBondContact O-N 2.93Å; Y112-R115 PolarHBondContact O-N 3.47Å; R113-R115 PolarHBondContact O-N 3.26Å
116	H	81.3	Confident	79.9	Confident	74 Å²	74	98.1 Å²	98.1	34%	0.343	47%	0.472	S	S	.	.	H	α-helix	trans	-82.1	-22.1	-178.4	-83.2	-79.9	0	0	0	114.2	Y112 R113 F118 L119	Y112-H116 AromaticContact CD2-CD2 3.89Å; Y112-H116 AromaticContact CE1-CD2 3.66Å; Y112-H116 AromaticContact CE2-CD2 3.5Å; Y112-H116 AromaticContact CE2-NE2 3.41Å; Y112-H116 WeakPolarHBondContact CE2-NE2 3.43Å; Y112-H116 AromaticContact CZ-CD2 3.37Å; Y112-H116 AromaticContact CZ-NE2 3.46Å; Y112-H116 PolarHBondContact O-CD2 3.38Å; Y112-H116 PolarHBondContact O-N 3.49Å; Y112-H116 VanDerWaalsContact O-N 3.1Å; R113-H116 CarbonylContact O-C 3.58Å; R113-H116 PolarHBondContact O-N 2.85Å; H116-F118 PolarHBondContact O-N 2.95Å; H116-L119 PolarHBondContact O-N 3.32Å
117	S	70.9	Confident	78.8	Confident	73 Å²	73	103.4 Å²	103.4	51%	0.51	50%	0.497	S	S	.	.	H	α-helix	trans	-63.8	-23.2	175.4	-51.7	0	0	0	0	113.7	R113	R113-S117 PolarHBondContact O-N 2.64Å; R113-S117 PolarHBondContact O-OG 3.36Å
118	F	52.5	Low	77.5	Confident	173 Å²	173	107.8 Å²	107.8	76%	0.759	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.4	4.4	179.4	-67.8	-72.9	0	0	0	113.7	V114 H116	V114-F118 HydrophobicContact CG1-CE2 3.99Å; V114-F118 WeakPolarHBondContact O-CD2 3.44Å; H116-F118 PolarHBondContact O-N 2.95Å
119	L	44.1	Very low	76.1	Confident	116 Å²	116	113.3 Å²	113.3	61%	0.607	52%	0.524	S	S	*	.			trans	-102.2	5.4	-178	-71.7	170.8	0	0	0	113.7	H116	H116-L119 PolarHBondContact O-N 3.32Å
120	H	38.6	Very low	74.5	Confident	233 Å²	233	112.5 Å²	112.5	100%	1.079	53%	0.529	S	S	*	.			trans	-133.3	0	175	-64.5	-46.2	0	0	0	110

Retrieved 120 of 120 residues in 95.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).