A0A059QHK0_HUMAN Loading...

NADH-ubiquinone oxidoreductase chain 4L

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Part of the enzyme membrane arm which is embedded in the lipid bilayer and involved in proton translocation.

AlphaFold DB , UniProt , Accession A0A059QHK0, Species HUMAN (Homo sapiens, Human), Gene ND4L, Length 82 aa.

						>A0A059QHK0_HUMAN|A0A059QHK0|ND4L
LGILVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	53.8	Low	61.7	Low	172 Å²	172	99.4 Å²	99.4	90%	0.901	51%	0.506	S	S	*	.				0	-36.9	0	-76.9	163.4	0	0	0	113.1	I3 L4 V5	L1-I3 PolarHBondContact O-N 3.43Å; L1-L4 PolarHBondContact O-N 3.22Å; L1-V5 WeakPolarHBondContact O-CG2 3.45Å; L1-V5 PolarHBondContact O-N 3.23Å
2	G	63.2	Low	63	Low	47 Å²	47	94.9 Å²	94.9	49%	0.485	49%	0.49	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.7	-37.7	-177	0	0	0	0	0	116.3	V5	G2-V5 VanDerWaalsContact O-O 3.12Å
3	I	60.5	Low	64.3	Low	37 Å²	37	88.7 Å²	88.7	19%	0.19	46%	0.46	C	S	.	.	T	Hydrogen-bonded Turn	trans	-85	-35.8	177.4	-60.5	156.4	0	0	0	111.7	L1 V5 C16 L17 M20	L1-I3 PolarHBondContact O-N 3.43Å; I3-V5 PolarHBondContact O-N 3.45Å; I3-C16 HydrophobicContact CD1-CB 4Å; I3-C16 HydrophobicContact CG1-CB 3.46Å; I3-C16 VanDerWaalsContact CG1-CB 3.46Å; I3-L17 HydrophobicContact CD1-CD2 4.12Å; I3-L17 HydrophobicContact CD1-CG 3.91Å; I3-M20 HydrophobicContact CD1-CE 3.03Å; I3-M20 HydrophobicContact CD1-CG 4.27Å; I3-M20 HydrophobicContact CD1-SD 3.48Å; I3-M20 WeakPolarHBondContact CD1-SD 3.37Å
4	L	59.1	Low	65.6	Low	147 Å²	147	84.1 Å²	84.1	77%	0.77	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.6	-28.3	178.3	-77.7	159.4	0	0	0	112.2	L1 Y6	L1-L4 PolarHBondContact O-N 3.22Å; L4-Y6 PolarHBondContact O-N 3.14Å
5	V	58.3	Low	66.7	Low	85 Å²	85	86.1 Å²	86.1	52%	0.515	45%	0.447	S	S	.	.	S	Bend	trans	-94.4	85.7	169.1	-177.6	0	0	0	0	107.1	L1 G2 I3 R7	L1-V5 WeakPolarHBondContact O-CG2 3.45Å; L1-V5 PolarHBondContact O-N 3.23Å; G2-V5 VanDerWaalsContact O-O 3.12Å; I3-V5 PolarHBondContact O-N 3.45Å; V5-R7 VanDerWaalsContact C-N 3.25Å; V5-R7 PolarHBondContact O-N 3.34Å
6	Y	55.4	Low	67.7	Low	162 Å²	162	83.7 Å²	83.7	64%	0.635	44%	0.439	S	S	*	.			trans	-58.7	90.6	171.3	-75.1	-84.7	0	0	0	109.4	L4	L4-Y6 PolarHBondContact O-N 3.14Å
7	R	54.8	Low	68.6	Low	188 Å²	188	83.3 Å²	83.3	71%	0.709	44%	0.437	S	S	*	.			trans	-63	148.3	161.6	-86.3	-85.9	-165.6	111.1	1.1	107	V5 H9	V5-R7 VanDerWaalsContact C-N 3.25Å; V5-R7 PolarHBondContact O-N 3.34Å; R7-H9 PolarHBondContact O-N 3.41Å
8	S	59	Low	69.6	Low	55 Å²	55	83.8 Å²	83.8	39%	0.385	44%	0.437	S	S	.	.	S	Bend	trans	-46.6	-18.7	-175.8	56.7	0	0	0	0	116.2	Y73	S8-Y73 WeakPolarHBondContact O-CA 3.44Å; S8-Y73 WeakPolarHBondContact O-CD1 3.42Å
9	H	67.9	Low	70.5	Confident	81 Å²	81	81.7 Å²	81.7	38%	0.375	44%	0.437	S	S	.	.	B	Isolated β-bridge	trans	-107.4	116.4	-178.7	-60.6	-73	0	0	0	112.8	R7 M11 S12 Y73	R7-H9 PolarHBondContact O-N 3.41Å; H9-M11 PolarHBondContact O-N 3.12Å; H9-S12 PolarHBondContact O-N 3.41Å; H9-S12 PolarHBondContact O-OG 3.04Å; H9-Y73 AromaticContact CE1-CE1 3.87Å
10	L	70.6	Confident	71.3	Confident	34 Å²	34	82.2 Å²	82.2	18%	0.178	44%	0.438	C	S	.	.	H	α-helix	trans	-59.9	-27.5	176.9	-147.8	150.9	0	0	0	112.8	S12 S13 L14 L62 I65 V74	L10-S12 VanDerWaalsContact C-N 3.33Å; L10-S12 PolarHBondContact O-N 2.96Å; L10-S13 WeakPolarHBondContact CA-OG 3.48Å; L10-S13 PolarHBondContact O-N 3.2Å; L10-S13 PolarHBondContact O-OG 3.39Å; L10-L14 HydrophobicContact CD2-CD1 4.2Å; L10-L14 HydrophobicContact CD2-CG 4.34Å; L10-L14 PolarHBondContact O-N 2.65Å; L10-L14 VanDerWaalsContact O-N 3.11Å; L10-L62 HydrophobicContact CB-CD1 3.92Å; L10-L62 HydrophobicContact CB-CG 4.37Å; L10-L62 HydrophobicContact CD2-CB 4.27Å; L10-L62 HydrophobicContact CD2-CD1 3.73Å; L10-L62 HydrophobicContact CD2-CG 4.14Å; L10-L62 HydrophobicContact CG-CD1 4.42Å; L10-I65 HydrophobicContact CD1-CD1 4Å; L10-V74 HydrophobicContact CB-CG2 4.38Å; L10-V74 HydrophobicContact CD1-CG2 4.22Å; L10-V74 HydrophobicContact CG-CG2 4.44Å
11	M	75.9	Confident	72.2	Confident	85 Å²	85	80.8 Å²	80.8	42%	0.419	43%	0.43	S	S	.	.	H	α-helix	trans	-58.7	-40.7	172.1	-70.6	-63.6	-72.1	0	0	112.9	H9 S13 L14 L15 L62	H9-M11 PolarHBondContact O-N 3.12Å; M11-S13 VanDerWaalsContact C-N 3.33Å; M11-S13 PolarHBondContact O-N 3.06Å; M11-L14 PolarHBondContact O-N 3.09Å; M11-L15 PolarHBondContact O-N 3.08Å; M11-L15 VanDerWaalsContact O-N 3.09Å; M11-L62 HydrophobicContact CB-CD1 4.49Å; M11-L62 HydrophobicContact CG-CD1 3.75Å; M11-L62 HydrophobicContact CG-CD2 4.45Å; M11-L62 HydrophobicContact SD-CD1 3.32Å; M11-L62 WeakPolarHBondContact SD-CD1 3.19Å; M11-L62 HydrophobicContact SD-CD2 4.01Å; M11-L62 HydrophobicContact SD-CG 4.34Å
12	S	77.7	Confident	73.8	Confident	46 Å²	46	77.8 Å²	77.8	32%	0.322	41%	0.414	S	S	.	.	H	α-helix	trans	-70	-32.2	-178.5	68.5	0	0	0	0	112.3	H9 L10 C16	H9-S12 PolarHBondContact O-N 3.41Å; H9-S12 PolarHBondContact O-OG 3.04Å; L10-S12 VanDerWaalsContact C-N 3.33Å; L10-S12 PolarHBondContact O-N 2.96Å; S12-C16 PolarHBondContact O-N 3.01Å; S12-C16 VanDerWaalsContact O-N 3.16Å; S12-C16 PolarHBondContact O-SG 3.22Å
13	S	80.1	Confident	75.1	Confident	14 Å²	14	78.9 Å²	78.9	10%	0.098	41%	0.414	C	S	.	.	H	α-helix	trans	-71.2	-36.7	173.2	49.5	0	0	0	0	112.5	L10 M11 C16 L17	L10-S13 WeakPolarHBondContact CA-OG 3.48Å; L10-S13 PolarHBondContact O-N 3.2Å; L10-S13 PolarHBondContact O-OG 3.39Å; M11-S13 VanDerWaalsContact C-N 3.33Å; M11-S13 PolarHBondContact O-N 3.06Å; S13-C16 PolarHBondContact O-N 3.02Å; S13-L17 PolarHBondContact O-N 3.41Å
14	L	81.9	Confident	76.5	Confident	25 Å²	25	81.1 Å²	81.1	13%	0.131	43%	0.426	C	S	.	.	H	α-helix	trans	-63.1	-45.8	174.8	-77.4	169.1	0	0	0	111.6	L10 M11 C16 L17 E18 L59 L62	L10-L14 HydrophobicContact CD2-CD1 4.2Å; L10-L14 HydrophobicContact CD2-CG 4.34Å; L10-L14 PolarHBondContact O-N 2.65Å; L10-L14 VanDerWaalsContact O-N 3.11Å; M11-L14 PolarHBondContact O-N 3.09Å; L14-C16 VanDerWaalsContact C-N 3.27Å; L14-C16 PolarHBondContact O-N 3.4Å; L14-L17 WeakPolarHBondContact O-CB 3.34Å; L14-L17 PolarHBondContact O-N 2.92Å; L14-L17 VanDerWaalsContact O-N 3.08Å; L14-E18 PolarHBondContact O-N 2.88Å; L14-L59 HydrophobicContact CD1-CD2 4.05Å; L14-L59 HydrophobicContact CD1-CG 4.34Å; L14-L62 HydrophobicContact CD1-CB 4.37Å; L14-L62 HydrophobicContact CD1-CD1 3.46Å; L14-L62 VanDerWaalsContact CD1-CD1 3.46Å
15	L	81.8	Confident	78	Confident	113 Å²	113	77.3 Å²	77.3	59%	0.592	40%	0.403	S	S	*	.	H	α-helix	trans	-61	-36.7	175.3	-73.3	171.9	0	0	0	112.4	M11 E18 G19	M11-L15 PolarHBondContact O-N 3.08Å; M11-L15 VanDerWaalsContact O-N 3.09Å; L15-E18 PolarHBondContact O-N 2.87Å; L15-G19 PolarHBondContact O-N 3.3Å
16	C	84	Confident	79.5	Confident	48 Å²	48	77.3 Å²	77.3	32%	0.324	40%	0.399	S	S	.	.	H	α-helix	trans	-67.3	-37.4	174.8	-68.4	0	0	0	0	112.1	I3 S12 S13 L14 G19 M20	I3-C16 HydrophobicContact CD1-CB 4Å; I3-C16 HydrophobicContact CG1-CB 3.46Å; I3-C16 VanDerWaalsContact CG1-CB 3.46Å; S12-C16 PolarHBondContact O-N 3.01Å; S12-C16 VanDerWaalsContact O-N 3.16Å; S12-C16 PolarHBondContact O-SG 3.22Å; S13-C16 PolarHBondContact O-N 3.02Å; L14-C16 VanDerWaalsContact C-N 3.27Å; L14-C16 PolarHBondContact O-N 3.4Å; C16-G19 PolarHBondContact O-N 3.08Å; C16-M20 WeakPolarHBondContact O-CG 3.17Å; C16-M20 PolarHBondContact O-N 3.22Å; C16-M20 VanDerWaalsContact O-N 3.08Å
17	L	82.8	Confident	81.2	Confident	77 Å²	77	74.8 Å²	74.8	40%	0.403	40%	0.395	S	S	.	.	H	α-helix	trans	-62.9	-45.9	174.1	-87.5	162.6	0	0	0	111.4	I3 S13 L14 G19 M20 M21	I3-L17 HydrophobicContact CD1-CD2 4.12Å; I3-L17 HydrophobicContact CD1-CG 3.91Å; S13-L17 PolarHBondContact O-N 3.41Å; L14-L17 WeakPolarHBondContact O-CB 3.34Å; L14-L17 PolarHBondContact O-N 2.92Å; L14-L17 VanDerWaalsContact O-N 3.08Å; L17-G19 VanDerWaalsContact C-N 3.31Å; L17-G19 PolarHBondContact O-N 3.13Å; L17-M20 HydrophobicContact CD2-CE 3.66Å; L17-M20 HydrophobicContact CG-CE 4.44Å; L17-M20 PolarHBondContact O-N 3.29Å; L17-M21 WeakPolarHBondContact O-CG 3.49Å; L17-M21 PolarHBondContact O-N 3.48Å
18	E	85.5	Confident	82.7	Confident	93 Å²	93	67.1 Å²	67.1	44%	0.435	37%	0.372	S	S	.	.	H	α-helix	trans	-58	-43.4	174.8	-72.1	-174.8	164.3	0	0	111.8	L14 L15 M20 M21 L22	L14-E18 PolarHBondContact O-N 2.88Å; L15-E18 PolarHBondContact O-N 2.87Å; E18-M20 PolarHBondContact O-N 2.99Å; E18-M21 PolarHBondContact O-N 2.87Å; E18-L22 WeakPolarHBondContact O-CB 3.37Å; E18-L22 PolarHBondContact O-N 3.06Å
19	G	86.4	Confident	84.1	Confident	43 Å²	43	66 Å²	66	44%	0.443	36%	0.362	S	S	.	.	H	α-helix	trans	-60.2	-40.2	175.9	0	0	0	0	0	113.6	L15 C16 L17 L22 S23	L15-G19 PolarHBondContact O-N 3.3Å; C16-G19 PolarHBondContact O-N 3.08Å; L17-G19 VanDerWaalsContact C-N 3.31Å; L17-G19 PolarHBondContact O-N 3.13Å; G19-L22 PolarHBondContact O-N 3.5Å; G19-S23 PolarHBondContact O-N 3.46Å
20	M	87.9	Confident	85.1	Confident	91 Å²	91	66.7 Å²	66.7	45%	0.448	37%	0.369	S	S	.	.	H	α-helix	trans	-66	-44.7	175.4	-68.2	-167	-45	0	0	112	I3 C16 L17 E18 L22 S23 L24	I3-M20 HydrophobicContact CD1-CE 3.03Å; I3-M20 HydrophobicContact CD1-CG 4.27Å; I3-M20 HydrophobicContact CD1-SD 3.48Å; I3-M20 WeakPolarHBondContact CD1-SD 3.37Å; C16-M20 WeakPolarHBondContact O-CG 3.17Å; C16-M20 PolarHBondContact O-N 3.22Å; C16-M20 VanDerWaalsContact O-N 3.08Å; L17-M20 HydrophobicContact CD2-CE 3.66Å; L17-M20 HydrophobicContact CG-CE 4.44Å; L17-M20 PolarHBondContact O-N 3.29Å; E18-M20 PolarHBondContact O-N 2.99Å; M20-L22 VanDerWaalsContact C-N 3.27Å; M20-L22 PolarHBondContact O-N 3.33Å; M20-S23 PolarHBondContact O-N 2.96Å; M20-S23 PolarHBondContact O-OG 3.42Å; M20-L24 PolarHBondContact O-N 3.28Å
21	M	89.7	Confident	85.8	Confident	54 Å²	54	70.2 Å²	70.2	27%	0.266	39%	0.386	S	S	.	.	H	α-helix	trans	-61.2	-38.5	177.8	-64.4	-56.4	-78.7	0	0	111.6	L17 E18 L24 F25 A51	L17-M21 WeakPolarHBondContact O-CG 3.49Å; L17-M21 PolarHBondContact O-N 3.48Å; E18-M21 PolarHBondContact O-N 2.87Å; M21-L24 PolarHBondContact O-N 2.98Å; M21-L24 HydrophobicContact SD-CD1 4.39Å; M21-F25 PolarHBondContact O-N 3.02Å; M21-A51 HydrophobicContact CB-CB 4.11Å; M21-A51 HydrophobicContact CE-CB 3.3Å; M21-A51 HydrophobicContact CG-CB 4.11Å
22	L	88.4	Confident	86.3	Confident	109 Å²	109	67 Å²	67	57%	0.571	37%	0.37	S	S	*	.	H	α-helix	trans	-66.4	-41.3	176.8	-151.7	155	0	0	0	111.5	E18 G19 M20 L24 F25 I26	E18-L22 WeakPolarHBondContact O-CB 3.37Å; E18-L22 PolarHBondContact O-N 3.06Å; G19-L22 PolarHBondContact O-N 3.5Å; M20-L22 VanDerWaalsContact C-N 3.27Å; M20-L22 PolarHBondContact O-N 3.33Å; L22-L24 PolarHBondContact O-N 3.48Å; L22-F25 WeakPolarHBondContact O-CB 3.4Å; L22-F25 PolarHBondContact O-N 3.28Å; L22-I26 HydrophobicContact CD2-CD1 3.63Å; L22-I26 HydrophobicContact CD2-CG1 4.19Å; L22-I26 WeakPolarHBondContact O-CG1 3.47Å; L22-I26 PolarHBondContact O-N 2.96Å
23	S	89.9	Confident	86.7	Confident	70 Å²	70	70 Å²	70	49%	0.49	38%	0.383	S	S	.	.	H	α-helix	trans	-62.8	-39.4	174.7	74.1	0	0	0	0	113.1	G19 M20 F25 I26 M27	G19-S23 PolarHBondContact O-N 3.46Å; M20-S23 PolarHBondContact O-N 2.96Å; M20-S23 PolarHBondContact O-OG 3.42Å; S23-F25 VanDerWaalsContact C-N 3.35Å; S23-I26 PolarHBondContact O-N 3.4Å; S23-M27 PolarHBondContact O-N 3.16Å
24	L	88.4	Confident	86.9	Confident	84 Å²	84	75.1 Å²	75.1	44%	0.44	41%	0.409	S	S	.	.	H	α-helix	trans	-65.4	-40	175.8	-79.6	165.4	0	0	0	111.2	M20 M21 L22 M27 A28	M20-L24 PolarHBondContact O-N 3.28Å; M21-L24 PolarHBondContact O-N 2.98Å; M21-L24 HydrophobicContact SD-CD1 4.39Å; L22-L24 PolarHBondContact O-N 3.48Å; L24-M27 PolarHBondContact O-N 3.48Å; L24-A28 VanDerWaalsContact O-CB 3.3Å; L24-A28 WeakPolarHBondContact O-CB 3.41Å; L24-A28 PolarHBondContact O-N 2.89Å
25	F	90.6	Very high	86.9	Confident	66 Å²	66	78.3 Å²	78.3	29%	0.289	43%	0.429	S	S	.	.	H	α-helix	trans	-62	-45.6	174.9	176.8	-97.8	0	0	0	112.1	M21 L22 S23 M27 A28 T29 P44 L48	M21-F25 PolarHBondContact O-N 3.02Å; L22-F25 WeakPolarHBondContact O-CB 3.4Å; L22-F25 PolarHBondContact O-N 3.28Å; S23-F25 VanDerWaalsContact C-N 3.35Å; F25-M27 PolarHBondContact O-N 2.97Å; F25-A28 PolarHBondContact O-N 3.19Å; F25-T29 HydrophobicContact CD1-CG2 4.3Å; F25-T29 HydrophobicContact CD2-CG2 4.27Å; F25-T29 HydrophobicContact CE1-CG2 3.9Å; F25-T29 HydrophobicContact CE2-CG2 3.87Å; F25-T29 HydrophobicContact CG-CG2 4.48Å; F25-T29 HydrophobicContact CZ-CG2 3.67Å; F25-T29 WeakPolarHBondContact O-CB 3.3Å; F25-T29 VanDerWaalsContact O-CG2 3.32Å; F25-T29 WeakPolarHBondContact O-CG2 3.39Å; F25-T29 PolarHBondContact O-N 3.43Å; F25-T29 PolarHBondContact O-OG1 2.87Å; F25-P44 HydrophobicContact CD2-CB 3.85Å; F25-P44 WeakPolarHBondContact CD2-O 3.46Å; F25-P44 HydrophobicContact CE2-CB 3.76Å; F25-P44 WeakPolarHBondContact CE2-O 3.43Å; F25-L48 HydrophobicContact CD1-CD1 4.49Å; F25-L48 HydrophobicContact CD2-CB 4.26Å; F25-L48 HydrophobicContact CD2-CD1 3.81Å; F25-L48 HydrophobicContact CE1-CD1 4.39Å; F25-L48 HydrophobicContact CE2-CB 4.39Å; F25-L48 HydrophobicContact CE2-CD1 3.68Å; F25-L48 HydrophobicContact CG-CD1 4.22Å; F25-L48 HydrophobicContact CZ-CD1 3.99Å
26	I	91.1	Very high	86.7	Confident	85 Å²	85	81.1 Å²	81.1	44%	0.436	44%	0.439	S	S	.	.	H	α-helix	trans	-61.8	-44.5	176.7	-66.6	169.5	0	0	0	110.7	L22 S23 A28 T29 L30	L22-I26 HydrophobicContact CD2-CD1 3.63Å; L22-I26 HydrophobicContact CD2-CG1 4.19Å; L22-I26 WeakPolarHBondContact O-CG1 3.47Å; L22-I26 PolarHBondContact O-N 2.96Å; S23-I26 PolarHBondContact O-N 3.4Å; I26-A28 PolarHBondContact O-N 3Å; I26-T29 WeakPolarHBondContact CA-OG1 3.36Å; I26-T29 PolarHBondContact O-N 3.49Å; I26-T29 PolarHBondContact O-OG1 2.7Å; I26-L30 HydrophobicContact CG2-CD1 3.89Å; I26-L30 HydrophobicContact CG2-CG 4.48Å; I26-L30 WeakPolarHBondContact O-CB 3.45Å; I26-L30 WeakPolarHBondContact O-CG 3.45Å; I26-L30 PolarHBondContact O-N 3.11Å
27	M	90.2	Very high	86.3	Confident	109 Å²	109	80.9 Å²	80.9	54%	0.537	44%	0.438	S	S	.	.	H	α-helix	trans	-63.1	-44.8	178.1	-167	-161.1	77.9	0	0	111.5	S23 L24 F25 L30 M31	S23-M27 PolarHBondContact O-N 3.16Å; L24-M27 PolarHBondContact O-N 3.48Å; F25-M27 PolarHBondContact O-N 2.97Å; M27-L30 PolarHBondContact O-N 3.37Å; M27-M31 WeakPolarHBondContact O-CG 3.41Å; M27-M31 PolarHBondContact O-N 3.42Å; M27-M31 VanDerWaalsContact O-N 3.07Å
28	A	87.3	Confident	85.9	Confident	28 Å²	28	84.8 Å²	84.8	23%	0.231	46%	0.458	C	S	.	.	H	α-helix	trans	-62.9	-45.2	179.5	0	0	0	0	0	111.8	L24 F25 I26 M31 T32 P44	L24-A28 VanDerWaalsContact O-CB 3.3Å; L24-A28 WeakPolarHBondContact O-CB 3.41Å; L24-A28 PolarHBondContact O-N 2.89Å; F25-A28 PolarHBondContact O-N 3.19Å; I26-A28 PolarHBondContact O-N 3Å; A28-M31 PolarHBondContact O-N 3.31Å; A28-T32 WeakPolarHBondContact O-CG2 3.48Å; A28-T32 PolarHBondContact O-N 3.21Å; A28-P44 HydrophobicContact CB-CB 4.24Å
29	T	87.5	Confident	85.5	Confident	30 Å²	30	87.4 Å²	87.4	18%	0.184	48%	0.475	C	S	.	.	H	α-helix	trans	-65	-38.5	177.7	51.5	0	0	0	0	112.6	F25 I26 M31 T32 L33 P44	F25-T29 HydrophobicContact CD1-CG2 4.3Å; F25-T29 HydrophobicContact CD2-CG2 4.27Å; F25-T29 HydrophobicContact CE1-CG2 3.9Å; F25-T29 HydrophobicContact CE2-CG2 3.87Å; F25-T29 HydrophobicContact CG-CG2 4.48Å; F25-T29 HydrophobicContact CZ-CG2 3.67Å; F25-T29 WeakPolarHBondContact O-CB 3.3Å; F25-T29 VanDerWaalsContact O-CG2 3.32Å; F25-T29 WeakPolarHBondContact O-CG2 3.39Å; F25-T29 PolarHBondContact O-N 3.43Å; F25-T29 PolarHBondContact O-OG1 2.87Å; I26-T29 WeakPolarHBondContact CA-OG1 3.36Å; I26-T29 PolarHBondContact O-N 3.49Å; I26-T29 PolarHBondContact O-OG1 2.7Å; T29-M31 VanDerWaalsContact C-N 3.31Å; T29-M31 PolarHBondContact O-N 3.41Å; T29-T32 WeakPolarHBondContact CA-OG1 3.32Å; T29-T32 PolarHBondContact O-N 2.78Å; T29-T32 PolarHBondContact O-OG1 3.08Å; T29-L33 WeakPolarHBondContact O-CB 3.23Å; T29-L33 WeakPolarHBondContact O-CD1 3.49Å; T29-L33 WeakPolarHBondContact O-CG 3.45Å; T29-L33 PolarHBondContact O-N 3.35Å; T29-P44 HydrophobicContact CG2-CB 3.75Å; T29-P44 HydrophobicContact CG2-CG 4.01Å
30	L	89.3	Confident	85.2	Confident	96 Å²	96	86.8 Å²	86.8	50%	0.503	47%	0.465	S	S	.	.	H	α-helix	trans	-62.7	-38.3	173.2	-74.7	168	0	0	0	112.1	I26 M27 N34	I26-L30 HydrophobicContact CG2-CD1 3.89Å; I26-L30 HydrophobicContact CG2-CG 4.48Å; I26-L30 WeakPolarHBondContact O-CB 3.45Å; I26-L30 WeakPolarHBondContact O-CG 3.45Å; I26-L30 PolarHBondContact O-N 3.11Å; M27-L30 PolarHBondContact O-N 3.37Å; L30-N34 WeakPolarHBondContact O-CB 3.48Å; L30-N34 PolarHBondContact O-N 3.25Å; L30-N34 PolarHBondContact O-ND2 2.96Å
31	M	86.3	Confident	84.8	Confident	109 Å²	109	85.7 Å²	85.7	54%	0.537	46%	0.461	S	S	.	.	H	α-helix	trans	-69.1	-39.7	176.5	-70.1	-63.6	-165	0	0	112.7	M27 A28 T29 L33 N34 T35	M27-M31 WeakPolarHBondContact O-CG 3.41Å; M27-M31 PolarHBondContact O-N 3.42Å; M27-M31 VanDerWaalsContact O-N 3.07Å; A28-M31 PolarHBondContact O-N 3.31Å; T29-M31 VanDerWaalsContact C-N 3.31Å; T29-M31 PolarHBondContact O-N 3.41Å; M31-L33 VanDerWaalsContact C-N 3.35Å; M31-N34 PolarHBondContact O-N 2.72Å; M31-T35 WeakPolarHBondContact O-CG2 3.48Å; M31-T35 PolarHBondContact O-N 3.02Å; M31-T35 VanDerWaalsContact O-N 3.12Å; M31-T35 PolarHBondContact O-OG1 3.03Å
32	T	85.8	Confident	84.6	Confident	16 Å²	16	88.3 Å²	88.3	10%	0.098	48%	0.475	C	S	.	.	H	α-helix	trans	-66.8	-38.7	176.5	59.8	0	0	0	0	111.4	A28 T29 T35 H36 S37 A40 N41 P44	A28-T32 WeakPolarHBondContact O-CG2 3.48Å; A28-T32 PolarHBondContact O-N 3.21Å; T29-T32 WeakPolarHBondContact CA-OG1 3.32Å; T29-T32 PolarHBondContact O-N 2.78Å; T29-T32 PolarHBondContact O-OG1 3.08Å; T32-T35 PolarHBondContact O-N 3.48Å; T32-T35 PolarHBondContact O-OG1 3.45Å; T32-H36 PolarHBondContact O-N 3.27Å; T32-S37 PolarHBondContact O-N 3.32Å; T32-A40 HydrophobicContact CG2-CB 3.76Å; T32-A40 WeakPolarHBondContact CG2-O 3.41Å; T32-N41 PolarHBondContact OG1-OD1 3.48Å; T32-P44 HydrophobicContact CG2-CG 4.42Å
33	L	85.1	Confident	84.6	Confident	111 Å²	111	87.4 Å²	87.4	58%	0.581	47%	0.474	S	S	*	.	H	α-helix	trans	-63.9	-45.7	174.6	-71.3	168.4	0	0	0	111.9	T29 M31 T35 H36	T29-L33 WeakPolarHBondContact O-CB 3.23Å; T29-L33 WeakPolarHBondContact O-CD1 3.49Å; T29-L33 WeakPolarHBondContact O-CG 3.45Å; T29-L33 PolarHBondContact O-N 3.35Å; M31-L33 VanDerWaalsContact C-N 3.35Å; L33-T35 VanDerWaalsContact C-N 3.29Å; L33-T35 PolarHBondContact O-N 2.99Å; L33-H36 PolarHBondContact O-N 3.4Å
34	N	84.9	Confident	84.5	Confident	121 Å²	121	84.2 Å²	84.2	65%	0.647	45%	0.451	S	S	*	.	H	α-helix	trans	-63.3	-33	178.8	-81.9	-31.2	0	0	0	113.3	L30 M31 H36	L30-N34 WeakPolarHBondContact O-CB 3.48Å; L30-N34 PolarHBondContact O-N 3.25Å; L30-N34 PolarHBondContact O-ND2 2.96Å; M31-N34 PolarHBondContact O-N 2.72Å; N34-H36 VanDerWaalsContact C-N 3.31Å
35	T	82	Confident	84.5	Confident	92 Å²	92	85.3 Å²	85.3	56%	0.564	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.7	1.4	-179.4	54.8	0	0	0	0	113.3	M31 T32 L33 S37	M31-T35 WeakPolarHBondContact O-CG2 3.48Å; M31-T35 PolarHBondContact O-N 3.02Å; M31-T35 VanDerWaalsContact O-N 3.12Å; M31-T35 PolarHBondContact O-OG1 3.03Å; T32-T35 PolarHBondContact O-N 3.48Å; T32-T35 PolarHBondContact O-OG1 3.45Å; L33-T35 VanDerWaalsContact C-N 3.29Å; L33-T35 PolarHBondContact O-N 2.99Å; T35-S37 PolarHBondContact O-N 3.36Å; T35-S37 PolarHBondContact OG1-OG 3.31Å
36	H	77.8	Confident	84.5	Confident	172 Å²	172	84.1 Å²	84.1	80%	0.796	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	47	29.2	-176.2	-69.4	-72.8	0	0	0	113.9	T32 L33 N34 L38	T32-H36 PolarHBondContact O-N 3.27Å; L33-H36 PolarHBondContact O-N 3.4Å; N34-H36 VanDerWaalsContact C-N 3.31Å; H36-L38 PolarHBondContact O-N 2.75Å
37	S	74.9	Confident	84.5	Confident	43 Å²	43	84.6 Å²	84.6	30%	0.301	46%	0.461	S	S	.	.			trans	-98.3	93	-174.1	58.6	0	0	0	0	110.2	T32 T35 L39 A40	T32-S37 PolarHBondContact O-N 3.32Å; T35-S37 PolarHBondContact O-N 3.36Å; T35-S37 PolarHBondContact OG1-OG 3.31Å; S37-L39 PolarHBondContact O-N 2.93Å; S37-A40 WeakPolarHBondContact O-CB 3.28Å; S37-A40 PolarHBondContact O-N 3.37Å; S37-A40 WeakPolarHBondContact OG-CB 3.44Å
38	L	74.3	Confident	84.5	Confident	158 Å²	158	83.7 Å²	83.7	83%	0.827	46%	0.458	S	S	*	.	G	3₁₀ helix	trans	-59.2	-31.7	-179.2	-69	171.3	0	0	0	113.1	H36 A40 N41	H36-L38 PolarHBondContact O-N 2.75Å; L38-A40 VanDerWaalsContact C-N 3.34Å; L38-N41 WeakPolarHBondContact O-CB 3.44Å; L38-N41 PolarHBondContact O-N 2.92Å
39	L	77.9	Confident	84.7	Confident	149 Å²	149	86.4 Å²	86.4	78%	0.78	47%	0.471	S	S	*	.	G	3₁₀ helix	trans	-68	-31.4	175.3	-81.8	159.9	0	0	0	112.8	S37 N41 I42	S37-L39 PolarHBondContact O-N 2.93Å; L39-N41 PolarHBondContact O-N 2.93Å; L39-I42 PolarHBondContact O-N 3.43Å
40	A	80	Confident	84.9	Confident	29 Å²	29	91.9 Å²	91.9	24%	0.24	49%	0.492	C	S	.	.	G	3₁₀ helix	trans	-72.9	-14.3	-179.5	0	0	0	0	0	112.5	T32 S37 L38 I42 V43 P44	T32-A40 HydrophobicContact CG2-CB 3.76Å; T32-A40 WeakPolarHBondContact CG2-O 3.41Å; S37-A40 WeakPolarHBondContact O-CB 3.28Å; S37-A40 PolarHBondContact O-N 3.37Å; S37-A40 WeakPolarHBondContact OG-CB 3.44Å; L38-A40 VanDerWaalsContact C-N 3.34Å; A40-I42 PolarHBondContact O-N 3.24Å; A40-V43 WeakPolarHBondContact O-CB 3.46Å; A40-V43 PolarHBondContact O-N 3.34Å; A40-V43 VanDerWaalsContact O-N 3.09Å; A40-P44 WeakPolarHBondContact O-CD 3.44Å
41	N	79.6	Confident	84.9	Confident	68 Å²	68	88.1 Å²	88.1	36%	0.364	48%	0.475	S	S	.	.	G	3₁₀ helix	trans	-66.4	-15.8	176.2	-118.9	20.7	0	0	0	113.7	T32 L38 L39 V43 P44 I45	T32-N41 PolarHBondContact OG1-OD1 3.48Å; L38-N41 WeakPolarHBondContact O-CB 3.44Å; L38-N41 PolarHBondContact O-N 2.92Å; L39-N41 PolarHBondContact O-N 2.93Å; N41-V43 VanDerWaalsContact C-N 3.28Å; N41-P44 WeakPolarHBondContact O-CD 3.46Å; N41-P44 WeakPolarHBondContact O-CG 3.35Å; N41-I45 WeakPolarHBondContact O-CD1 3.12Å; N41-I45 WeakPolarHBondContact O-CG1 3.41Å
42	I	86.3	Confident	85	Confident	110 Å²	110	85.7 Å²	85.7	56%	0.564	47%	0.472	S	S	*	.	H	α-helix	trans	-67.4	-32.8	172.5	-61.6	172.2	0	0	0	110.8	L39 A40 I45 A46	L39-I42 PolarHBondContact O-N 3.43Å; A40-I42 PolarHBondContact O-N 3.24Å; I42-I45 PolarHBondContact O-N 3.39Å; I42-A46 WeakPolarHBondContact O-CB 3.39Å; I42-A46 PolarHBondContact O-N 3.11Å
43	V	86.8	Confident	85.2	Confident	90 Å²	90	88.1 Å²	88.1	55%	0.545	49%	0.489	S	S	.	.	H	α-helix	trans	-62	-53.3	-177.7	-178.9	0	0	0	0	112.9	A40 N41 I45 A46 M47	A40-V43 WeakPolarHBondContact O-CB 3.46Å; A40-V43 PolarHBondContact O-N 3.34Å; A40-V43 VanDerWaalsContact O-N 3.09Å; N41-V43 VanDerWaalsContact C-N 3.28Å; V43-I45 VanDerWaalsContact C-N 3.27Å; V43-I45 PolarHBondContact O-N 3.31Å; V43-A46 PolarHBondContact O-N 3.44Å; V43-M47 HydrophobicContact CG1-CG 4.45Å; V43-M47 WeakPolarHBondContact O-CB 3.45Å; V43-M47 VanDerWaalsContact O-CG 3.28Å; V43-M47 WeakPolarHBondContact O-CG 3.47Å; V43-M47 PolarHBondContact O-N 3.08Å
44	P	87.6	Confident	85.4	Confident	2 Å²	2	89.3 Å²	89.3	1%	0.013	49%	0.492	C	S	.	.	H	α-helix	trans	-64	-31	178.5	23	-32.2	0	0	0	112.7	F25 A28 T29 T32 A40 N41 L48	F25-P44 HydrophobicContact CD2-CB 3.85Å; F25-P44 WeakPolarHBondContact CD2-O 3.46Å; F25-P44 HydrophobicContact CE2-CB 3.76Å; F25-P44 WeakPolarHBondContact CE2-O 3.43Å; A28-P44 HydrophobicContact CB-CB 4.24Å; T29-P44 HydrophobicContact CG2-CB 3.75Å; T29-P44 HydrophobicContact CG2-CG 4.01Å; T32-P44 HydrophobicContact CG2-CG 4.42Å; A40-P44 WeakPolarHBondContact O-CD 3.44Å; N41-P44 WeakPolarHBondContact O-CD 3.46Å; N41-P44 WeakPolarHBondContact O-CG 3.35Å; P44-L48 WeakPolarHBondContact O-CB 3.32Å; P44-L48 PolarHBondContact O-N 3.29Å
45	I	89.2	Confident	85.5	Confident	107 Å²	107	84.6 Å²	84.6	55%	0.549	47%	0.47	S	S	.	.	H	α-helix	trans	-68.6	-48.2	175.6	-61	167.9	0	0	0	110.5	N41 I42 V43 M47 L48 V49	N41-I45 WeakPolarHBondContact O-CD1 3.12Å; N41-I45 WeakPolarHBondContact O-CG1 3.41Å; I42-I45 PolarHBondContact O-N 3.39Å; V43-I45 VanDerWaalsContact C-N 3.27Å; V43-I45 PolarHBondContact O-N 3.31Å; I45-M47 VanDerWaalsContact C-N 3.32Å; I45-M47 PolarHBondContact O-N 2.99Å; I45-L48 PolarHBondContact O-N 2.96Å; I45-L48 VanDerWaalsContact O-N 3.16Å; I45-V49 WeakPolarHBondContact O-CG2 3.37Å; I45-V49 PolarHBondContact O-N 3.47Å; I45-V49 VanDerWaalsContact O-N 3.09Å
46	A	91.1	Very high	85.9	Confident	41 Å²	41	83 Å²	83	34%	0.339	47%	0.466	S	S	.	.	H	α-helix	trans	-60	-43.3	176.8	0	0	0	0	0	111.5	I42 V43 L48 V49 F50	I42-A46 WeakPolarHBondContact O-CB 3.39Å; I42-A46 PolarHBondContact O-N 3.11Å; V43-A46 PolarHBondContact O-N 3.44Å; A46-L48 VanDerWaalsContact C-N 3.31Å; A46-L48 PolarHBondContact O-N 3.17Å; A46-V49 PolarHBondContact O-N 3.39Å; A46-F50 VanDerWaalsContact O-CD2 3.23Å; A46-F50 WeakPolarHBondContact O-CD2 3.47Å; A46-F50 PolarHBondContact O-N 3.03Å; A46-F50 VanDerWaalsContact O-N 3.11Å
47	M	89.8	Confident	86.4	Confident	96 Å²	96	79.2 Å²	79.2	47%	0.473	46%	0.455	S	S	.	.	H	α-helix	trans	-56.7	-42.6	174.1	-75.7	-72	-68.9	0	0	112.3	V43 I45 F50 A51	V43-M47 HydrophobicContact CG1-CG 4.45Å; V43-M47 WeakPolarHBondContact O-CB 3.45Å; V43-M47 VanDerWaalsContact O-CG 3.28Å; V43-M47 WeakPolarHBondContact O-CG 3.47Å; V43-M47 PolarHBondContact O-N 3.08Å; I45-M47 VanDerWaalsContact C-N 3.32Å; I45-M47 PolarHBondContact O-N 2.99Å; M47-F50 PolarHBondContact O-N 3.34Å; M47-A51 WeakPolarHBondContact O-CB 3.14Å; M47-A51 PolarHBondContact O-N 3.09Å
48	L	90.1	Very high	87	Confident	90 Å²	90	78 Å²	78	47%	0.471	45%	0.449	S	S	.	.	H	α-helix	trans	-66.8	-38	179.7	-164.4	152.2	0	0	0	111.9	F25 P44 I45 A46 A51 A52	F25-L48 HydrophobicContact CD1-CD1 4.49Å; F25-L48 HydrophobicContact CD2-CB 4.26Å; F25-L48 HydrophobicContact CD2-CD1 3.81Å; F25-L48 HydrophobicContact CE1-CD1 4.39Å; F25-L48 HydrophobicContact CE2-CB 4.39Å; F25-L48 HydrophobicContact CE2-CD1 3.68Å; F25-L48 HydrophobicContact CG-CD1 4.22Å; F25-L48 HydrophobicContact CZ-CD1 3.99Å; P44-L48 WeakPolarHBondContact O-CB 3.32Å; P44-L48 PolarHBondContact O-N 3.29Å; I45-L48 PolarHBondContact O-N 2.96Å; I45-L48 VanDerWaalsContact O-N 3.16Å; A46-L48 VanDerWaalsContact C-N 3.31Å; A46-L48 PolarHBondContact O-N 3.17Å; L48-A51 WeakPolarHBondContact O-CB 3.43Å; L48-A51 PolarHBondContact O-N 3.16Å; L48-A52 PolarHBondContact O-N 3.09Å
49	V	93.4	Very high	87.5	Confident	84 Å²	84	74.2 Å²	74.2	51%	0.509	43%	0.429	S	S	.	.	H	α-helix	trans	-63.2	-48.1	175.6	176.6	0	0	0	0	110.8	I45 A46 A51 A52 C53	I45-V49 WeakPolarHBondContact O-CG2 3.37Å; I45-V49 PolarHBondContact O-N 3.47Å; I45-V49 VanDerWaalsContact O-N 3.09Å; A46-V49 PolarHBondContact O-N 3.39Å; V49-A51 VanDerWaalsContact C-N 3.31Å; V49-A51 PolarHBondContact O-N 3.06Å; V49-A52 PolarHBondContact O-N 3.16Å; V49-C53 PolarHBondContact O-N 3.21Å; V49-C53 VanDerWaalsContact O-N 3.08Å; V49-C53 PolarHBondContact O-SG 3.41Å
50	F	90.1	Very high	88	Confident	145 Å²	145	70 Å²	70	64%	0.636	42%	0.417	S	S	*	.	H	α-helix	trans	-62.2	-39.2	176.7	-77.4	-68.7	0	0	0	112.3	A46 M47 A52 C53 E54	A46-F50 VanDerWaalsContact O-CD2 3.23Å; A46-F50 WeakPolarHBondContact O-CD2 3.47Å; A46-F50 PolarHBondContact O-N 3.03Å; A46-F50 VanDerWaalsContact O-N 3.11Å; M47-F50 PolarHBondContact O-N 3.34Å; F50-A52 VanDerWaalsContact C-N 3.34Å; F50-A52 PolarHBondContact O-N 3.31Å; F50-C53 WeakPolarHBondContact O-CB 3.3Å; F50-C53 PolarHBondContact O-N 3.47Å; F50-E54 PolarHBondContact O-N 3.17Å
51	A	89.7	Confident	88.2	Confident	18 Å²	18	73.5 Å²	73.5	15%	0.149	43%	0.43	C	S	.	.	H	α-helix	trans	-58.2	-45	175.1	0	0	0	0	0	112.4	M21 M47 L48 V49 C53 E54 A55	M21-A51 HydrophobicContact CB-CB 4.11Å; M21-A51 HydrophobicContact CE-CB 3.3Å; M21-A51 HydrophobicContact CG-CB 4.11Å; M47-A51 WeakPolarHBondContact O-CB 3.14Å; M47-A51 PolarHBondContact O-N 3.09Å; L48-A51 WeakPolarHBondContact O-CB 3.43Å; L48-A51 PolarHBondContact O-N 3.16Å; V49-A51 VanDerWaalsContact C-N 3.31Å; V49-A51 PolarHBondContact O-N 3.06Å; A51-C53 VanDerWaalsContact C-N 3.32Å; A51-C53 PolarHBondContact O-N 3.09Å; A51-E54 PolarHBondContact O-N 3.3Å; A51-A55 WeakPolarHBondContact O-CB 3.44Å; A51-A55 PolarHBondContact O-N 2.98Å
52	A	89.6	Confident	88.4	Confident	57 Å²	57	70.8 Å²	70.8	47%	0.471	42%	0.416	S	S	.	.	H	α-helix	trans	-65.1	-36.7	177.8	0	0	0	0	0	111.9	L48 V49 F50 A55 A56	L48-A52 PolarHBondContact O-N 3.09Å; V49-A52 PolarHBondContact O-N 3.16Å; F50-A52 VanDerWaalsContact C-N 3.34Å; F50-A52 PolarHBondContact O-N 3.31Å; A52-A55 PolarHBondContact O-N 2.9Å; A52-A56 WeakPolarHBondContact O-CB 3.4Å; A52-A56 PolarHBondContact O-N 3.39Å
53	C	90.2	Very high	88.3	Confident	68 Å²	68	69.2 Å²	69.2	46%	0.459	41%	0.411	S	S	.	.	H	α-helix	trans	-64	-45.4	174.6	-64.7	0	0	0	0	112.1	V49 F50 A51 A56 V57	V49-C53 PolarHBondContact O-N 3.21Å; V49-C53 VanDerWaalsContact O-N 3.08Å; V49-C53 PolarHBondContact O-SG 3.41Å; F50-C53 WeakPolarHBondContact O-CB 3.3Å; F50-C53 PolarHBondContact O-N 3.47Å; A51-C53 VanDerWaalsContact C-N 3.32Å; A51-C53 PolarHBondContact O-N 3.09Å; C53-A56 PolarHBondContact O-N 3.21Å; C53-V57 WeakPolarHBondContact O-CG2 3.41Å; C53-V57 PolarHBondContact O-N 3.37Å
54	E	87.7	Confident	88.1	Confident	135 Å²	135	67.5 Å²	67.5	63%	0.631	40%	0.403	S	S	*	.	H	α-helix	trans	-62.7	-42.3	176.5	-70.8	-173.9	168.6	0	0	111.9	F50 A51 A56 V57 G58	F50-E54 PolarHBondContact O-N 3.17Å; A51-E54 PolarHBondContact O-N 3.3Å; E54-A56 PolarHBondContact O-N 3.41Å; E54-V57 PolarHBondContact O-N 3Å; E54-G58 PolarHBondContact O-N 3.27Å
55	A	88	Confident	87.6	Confident	22 Å²	22	68.7 Å²	68.7	18%	0.182	41%	0.409	C	S	.	.	H	α-helix	trans	-62.1	-42.5	175.9	0	0	0	0	0	112	A51 A52 V57 G58 L59	A51-A55 WeakPolarHBondContact O-CB 3.44Å; A51-A55 PolarHBondContact O-N 2.98Å; A52-A55 PolarHBondContact O-N 2.9Å; A55-V57 PolarHBondContact O-N 3.03Å; A55-G58 PolarHBondContact O-N 3.46Å; A55-L59 WeakPolarHBondContact O-CB 3.5Å; A55-L59 WeakPolarHBondContact O-CG 3.42Å; A55-L59 PolarHBondContact O-N 3.2Å
56	A	89.5	Confident	87.1	Confident	59 Å²	59	65.2 Å²	65.2	49%	0.488	39%	0.394	S	S	.	.	H	α-helix	trans	-62.1	-43.5	176.8	0	0	0	0	0	112.2	A52 C53 E54 L59 A60	A52-A56 WeakPolarHBondContact O-CB 3.4Å; A52-A56 PolarHBondContact O-N 3.39Å; C53-A56 PolarHBondContact O-N 3.21Å; E54-A56 PolarHBondContact O-N 3.41Å; A56-L59 PolarHBondContact O-N 3.06Å; A56-A60 WeakPolarHBondContact O-CB 3.34Å; A56-A60 PolarHBondContact O-N 2.97Å
57	V	88.7	Confident	86.5	Confident	93 Å²	93	69.4 Å²	69.4	56%	0.564	41%	0.411	S	S	*	.	H	α-helix	trans	-65.8	-41.5	175.3	175.6	0	0	0	0	111	C53 E54 A55 L59 A60 L61	C53-V57 WeakPolarHBondContact O-CG2 3.41Å; C53-V57 PolarHBondContact O-N 3.37Å; E54-V57 PolarHBondContact O-N 3Å; A55-V57 PolarHBondContact O-N 3.03Å; V57-L59 PolarHBondContact O-N 3.37Å; V57-A60 PolarHBondContact O-N 3.47Å; V57-L61 HydrophobicContact CG1-CD1 4.38Å; V57-L61 WeakPolarHBondContact O-CG 3.4Å; V57-L61 PolarHBondContact O-N 3.08Å
58	G	87.3	Confident	85.9	Confident	18 Å²	18	69.6 Å²	69.6	19%	0.186	42%	0.418	C	S	.	.	H	α-helix	trans	-60.8	-42.3	176.4	0	0	0	0	0	113.1	E54 A55 L61 L62	E54-G58 PolarHBondContact O-N 3.27Å; A55-G58 PolarHBondContact O-N 3.46Å; G58-L61 PolarHBondContact O-N 3.39Å; G58-L62 PolarHBondContact O-N 2.7Å
59	L	85.8	Confident	84.9	Confident	77 Å²	77	68.8 Å²	68.8	40%	0.403	41%	0.409	S	S	.	.	H	α-helix	trans	-66.4	-42.2	174.2	-75.9	161.9	0	0	0	112	L14 A55 A56 V57 L61 L62 V63	L14-L59 HydrophobicContact CD1-CD2 4.05Å; L14-L59 HydrophobicContact CD1-CG 4.34Å; A55-L59 WeakPolarHBondContact O-CB 3.5Å; A55-L59 WeakPolarHBondContact O-CG 3.42Å; A55-L59 PolarHBondContact O-N 3.2Å; A56-L59 PolarHBondContact O-N 3.06Å; V57-L59 PolarHBondContact O-N 3.37Å; L59-L61 VanDerWaalsContact C-N 3.31Å; L59-L61 PolarHBondContact O-N 3.03Å; L59-L62 WeakPolarHBondContact O-CB 3.48Å; L59-L62 PolarHBondContact O-N 2.86Å; L59-L62 VanDerWaalsContact O-N 3.16Å; L59-V63 WeakPolarHBondContact O-CG2 3.43Å; L59-V63 PolarHBondContact O-N 3.12Å
60	A	88	Confident	83.6	Confident	62 Å²	62	67.7 Å²	67.7	51%	0.512	41%	0.414	S	S	.	.	H	α-helix	trans	-60.5	-41.1	176.3	0	0	0	0	0	111.9	A56 V57 V63 S64	A56-A60 WeakPolarHBondContact O-CB 3.34Å; A56-A60 PolarHBondContact O-N 2.97Å; V57-A60 PolarHBondContact O-N 3.47Å; A60-V63 PolarHBondContact O-N 3.29Å; A60-S64 PolarHBondContact O-N 3.42Å
61	L	84.2	Confident	82.2	Confident	101 Å²	101	65.6 Å²	65.6	53%	0.529	41%	0.409	S	S	.	.	H	α-helix	trans	-63.4	-43.1	173.3	-75	171.6	0	0	0	111.8	V57 G58 L59 V63 S64 I65	V57-L61 HydrophobicContact CG1-CD1 4.38Å; V57-L61 WeakPolarHBondContact O-CG 3.4Å; V57-L61 PolarHBondContact O-N 3.08Å; G58-L61 PolarHBondContact O-N 3.39Å; L59-L61 VanDerWaalsContact C-N 3.31Å; L59-L61 PolarHBondContact O-N 3.03Å; L61-V63 VanDerWaalsContact C-N 3.32Å; L61-V63 PolarHBondContact O-N 2.92Å; L61-S64 PolarHBondContact O-N 3.44Å; L61-S64 VanDerWaalsContact O-N 3.09Å; L61-S64 PolarHBondContact O-OG 3.37Å; L61-I65 WeakPolarHBondContact O-CG1 3.48Å; L61-I65 PolarHBondContact O-N 2.96Å
62	L	83.2	Confident	80.9	Confident	11 Å²	11	67.2 Å²	67.2	6%	0.058	42%	0.416	C	S	.	.	H	α-helix	trans	-59.4	-44.4	177.1	-165.5	158.4	0	0	0	111.4	L10 M11 L14 G58 L59 S64 I65 S66	L10-L62 HydrophobicContact CB-CD1 3.92Å; L10-L62 HydrophobicContact CB-CG 4.37Å; L10-L62 HydrophobicContact CD2-CB 4.27Å; L10-L62 HydrophobicContact CD2-CD1 3.73Å; L10-L62 HydrophobicContact CD2-CG 4.14Å; L10-L62 HydrophobicContact CG-CD1 4.42Å; M11-L62 HydrophobicContact CB-CD1 4.49Å; M11-L62 HydrophobicContact CG-CD1 3.75Å; M11-L62 HydrophobicContact CG-CD2 4.45Å; M11-L62 HydrophobicContact SD-CD1 3.32Å; M11-L62 WeakPolarHBondContact SD-CD1 3.19Å; M11-L62 HydrophobicContact SD-CD2 4.01Å; M11-L62 HydrophobicContact SD-CG 4.34Å; L14-L62 HydrophobicContact CD1-CB 4.37Å; L14-L62 HydrophobicContact CD1-CD1 3.46Å; L14-L62 VanDerWaalsContact CD1-CD1 3.46Å; G58-L62 PolarHBondContact O-N 2.7Å; L59-L62 WeakPolarHBondContact O-CB 3.48Å; L59-L62 PolarHBondContact O-N 2.86Å; L59-L62 VanDerWaalsContact O-N 3.16Å; L62-S64 VanDerWaalsContact C-N 3.3Å; L62-S64 PolarHBondContact O-N 3.47Å; L62-I65 PolarHBondContact O-N 3.44Å; L62-S66 PolarHBondContact O-N 3.21Å; L62-S66 PolarHBondContact O-OG 3.2Å
63	V	84.2	Confident	79.5	Confident	78 Å²	78	69.2 Å²	69.2	47%	0.473	41%	0.412	S	S	.	.	H	α-helix	trans	-61.4	-37.8	175	174.4	0	0	0	0	111.7	L59 A60 L61 S66 N67	L59-V63 WeakPolarHBondContact O-CG2 3.43Å; L59-V63 PolarHBondContact O-N 3.12Å; A60-V63 PolarHBondContact O-N 3.29Å; L61-V63 VanDerWaalsContact C-N 3.32Å; L61-V63 PolarHBondContact O-N 2.92Å; V63-S66 WeakPolarHBondContact CA-OG 3.41Å; V63-S66 PolarHBondContact O-OG 3.44Å; V63-N67 WeakPolarHBondContact O-CB 3.47Å; V63-N67 VanDerWaalsContact O-CG 3.25Å; V63-N67 PolarHBondContact O-N 3.07Å; V63-N67 PolarHBondContact O-ND2 3.4Å; V63-N67 VanDerWaalsContact O-ND2 3.08Å
64	S	82.1	Confident	78	Confident	53 Å²	53	68.5 Å²	68.5	37%	0.371	41%	0.405	S	S	.	.	H	α-helix	trans	-65.7	-41	175.7	74.7	0	0	0	0	112.3	A60 L61 L62 N67 T68	A60-S64 PolarHBondContact O-N 3.42Å; L61-S64 PolarHBondContact O-N 3.44Å; L61-S64 VanDerWaalsContact O-N 3.09Å; L61-S64 PolarHBondContact O-OG 3.37Å; L62-S64 VanDerWaalsContact C-N 3.3Å; L62-S64 PolarHBondContact O-N 3.47Å; S64-N67 PolarHBondContact O-N 3.33Å; S64-T68 WeakPolarHBondContact O-CG2 3.32Å; S64-T68 PolarHBondContact O-N 2.93Å; S64-T68 PolarHBondContact O-OG1 2.98Å
65	I	77.3	Confident	76.6	Confident	28 Å²	28	69.6 Å²	69.6	14%	0.144	41%	0.41	C	S	.	.	H	α-helix	trans	-67.9	-42	178.7	-66	164.7	0	0	0	110.6	L10 L61 L62 N67 T68 Y69 L77	L10-I65 HydrophobicContact CD1-CD1 4Å; L61-I65 WeakPolarHBondContact O-CG1 3.48Å; L61-I65 PolarHBondContact O-N 2.96Å; L62-I65 PolarHBondContact O-N 3.44Å; I65-N67 VanDerWaalsContact C-N 3.32Å; I65-N67 PolarHBondContact O-N 3Å; I65-T68 PolarHBondContact O-N 3.48Å; I65-T68 PolarHBondContact O-OG1 2.91Å; I65-T68 VanDerWaalsContact O-OG1 3.13Å; I65-Y69 HydrophobicContact CG2-CD2 4.04Å; I65-Y69 PolarHBondContact O-N 2.94Å; I65-L77 HydrophobicContact CD1-CD1 4.41Å
66	S	78.5	Confident	75.1	Confident	33 Å²	33	72.2 Å²	72.2	23%	0.231	42%	0.421	C	S	.	.	H	α-helix	trans	-66.1	-35.9	177.7	71	0	0	0	0	111.6	L62 V63 G70 D72	L62-S66 PolarHBondContact O-N 3.21Å; L62-S66 PolarHBondContact O-OG 3.2Å; V63-S66 WeakPolarHBondContact CA-OG 3.41Å; V63-S66 PolarHBondContact O-OG 3.44Å; S66-G70 WeakPolarHBondContact O-CA 3.42Å; S66-G70 PolarHBondContact O-N 3.01Å; S66-D72 VanDerWaalsContact CB-OD1 3.3Å; S66-D72 WeakPolarHBondContact CB-OD1 3.32Å
67	N	80.3	Confident	73.6	Confident	129 Å²	129	72.4 Å²	72.4	69%	0.69	41%	0.413	S	S	*	.	H	α-helix	trans	-68.5	-35.3	173.5	-76	-33	0	0	0	113.4	V63 S64 I65	V63-N67 WeakPolarHBondContact O-CB 3.47Å; V63-N67 VanDerWaalsContact O-CG 3.25Å; V63-N67 PolarHBondContact O-N 3.07Å; V63-N67 PolarHBondContact O-ND2 3.4Å; V63-N67 VanDerWaalsContact O-ND2 3.08Å; S64-N67 PolarHBondContact O-N 3.33Å; I65-N67 VanDerWaalsContact C-N 3.32Å; I65-N67 PolarHBondContact O-N 3Å
68	T	75.9	Confident	72.2	Confident	100 Å²	100	72.4 Å²	72.4	61%	0.613	41%	0.41	S	S	*	.	H	α-helix	trans	-83.2	-34.4	-179.2	54.1	0	0	0	0	113.6	S64 I65	S64-T68 WeakPolarHBondContact O-CG2 3.32Å; S64-T68 PolarHBondContact O-N 2.93Å; S64-T68 PolarHBondContact O-OG1 2.98Å; I65-T68 PolarHBondContact O-N 3.48Å; I65-T68 PolarHBondContact O-OG1 2.91Å; I65-T68 VanDerWaalsContact O-OG1 3.13Å
69	Y	70.3	Confident	70.9	Confident	73 Å²	73	77.5 Å²	77.5	29%	0.286	43%	0.432	S	S	.	.	H	α-helix	trans	-112.4	-4.9	-173.4	-65.7	-75.1	0	0	0	114.1	I65 L71 N76 L77 L79	I65-Y69 HydrophobicContact CG2-CD2 4.04Å; I65-Y69 PolarHBondContact O-N 2.94Å; Y69-L71 PolarHBondContact O-N 2.9Å; Y69-N76 HydrophobicContact CD1-CB 3.73Å; Y69-N76 HydrophobicContact CE1-CB 4.25Å; Y69-N76 HydrophobicContact CG-CB 3.93Å; Y69-L77 HydrophobicContact CE2-CD2 3.87Å; Y69-L79 HydrophobicContact CE1-CD1 4.09Å; Y69-L79 WeakPolarHBondContact OH-CD1 3.47Å
70	G	65.1	Low	69.7	Low	61 Å²	61	81.1 Å²	81.1	63%	0.629	45%	0.452	S	S	*	.	S	Bend	trans	68.9	-8.9	178.5	0	0	0	0	0	115.3	S66	S66-G70 WeakPolarHBondContact O-CA 3.42Å; S66-G70 PolarHBondContact O-N 3.01Å
71	L	61.7	Low	68.2	Low	101 Å²	101	85.4 Å²	85.4	53%	0.529	46%	0.461	S	S	.	.	S	Bend	trans	-144.9	138.2	-175.7	-65	168.8	0	0	0	110.1	Y69 Y73	Y69-L71 PolarHBondContact O-N 2.9Å; L71-Y73 HydrophobicContact CB-CD2 3.67Å; L71-Y73 HydrophobicContact CB-CE2 4.21Å; L71-Y73 HydrophobicContact CD1-CD2 4.1Å; L71-Y73 HydrophobicContact CD1-CE2 4.23Å; L71-Y73 HydrophobicContact CD2-CE2 4.45Å; L71-Y73 HydrophobicContact CG-CD2 4.38Å; L71-Y73 PolarHBondContact O-N 3.5Å
72	D	61.1	Low	66.9	Low	53 Å²	53	89 Å²	89	28%	0.283	49%	0.493	S	S	.	.			trans	-72	22.8	-177	-60.2	-30.2	0	0	0	114.8	S66	S66-D72 VanDerWaalsContact CB-OD1 3.3Å; S66-D72 WeakPolarHBondContact CB-OD1 3.32Å
73	Y	61.2	Low	66	Low	99 Å²	99	93 Å²	93	39%	0.388	52%	0.515	S	S	.	.	B	Isolated β-bridge	trans	-84.7	119.4	-175.6	-70.7	-62.3	0	0	0	111.7	S8 H9 L71 H75 N76	S8-Y73 WeakPolarHBondContact O-CA 3.44Å; S8-Y73 WeakPolarHBondContact O-CD1 3.42Å; H9-Y73 AromaticContact CE1-CE1 3.87Å; L71-Y73 HydrophobicContact CB-CD2 3.67Å; L71-Y73 HydrophobicContact CB-CE2 4.21Å; L71-Y73 HydrophobicContact CD1-CD2 4.1Å; L71-Y73 HydrophobicContact CD1-CE2 4.23Å; L71-Y73 HydrophobicContact CD2-CE2 4.45Å; L71-Y73 HydrophobicContact CG-CD2 4.38Å; L71-Y73 PolarHBondContact O-N 3.5Å; Y73-H75 PolarHBondContact O-N 3.48Å; Y73-H75 VanDerWaalsContact O-N 3.08Å; Y73-N76 PolarHBondContact O-N 3.02Å
74	V	58.9	Low	65.1	Low	53 Å²	53	93.7 Å²	93.7	32%	0.321	52%	0.517	S	S	.	.	G	3₁₀ helix	trans	-57.1	-24.8	173.9	-171.6	0	0	0	0	112	L10 N76 L77	L10-V74 HydrophobicContact CB-CG2 4.38Å; L10-V74 HydrophobicContact CD1-CG2 4.22Å; L10-V74 HydrophobicContact CG-CG2 4.44Å; V74-N76 VanDerWaalsContact C-N 3.27Å; V74-N76 PolarHBondContact O-N 3.35Å; V74-L77 PolarHBondContact O-N 3.38Å
75	H	56.5	Low	64.1	Low	158 Å²	158	96 Å²	96	73%	0.731	53%	0.525	S	S	*	.	G	3₁₀ helix	trans	-69.2	-19.4	-177.4	-155.9	8.5	0	0	0	114.3	Y73 L77	Y73-H75 PolarHBondContact O-N 3.48Å; Y73-H75 VanDerWaalsContact O-N 3.08Å; H75-L77 VanDerWaalsContact C-N 3.27Å; H75-L77 PolarHBondContact O-N 3.01Å
76	N	56.7	Low	63.4	Low	77 Å²	77	100 Å²	100	41%	0.412	55%	0.547	S	S	.	.	G	3₁₀ helix	trans	-76.4	-10.3	177.9	-98.5	27.3	0	0	0	113.9	Y69 Y73 V74 N78	Y69-N76 HydrophobicContact CD1-CB 3.73Å; Y69-N76 HydrophobicContact CE1-CB 4.25Å; Y69-N76 HydrophobicContact CG-CB 3.93Å; Y73-N76 PolarHBondContact O-N 3.02Å; V74-N76 VanDerWaalsContact C-N 3.27Å; V74-N76 PolarHBondContact O-N 3.35Å; N76-N78 PolarHBondContact O-N 2.98Å; N76-N78 VanDerWaalsContact O-N 3.12Å
77	L	59.1	Low	62.4	Low	62 Å²	62	104.2 Å²	104.2	33%	0.325	57%	0.567	S	S	.	*	G	3₁₀ helix	trans	-80.2	21.5	-179.5	-66.2	167.8	0	0	0	113.7	I65 Y69 V74 H75 L79	I65-L77 HydrophobicContact CD1-CD1 4.41Å; Y69-L77 HydrophobicContact CE2-CD2 3.87Å; V74-L77 PolarHBondContact O-N 3.38Å; H75-L77 VanDerWaalsContact C-N 3.27Å; H75-L77 PolarHBondContact O-N 3.01Å; L77-L79 PolarHBondContact O-N 3.36Å
78	N	59.9	Low	61.2	Low	94 Å²	94	102.5 Å²	102.5	50%	0.503	56%	0.559	S	S	.	*	G	3₁₀ helix	trans	-79.7	4.4	-175.4	-134.1	33.6	0	0	0	114.7	N76 L80 Q81	N76-N78 PolarHBondContact O-N 2.98Å; N76-N78 VanDerWaalsContact O-N 3.12Å; N78-L80 VanDerWaalsContact C-N 3.28Å; N78-L80 PolarHBondContact O-N 3.46Å; N78-Q81 PolarHBondContact ND2-OE1 3.21Å; N78-Q81 PolarHBondContact O-N 3.23Å; N78-Q81 PolarHBondContact OD1-OE1 2.99Å; N78-Q81 VanDerWaalsContact OD1-OE1 3.14Å
79	L	58.8	Low	60.2	Low	124 Å²	124	102.7 Å²	102.7	65%	0.649	56%	0.555	S	S	*	*	G	3₁₀ helix	trans	-71	-19.6	177.4	-82.7	157.3	0	0	0	113.7	Y69 L77 Q81	Y69-L79 HydrophobicContact CE1-CD1 4.09Å; Y69-L79 WeakPolarHBondContact OH-CD1 3.47Å; L77-L79 PolarHBondContact O-N 3.36Å; L79-Q81 VanDerWaalsContact C-N 3.31Å
80	L	59.9	Low	59.4	Low	154 Å²	154	105 Å²	105	81%	0.806	58%	0.576	S	S	*	*	G	3₁₀ helix	trans	-87.1	2.3	177.8	-78.6	153.1	0	0	0	113.4	N78	N78-L80 VanDerWaalsContact C-N 3.28Å; N78-L80 PolarHBondContact O-N 3.46Å
81	Q	57.8	Low	58.9	Low	152 Å²	152	108.7 Å²	108.7	71%	0.71	57%	0.571	S	S	*	*	G	3₁₀ helix	trans	-85.7	5.9	175.5	-152.1	-173.4	-28.1	0	0	112.8	N78 L79	N78-Q81 PolarHBondContact ND2-OE1 3.21Å; N78-Q81 PolarHBondContact O-N 3.23Å; N78-Q81 PolarHBondContact OD1-OE1 2.99Å; N78-Q81 VanDerWaalsContact OD1-OE1 3.14Å; L79-Q81 VanDerWaalsContact C-N 3.31Å
82	C	55.6	Low	58.7	Low	177 Å²	177	109.4 Å²	109.4	100%	1.196	58%	0.575	S	S	*	*			trans	-85.6	0	168.2	-67.7	0	0	0	0	110.5

Retrieved 82 of 82 residues in 54.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).