A0A059R8V1_HUMAN Loading...

NADH-ubiquinone oxidoreductase chain 4L

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Part of the enzyme membrane arm which is embedded in the lipid bilayer and involved in proton translocation.

AlphaFold DB , UniProt , Accession A0A059R8V1, Species HUMAN (Homo sapiens, Human), Gene ND4L, Length 90 aa.

						>A0A059R8V1_HUMAN|A0A059R8V1|ND4L
MLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	78.4	Confident	88.3	Confident	164 Å²	164	78.6 Å²	78.6	81%	0.808	44%	0.44	S	S	*	.				0	-58.9	0	-65.3	-47.6	-136.6	0	0	113	A3 F4 T5 M35	M1-A3 VanDerWaalsContact C-N 3.31Å; M1-A3 PolarHBondContact O-N 3.49Å; M1-F4 WeakPolarHBondContact O-CB 3.43Å; M1-F4 PolarHBondContact O-N 3.21Å; M1-T5 PolarHBondContact O-N 3.18Å; M1-T5 PolarHBondContact O-OG1 3.03Å; M1-M35 HydrophobicContact CE-SD 4.33Å; M1-M35 HydrophobicContact SD-SD 3.97Å
2	L	89.9	Confident	88	Confident	142 Å²	142	80.2 Å²	80.2	74%	0.743	45%	0.445	S	S	*	.	H	α-helix	trans	-55	-44	178.7	-72	168.2	0	0	0	113.3	F4 T5 I6	L2-F4 VanDerWaalsContact C-N 3.34Å; L2-F4 PolarHBondContact O-N 3.26Å; L2-T5 WeakPolarHBondContact CA-OG1 3.41Å; L2-T5 PolarHBondContact O-N 2.94Å; L2-T5 PolarHBondContact O-OG1 3.48Å; L2-I6 WeakPolarHBondContact O-CD1 3.42Å; L2-I6 WeakPolarHBondContact O-CG1 3.42Å; L2-I6 PolarHBondContact O-N 3.29Å
3	A	90.1	Very high	87.6	Confident	63 Å²	63	81.2 Å²	81.2	52%	0.521	45%	0.454	S	S	.	.	H	α-helix	trans	-58.4	-43.6	175.8	0	0	0	0	0	112.7	M1 I6 S7	M1-A3 VanDerWaalsContact C-N 3.31Å; M1-A3 PolarHBondContact O-N 3.49Å; A3-I6 PolarHBondContact O-N 3.21Å; A3-S7 PolarHBondContact O-N 3.23Å; A3-S7 PolarHBondContact O-OG 3.45Å; A3-S7 VanDerWaalsContact O-OG 3.05Å
4	F	91.1	Very high	85.8	Confident	58 Å²	58	88 Å²	88	25%	0.254	47%	0.471	S	S	.	.	H	α-helix	trans	-64.1	-42.5	176.6	-178.3	-95.1	0	0	0	111.9	M1 L2 I6 S7 L8 M28 S31 L32	M1-F4 WeakPolarHBondContact O-CB 3.43Å; M1-F4 PolarHBondContact O-N 3.21Å; L2-F4 VanDerWaalsContact C-N 3.34Å; L2-F4 PolarHBondContact O-N 3.26Å; F4-I6 VanDerWaalsContact C-N 3.32Å; F4-I6 PolarHBondContact O-N 3.24Å; F4-S7 WeakPolarHBondContact CA-OG 3.1Å; F4-S7 PolarHBondContact O-N 3.38Å; F4-S7 PolarHBondContact O-OG 2.65Å; F4-L8 HydrophobicContact CE1-CD1 4.23Å; F4-L8 HydrophobicContact CZ-CD1 4.31Å; F4-L8 VanDerWaalsContact O-CB 3.24Å; F4-L8 WeakPolarHBondContact O-CB 3.49Å; F4-L8 PolarHBondContact O-N 2.84Å; F4-M28 HydrophobicContact CD2-CB 4.18Å; F4-M28 HydrophobicContact CD2-CG 4.25Å; F4-M28 HydrophobicContact CE2-CB 4.02Å; F4-M28 HydrophobicContact CE2-CG 4.15Å; F4-M28 HydrophobicContact CE2-SD 4.36Å; F4-S31 WeakPolarHBondContact CB-OG 3.43Å; F4-S31 WeakPolarHBondContact CD2-OG 3.49Å; F4-L32 HydrophobicContact CD2-CD1 4.48Å; F4-L32 HydrophobicContact CD2-CD2 4.35Å; F4-L32 HydrophobicContact CD2-CG 4.06Å; F4-L32 HydrophobicContact CE2-CD1 3.93Å; F4-L32 HydrophobicContact CE2-CD2 4.27Å; F4-L32 HydrophobicContact CE2-CG 3.98Å
5	T	90.7	Very high	84.3	Confident	63 Å²	63	94.3 Å²	94.3	39%	0.387	49%	0.486	S	S	.	.	H	α-helix	trans	-67.2	-34.3	178.4	50.9	0	0	0	0	112.3	M1 L2 L9	M1-T5 PolarHBondContact O-N 3.18Å; M1-T5 PolarHBondContact O-OG1 3.03Å; L2-T5 WeakPolarHBondContact CA-OG1 3.41Å; L2-T5 PolarHBondContact O-N 2.94Å; L2-T5 PolarHBondContact O-OG1 3.48Å; T5-L9 WeakPolarHBondContact O-CB 3.39Å; T5-L9 WeakPolarHBondContact O-CG 3.41Å; T5-L9 PolarHBondContact O-N 3.06Å
6	I	90.6	Very high	83	Confident	115 Å²	115	92.3 Å²	92.3	59%	0.59	48%	0.483	S	S	*	.	H	α-helix	trans	-70	-43.5	177.6	-66.4	161.4	0	0	0	110.4	L2 A3 F4 L9 G10	L2-I6 WeakPolarHBondContact O-CD1 3.42Å; L2-I6 WeakPolarHBondContact O-CG1 3.42Å; L2-I6 PolarHBondContact O-N 3.29Å; A3-I6 PolarHBondContact O-N 3.21Å; F4-I6 VanDerWaalsContact C-N 3.32Å; F4-I6 PolarHBondContact O-N 3.24Å; I6-L9 PolarHBondContact O-N 3.2Å; I6-G10 PolarHBondContact O-N 3.3Å
7	S	89.1	Confident	82.7	Confident	16 Å²	16	91.4 Å²	91.4	11%	0.112	48%	0.475	C	S	.	.	H	α-helix	trans	-69	-36	176.8	52.6	0	0	0	0	112.5	A3 F4 G10 M11 M28	A3-S7 PolarHBondContact O-N 3.23Å; A3-S7 PolarHBondContact O-OG 3.45Å; A3-S7 VanDerWaalsContact O-OG 3.05Å; F4-S7 WeakPolarHBondContact CA-OG 3.1Å; F4-S7 PolarHBondContact O-N 3.38Å; F4-S7 PolarHBondContact O-OG 2.65Å; S7-G10 PolarHBondContact O-N 3.22Å; S7-M11 PolarHBondContact O-N 2.98Å; S7-M28 WeakPolarHBondContact OG-CG 3.49Å
8	L	89.4	Confident	82.3	Confident	61 Å²	61	88.3 Å²	88.3	32%	0.319	46%	0.459	S	S	.	.	H	α-helix	trans	-60.9	-48.1	171.3	-172.3	100.6	0	0	0	111.5	F4 G10 M11 L12 M28	F4-L8 HydrophobicContact CE1-CD1 4.23Å; F4-L8 HydrophobicContact CZ-CD1 4.31Å; F4-L8 VanDerWaalsContact O-CB 3.24Å; F4-L8 WeakPolarHBondContact O-CB 3.49Å; F4-L8 PolarHBondContact O-N 2.84Å; L8-G10 VanDerWaalsContact C-N 3.3Å; L8-G10 PolarHBondContact O-N 2.99Å; L8-M11 PolarHBondContact O-N 2.85Å; L8-L12 HydrophobicContact CD2-CD1 4.09Å; L8-L12 HydrophobicContact CG-CD1 4.2Å; L8-L12 WeakPolarHBondContact O-CG 3.4Å; L8-L12 PolarHBondContact O-N 2.96Å; L8-M28 HydrophobicContact CB-SD 4.08Å; L8-M28 HydrophobicContact CD1-SD 3.96Å
9	L	88.8	Confident	82.4	Confident	105 Å²	105	87.9 Å²	87.9	55%	0.55	46%	0.456	S	S	.	.	H	α-helix	trans	-61.2	-39.9	175.6	-74.6	168.7	0	0	0	111.5	T5 I6 M11 L12 V13	T5-L9 WeakPolarHBondContact O-CB 3.39Å; T5-L9 WeakPolarHBondContact O-CG 3.41Å; T5-L9 PolarHBondContact O-N 3.06Å; I6-L9 PolarHBondContact O-N 3.2Å; L9-M11 VanDerWaalsContact C-N 3.3Å; L9-M11 PolarHBondContact O-N 3.19Å; L9-L12 PolarHBondContact O-N 3.42Å; L9-V13 WeakPolarHBondContact O-CG2 3.48Å; L9-V13 PolarHBondContact O-N 3.11Å
10	G	87.3	Confident	82.5	Confident	31 Å²	31	85.6 Å²	85.6	32%	0.32	45%	0.448	S	S	.	.	H	α-helix	trans	-61.5	-35.5	175.5	0	0	0	0	0	113.6	I6 S7 L8	I6-G10 PolarHBondContact O-N 3.3Å; S7-G10 PolarHBondContact O-N 3.22Å; L8-G10 VanDerWaalsContact C-N 3.3Å; L8-G10 PolarHBondContact O-N 2.99Å
11	M	85.8	Confident	82.6	Confident	47 Å²	47	82.9 Å²	82.9	23%	0.232	44%	0.436	C	S	.	.	H	α-helix	trans	-74.1	-42.9	175.8	-178.2	-85.6	-71.5	0	0	112.3	S7 L8 L9 V13 C24 M28	S7-M11 PolarHBondContact O-N 2.98Å; L8-M11 PolarHBondContact O-N 2.85Å; L9-M11 VanDerWaalsContact C-N 3.3Å; L9-M11 PolarHBondContact O-N 3.19Å; M11-V13 VanDerWaalsContact C-N 3.29Å; M11-V13 PolarHBondContact O-N 3.42Å; M11-C24 HydrophobicContact CB-CB 4.21Å; M11-M28 HydrophobicContact CB-CE 4.18Å; M11-M28 HydrophobicContact CE-CE 4.17Å; M11-M28 HydrophobicContact CG-CE 4.25Å
12	L	84.6	Confident	83	Confident	97 Å²	97	76.5 Å²	76.5	51%	0.508	41%	0.405	S	S	.	.	H	α-helix	trans	-65.8	-32.4	179	-71	170.5	0	0	0	112.5	L8 L9 Y14	L8-L12 HydrophobicContact CD2-CD1 4.09Å; L8-L12 HydrophobicContact CG-CD1 4.2Å; L8-L12 WeakPolarHBondContact O-CG 3.4Å; L8-L12 PolarHBondContact O-N 2.96Å; L9-L12 PolarHBondContact O-N 3.42Å; L12-Y14 VanDerWaalsContact C-N 3.25Å; L12-Y14 WeakPolarHBondContact O-CD2 3.36Å; L12-Y14 PolarHBondContact O-N 3.44Å
13	V	82.8	Confident	82.9	Confident	93 Å²	93	75 Å²	75	56%	0.564	40%	0.397	S	S	*	.	S	Bend	trans	-78.9	82.1	170.3	-178.7	0	0	0	0	108	L9 M11 R15	L9-V13 WeakPolarHBondContact O-CG2 3.48Å; L9-V13 PolarHBondContact O-N 3.11Å; M11-V13 VanDerWaalsContact C-N 3.29Å; M11-V13 PolarHBondContact O-N 3.42Å; V13-R15 PolarHBondContact O-N 3.25Å
14	Y	63.1	Low	82.9	Confident	177 Å²	177	73.6 Å²	73.6	69%	0.694	38%	0.383	S	S	*	.			trans	-53	99.8	175.7	-73.1	-80.5	0	0	0	110.7	L12	L12-Y14 VanDerWaalsContact C-N 3.25Å; L12-Y14 WeakPolarHBondContact O-CD2 3.36Å; L12-Y14 PolarHBondContact O-N 3.44Å
15	R	63.4	Low	82.7	Confident	183 Å²	183	74.1 Å²	74.1	69%	0.691	39%	0.388	S	S	*	.			trans	-77.8	154.6	166.3	-72.8	-76.1	-163.8	126.4	3.4	108.5	V13 H17	V13-R15 PolarHBondContact O-N 3.25Å; R15-H17 PolarHBondContact O-N 3.01Å
16	S	63.3	Low	82.7	Confident	62 Å²	62	75.8 Å²	75.8	43%	0.434	39%	0.392	S	S	.	.	S	Bend	trans	-53.7	-25	-177.6	54.2	0	0	0	0	114.6	Y81 V82	S16-Y81 WeakPolarHBondContact O-CA 3.5Å; S16-Y81 WeakPolarHBondContact O-CD1 3.21Å; S16-V82 PolarHBondContact O-N 2.92Å
17	H	77	Confident	82.7	Confident	77 Å²	77	71.8 Å²	71.8	36%	0.356	38%	0.379	S	S	.	.	B	Isolated β-bridge	trans	-105.3	121.7	-175.8	-62	-72.3	0	0	0	112.9	R15 M19 S20 Y81	R15-H17 PolarHBondContact O-N 3.01Å; H17-M19 PolarHBondContact O-N 3.17Å; H17-S20 PolarHBondContact O-N 2.98Å; H17-S20 VanDerWaalsContact O-N 3.08Å; H17-S20 PolarHBondContact O-OG 3.05Å; H17-Y81 AromaticContact CE1-CE1 3.39Å; H17-Y81 WeakPolarHBondContact CE1-CE1 3.4Å; H17-Y81 AromaticContact CE1-CZ 3.72Å; H17-Y81 AromaticContact NE2-CE1 3.81Å
18	L	76.9	Confident	82.8	Confident	36 Å²	36	71.8 Å²	71.8	19%	0.188	38%	0.377	C	S	.	.	H	α-helix	trans	-62.4	-29.1	178	-154.3	123	0	0	0	113	S20 S21 L22 L70 I73 D80 V82	L18-S20 VanDerWaalsContact C-N 3.29Å; L18-S20 PolarHBondContact O-N 3.46Å; L18-S21 WeakPolarHBondContact CA-OG 3.45Å; L18-S21 PolarHBondContact O-N 3.12Å; L18-S21 PolarHBondContact O-OG 2.98Å; L18-L22 HydrophobicContact CD2-CD1 4.2Å; L18-L22 HydrophobicContact CD2-CG 4.45Å; L18-L22 PolarHBondContact O-N 3.42Å; L18-L22 VanDerWaalsContact O-N 3.09Å; L18-L70 HydrophobicContact CB-CD1 4.1Å; L18-L70 HydrophobicContact CD2-CB 4.02Å; L18-L70 HydrophobicContact CD2-CD1 3.73Å; L18-L70 HydrophobicContact CD2-CG 4.01Å; L18-I73 HydrophobicContact CD1-CD1 4.27Å; L18-D80 PolarHBondContact N-O 3.06Å; L18-V82 HydrophobicContact CB-CG2 4.33Å; L18-V82 HydrophobicContact CD1-CG2 4.07Å
19	M	83	Confident	83	Confident	81 Å²	81	70.8 Å²	70.8	40%	0.399	37%	0.371	S	S	.	.	H	α-helix	trans	-56.5	-41.6	172.7	-74.1	-60.5	-69.4	0	0	112.5	H17 L22 L23 L67 L70	H17-M19 PolarHBondContact O-N 3.17Å; M19-L22 PolarHBondContact O-N 2.87Å; M19-L23 PolarHBondContact O-N 3.35Å; M19-L23 VanDerWaalsContact O-N 3.1Å; M19-L67 HydrophobicContact SD-CD2 4.41Å; M19-L70 HydrophobicContact CB-CD1 4.46Å; M19-L70 HydrophobicContact CG-CD1 3.67Å; M19-L70 HydrophobicContact SD-CD1 3.23Å; M19-L70 WeakPolarHBondContact SD-CD1 3.47Å; M19-L70 HydrophobicContact SD-CD2 4.15Å; M19-L70 HydrophobicContact SD-CG 4.34Å
20	S	84.6	Confident	83.1	Confident	41 Å²	41	71.1 Å²	71.1	29%	0.287	37%	0.373	S	S	.	.	H	α-helix	trans	-69	-35.5	-178.2	66.4	0	0	0	0	112.2	H17 L18 L23 C24	H17-S20 PolarHBondContact O-N 2.98Å; H17-S20 VanDerWaalsContact O-N 3.08Å; H17-S20 PolarHBondContact O-OG 3.05Å; L18-S20 VanDerWaalsContact C-N 3.29Å; L18-S20 PolarHBondContact O-N 3.46Å; S20-L23 PolarHBondContact O-N 3.49Å; S20-C24 PolarHBondContact O-N 3.38Å; S20-C24 VanDerWaalsContact O-N 3.11Å; S20-C24 PolarHBondContact O-SG 3.36Å; S20-C24 VanDerWaalsContact O-SG 3.38Å
21	S	85.6	Confident	83.4	Confident	28 Å²	28	70.6 Å²	70.6	20%	0.196	36%	0.364	C	S	.	.	H	α-helix	trans	-67.3	-37.9	172.7	45.1	0	0	0	0	112.6	L18 C24 L25	L18-S21 WeakPolarHBondContact CA-OG 3.45Å; L18-S21 PolarHBondContact O-N 3.12Å; L18-S21 PolarHBondContact O-OG 2.98Å; S21-C24 PolarHBondContact O-N 3.01Å; S21-L25 PolarHBondContact O-N 3.39Å
22	L	86.9	Confident	83.7	Confident	31 Å²	31	71 Å²	71	16%	0.162	37%	0.367	C	S	.	.	H	α-helix	trans	-62.9	-43.2	176	-72.6	171.8	0	0	0	111.5	L18 M19 C24 L25 E26 L67 L70	L18-L22 HydrophobicContact CD2-CD1 4.2Å; L18-L22 HydrophobicContact CD2-CG 4.45Å; L18-L22 PolarHBondContact O-N 3.42Å; L18-L22 VanDerWaalsContact O-N 3.09Å; M19-L22 PolarHBondContact O-N 2.87Å; L22-C24 VanDerWaalsContact C-N 3.34Å; L22-C24 PolarHBondContact O-N 3.16Å; L22-L25 WeakPolarHBondContact O-CA 3.33Å; L22-L25 VanDerWaalsContact O-CB 3.32Å; L22-L25 WeakPolarHBondContact O-CB 3.4Å; L22-L25 PolarHBondContact O-N 3.02Å; L22-L25 VanDerWaalsContact O-N 3.08Å; L22-E26 PolarHBondContact O-N 3Å; L22-L67 HydrophobicContact CD1-CD2 4.22Å; L22-L67 HydrophobicContact CD1-CG 4.48Å; L22-L70 HydrophobicContact CD1-CD1 3.66Å
23	L	87.4	Confident	84.1	Confident	109 Å²	109	69.5 Å²	69.5	57%	0.571	36%	0.357	S	S	*	.	H	α-helix	trans	-62.7	-38.2	175	-71.3	171.6	0	0	0	112.6	M19 S20 L25 E26 G27	M19-L23 PolarHBondContact O-N 3.35Å; M19-L23 VanDerWaalsContact O-N 3.1Å; S20-L23 PolarHBondContact O-N 3.49Å; L23-L25 VanDerWaalsContact C-N 3.28Å; L23-L25 PolarHBondContact O-N 2.98Å; L23-E26 PolarHBondContact O-N 3.27Å; L23-G27 PolarHBondContact O-N 3.45Å
24	C	88.9	Confident	84.6	Confident	35 Å²	35	69 Å²	69	24%	0.236	35%	0.35	C	S	.	.	H	α-helix	trans	-63.6	-36	173	-70.4	0	0	0	0	111.9	M11 S20 S21 L22 G27 M28	M11-C24 HydrophobicContact CB-CB 4.21Å; S20-C24 PolarHBondContact O-N 3.38Å; S20-C24 VanDerWaalsContact O-N 3.11Å; S20-C24 PolarHBondContact O-SG 3.36Å; S20-C24 VanDerWaalsContact O-SG 3.38Å; S21-C24 PolarHBondContact O-N 3.01Å; L22-C24 VanDerWaalsContact C-N 3.34Å; L22-C24 PolarHBondContact O-N 3.16Å; C24-G27 PolarHBondContact O-N 2.86Å; C24-M28 PolarHBondContact O-N 3.29Å
25	L	88.3	Confident	85.9	Confident	68 Å²	68	64.1 Å²	64.1	36%	0.356	34%	0.335	S	S	.	.	H	α-helix	trans	-67	-44.9	176.7	-142.6	160.1	0	0	0	111.5	S21 L22 L23 G27 M28 M29	S21-L25 PolarHBondContact O-N 3.39Å; L22-L25 WeakPolarHBondContact O-CA 3.33Å; L22-L25 VanDerWaalsContact O-CB 3.32Å; L22-L25 WeakPolarHBondContact O-CB 3.4Å; L22-L25 PolarHBondContact O-N 3.02Å; L22-L25 VanDerWaalsContact O-N 3.08Å; L23-L25 VanDerWaalsContact C-N 3.28Å; L23-L25 PolarHBondContact O-N 2.98Å; L25-G27 VanDerWaalsContact C-N 3.3Å; L25-G27 PolarHBondContact O-N 3.26Å; L25-M28 HydrophobicContact CB-CE 4.23Å; L25-M28 HydrophobicContact CG-CE 3.87Å; L25-M28 WeakPolarHBondContact O-CB 3.39Å; L25-M28 PolarHBondContact O-N 3.07Å; L25-M28 VanDerWaalsContact O-N 3.14Å; L25-M29 HydrophobicContact CD2-CG 4.28Å; L25-M29 WeakPolarHBondContact O-CG 3.38Å; L25-M29 PolarHBondContact O-N 2.99Å
26	E	89.9	Confident	87.1	Confident	98 Å²	98	56.8 Å²	56.8	46%	0.458	31%	0.313	S	S	.	.	H	α-helix	trans	-58.8	-41.4	171.5	-71	-174.1	165.6	0	0	112	L22 L23 M28 M29 L30	L22-E26 PolarHBondContact O-N 3Å; L23-E26 PolarHBondContact O-N 3.27Å; E26-M28 VanDerWaalsContact C-N 3.35Å; E26-M28 PolarHBondContact O-N 3.49Å; E26-M29 PolarHBondContact O-N 3.38Å; E26-L30 WeakPolarHBondContact O-CB 3.42Å; E26-L30 PolarHBondContact O-N 3Å
27	G	89.9	Confident	88.4	Confident	31 Å²	31	55.2 Å²	55.2	32%	0.32	30%	0.301	S	S	.	.	H	α-helix	trans	-61.5	-38	174.6	0	0	0	0	0	113.6	L23 C24 L25 S31	L23-G27 PolarHBondContact O-N 3.45Å; C24-G27 PolarHBondContact O-N 2.86Å; L25-G27 VanDerWaalsContact C-N 3.3Å; L25-G27 PolarHBondContact O-N 3.26Å; G27-S31 PolarHBondContact O-N 3.42Å; G27-S31 VanDerWaalsContact O-N 3.12Å
28	M	91.6	Very high	89	Confident	16 Å²	16	56 Å²	56	8%	0.079	31%	0.307	C	S	.	.	H	α-helix	trans	-62.5	-49.7	172.5	-74.5	-172.9	-68	0	0	111.1	F4 S7 L8 M11 C24 L25 E26 L30 S31 L32	F4-M28 HydrophobicContact CD2-CB 4.18Å; F4-M28 HydrophobicContact CD2-CG 4.25Å; F4-M28 HydrophobicContact CE2-CB 4.02Å; F4-M28 HydrophobicContact CE2-CG 4.15Å; F4-M28 HydrophobicContact CE2-SD 4.36Å; S7-M28 WeakPolarHBondContact OG-CG 3.49Å; L8-M28 HydrophobicContact CB-SD 4.08Å; L8-M28 HydrophobicContact CD1-SD 3.96Å; M11-M28 HydrophobicContact CB-CE 4.18Å; M11-M28 HydrophobicContact CE-CE 4.17Å; M11-M28 HydrophobicContact CG-CE 4.25Å; C24-M28 PolarHBondContact O-N 3.29Å; L25-M28 HydrophobicContact CB-CE 4.23Å; L25-M28 HydrophobicContact CG-CE 3.87Å; L25-M28 WeakPolarHBondContact O-CB 3.39Å; L25-M28 PolarHBondContact O-N 3.07Å; L25-M28 VanDerWaalsContact O-N 3.14Å; E26-M28 VanDerWaalsContact C-N 3.35Å; E26-M28 PolarHBondContact O-N 3.49Å; M28-L30 VanDerWaalsContact C-N 3.34Å; M28-L30 PolarHBondContact O-N 3.49Å; M28-S31 PolarHBondContact O-N 3.34Å; M28-S31 PolarHBondContact O-OG 2.95Å; M28-L32 PolarHBondContact O-N 2.9Å; M28-L32 VanDerWaalsContact O-N 3.08Å
29	M	93.2	Very high	89.5	Confident	41 Å²	41	59.9 Å²	59.9	20%	0.202	33%	0.326	C	S	.	.	H	α-helix	trans	-62.1	-40.4	-179.1	-63.3	-56.6	-82.4	0	0	112.2	L25 E26 L32 F33 A59	L25-M29 HydrophobicContact CD2-CG 4.28Å; L25-M29 WeakPolarHBondContact O-CG 3.38Å; L25-M29 PolarHBondContact O-N 2.99Å; E26-M29 PolarHBondContact O-N 3.38Å; M29-L32 PolarHBondContact O-N 2.83Å; M29-L32 HydrophobicContact SD-CD1 4.45Å; M29-F33 PolarHBondContact O-N 3.14Å; M29-A59 HydrophobicContact CB-CB 3.95Å; M29-A59 HydrophobicContact CE-CB 3.35Å; M29-A59 HydrophobicContact CG-CB 3.93Å
30	L	92.2	Very high	89.8	Confident	111 Å²	111	56.7 Å²	56.7	58%	0.581	31%	0.311	S	S	*	.	H	α-helix	trans	-65.5	-39.8	176.8	-169.9	134.7	0	0	0	112.1	E26 M28 L32 F33 I34	E26-L30 WeakPolarHBondContact O-CB 3.42Å; E26-L30 PolarHBondContact O-N 3Å; M28-L30 VanDerWaalsContact C-N 3.34Å; M28-L30 PolarHBondContact O-N 3.49Å; L30-L32 VanDerWaalsContact C-N 3.34Å; L30-L32 PolarHBondContact O-N 3.36Å; L30-F33 PolarHBondContact O-N 2.99Å; L30-I34 HydrophobicContact CD2-CD1 3.66Å; L30-I34 HydrophobicContact CD2-CG1 4.5Å; L30-I34 WeakPolarHBondContact O-CG1 3.42Å; L30-I34 PolarHBondContact O-N 3.43Å
31	S	93.5	Very high	89.9	Confident	20 Å²	20	60 Å²	60	14%	0.14	33%	0.325	C	S	.	.	H	α-helix	trans	-66.3	-35	176.5	75.6	0	0	0	0	113	F4 G27 M28 M35	F4-S31 WeakPolarHBondContact CB-OG 3.43Å; F4-S31 WeakPolarHBondContact CD2-OG 3.49Å; G27-S31 PolarHBondContact O-N 3.42Å; G27-S31 VanDerWaalsContact O-N 3.12Å; M28-S31 PolarHBondContact O-N 3.34Å; M28-S31 PolarHBondContact O-OG 2.95Å; S31-M35 PolarHBondContact O-N 2.99Å; S31-M35 VanDerWaalsContact O-N 3.14Å
32	L	91.1	Very high	90	Very high	56 Å²	56	64.6 Å²	64.6	29%	0.293	35%	0.347	S	S	.	.	H	α-helix	trans	-68.2	-40.9	173.2	-75.1	170.5	0	0	0	111.5	F4 M28 M29 L30 M35 A36	F4-L32 HydrophobicContact CD2-CD1 4.48Å; F4-L32 HydrophobicContact CD2-CD2 4.35Å; F4-L32 HydrophobicContact CD2-CG 4.06Å; F4-L32 HydrophobicContact CE2-CD1 3.93Å; F4-L32 HydrophobicContact CE2-CD2 4.27Å; F4-L32 HydrophobicContact CE2-CG 3.98Å; M28-L32 PolarHBondContact O-N 2.9Å; M28-L32 VanDerWaalsContact O-N 3.08Å; M29-L32 PolarHBondContact O-N 2.83Å; M29-L32 HydrophobicContact SD-CD1 4.45Å; L30-L32 VanDerWaalsContact C-N 3.34Å; L30-L32 PolarHBondContact O-N 3.36Å; L32-M35 HydrophobicContact CD2-CE 4.35Å; L32-M35 PolarHBondContact O-N 3.25Å; L32-A36 WeakPolarHBondContact O-CB 3.23Å; L32-A36 PolarHBondContact O-N 3.48Å
33	F	93.1	Very high	89.9	Confident	66 Å²	66	67.5 Å²	67.5	29%	0.289	37%	0.366	S	S	.	.	H	α-helix	trans	-60.1	-47.6	175.5	176.2	-99.9	0	0	0	112	M29 L30 M35 A36 T37 P52 L56	M29-F33 PolarHBondContact O-N 3.14Å; L30-F33 PolarHBondContact O-N 2.99Å; F33-M35 VanDerWaalsContact C-N 3.32Å; F33-M35 PolarHBondContact O-N 3.42Å; F33-A36 PolarHBondContact O-N 2.98Å; F33-T37 HydrophobicContact CD1-CG2 4.35Å; F33-T37 HydrophobicContact CD2-CG2 4.21Å; F33-T37 HydrophobicContact CE1-CG2 3.92Å; F33-T37 HydrophobicContact CE2-CG2 3.78Å; F33-T37 HydrophobicContact CG-CG2 4.49Å; F33-T37 HydrophobicContact CZ-CG2 3.62Å; F33-T37 WeakPolarHBondContact O-CB 3.41Å; F33-T37 WeakPolarHBondContact O-CG2 3.44Å; F33-T37 PolarHBondContact O-N 3.49Å; F33-T37 PolarHBondContact O-OG1 3.33Å; F33-P52 HydrophobicContact CD2-CB 3.72Å; F33-P52 WeakPolarHBondContact CD2-O 3.4Å; F33-P52 HydrophobicContact CE2-CB 3.57Å; F33-L56 HydrophobicContact CD2-CB 4.45Å; F33-L56 HydrophobicContact CD2-CD1 3.85Å; F33-L56 HydrophobicContact CE1-CD1 4.44Å; F33-L56 HydrophobicContact CE2-CD1 3.74Å; F33-L56 HydrophobicContact CG-CD1 4.25Å; F33-L56 HydrophobicContact CZ-CD1 4.05Å
34	I	92.9	Very high	89.5	Confident	83 Å²	83	70.5 Å²	70.5	43%	0.426	38%	0.377	S	S	.	.	H	α-helix	trans	-61.3	-42.3	177.5	-66.6	169.9	0	0	0	110.8	L30 T37 L38	L30-I34 HydrophobicContact CD2-CD1 3.66Å; L30-I34 HydrophobicContact CD2-CG1 4.5Å; L30-I34 WeakPolarHBondContact O-CG1 3.42Å; L30-I34 PolarHBondContact O-N 3.43Å; I34-T37 WeakPolarHBondContact CA-OG1 3.47Å; I34-T37 PolarHBondContact O-OG1 3.18Å; I34-L38 HydrophobicContact CG2-CD1 3.86Å; I34-L38 HydrophobicContact CG2-CG 4.43Å; I34-L38 WeakPolarHBondContact O-CB 3.45Å; I34-L38 VanDerWaalsContact O-CG 3.27Å; I34-L38 WeakPolarHBondContact O-CG 3.41Å; I34-L38 PolarHBondContact O-N 3.48Å
35	M	91.2	Very high	89	Confident	74 Å²	74	70.8 Å²	70.8	37%	0.365	38%	0.38	S	S	.	.	H	α-helix	trans	-64.7	-45.4	178	-169.6	-175.7	73.8	0	0	111.8	M1 S31 L32 F33 L38 M39	M1-M35 HydrophobicContact CE-SD 4.33Å; M1-M35 HydrophobicContact SD-SD 3.97Å; S31-M35 PolarHBondContact O-N 2.99Å; S31-M35 VanDerWaalsContact O-N 3.14Å; L32-M35 HydrophobicContact CD2-CE 4.35Å; L32-M35 PolarHBondContact O-N 3.25Å; F33-M35 VanDerWaalsContact C-N 3.32Å; F33-M35 PolarHBondContact O-N 3.42Å; M35-L38 PolarHBondContact O-N 2.94Å; M35-M39 VanDerWaalsContact O-CG 3.3Å; M35-M39 WeakPolarHBondContact O-CG 3.32Å; M35-M39 PolarHBondContact O-N 3.08Å
36	A	89.1	Confident	88.4	Confident	28 Å²	28	75 Å²	75	23%	0.231	40%	0.402	C	S	.	.	H	α-helix	trans	-62.9	-46	-179.9	0	0	0	0	0	111.3	L32 F33 M39 T40 P52	L32-A36 WeakPolarHBondContact O-CB 3.23Å; L32-A36 PolarHBondContact O-N 3.48Å; F33-A36 PolarHBondContact O-N 2.98Å; A36-M39 PolarHBondContact O-N 3.44Å; A36-T40 WeakPolarHBondContact O-CG2 3.47Å; A36-T40 PolarHBondContact O-N 3.09Å; A36-P52 HydrophobicContact CB-CB 4.39Å; A36-P52 HydrophobicContact CB-CG 3.99Å
37	T	89.9	Confident	87.9	Confident	29 Å²	29	77.6 Å²	77.6	18%	0.178	42%	0.418	C	S	.	.	H	α-helix	trans	-63.2	-40.9	177.1	50.2	0	0	0	0	112.9	F33 I34 M39 T40 L41 P52	F33-T37 HydrophobicContact CD1-CG2 4.35Å; F33-T37 HydrophobicContact CD2-CG2 4.21Å; F33-T37 HydrophobicContact CE1-CG2 3.92Å; F33-T37 HydrophobicContact CE2-CG2 3.78Å; F33-T37 HydrophobicContact CG-CG2 4.49Å; F33-T37 HydrophobicContact CZ-CG2 3.62Å; F33-T37 WeakPolarHBondContact O-CB 3.41Å; F33-T37 WeakPolarHBondContact O-CG2 3.44Å; F33-T37 PolarHBondContact O-N 3.49Å; F33-T37 PolarHBondContact O-OG1 3.33Å; I34-T37 WeakPolarHBondContact CA-OG1 3.47Å; I34-T37 PolarHBondContact O-OG1 3.18Å; T37-M39 VanDerWaalsContact C-N 3.3Å; T37-M39 PolarHBondContact O-N 3.48Å; T37-T40 PolarHBondContact O-N 2.68Å; T37-T40 PolarHBondContact O-OG1 3.28Å; T37-L41 WeakPolarHBondContact O-CB 3.4Å; T37-L41 WeakPolarHBondContact O-CD1 3.46Å; T37-L41 WeakPolarHBondContact O-CG 3.22Å; T37-L41 PolarHBondContact O-N 3.11Å; T37-P52 HydrophobicContact CG2-CB 3.65Å; T37-P52 HydrophobicContact CG2-CG 3.9Å
38	L	90.4	Very high	87.6	Confident	95 Å²	95	77.5 Å²	77.5	50%	0.497	41%	0.414	S	S	.	.	H	α-helix	trans	-63.1	-37.6	174.5	-73.9	169.8	0	0	0	111.9	I34 M35 N42	I34-L38 HydrophobicContact CG2-CD1 3.86Å; I34-L38 HydrophobicContact CG2-CG 4.43Å; I34-L38 WeakPolarHBondContact O-CB 3.45Å; I34-L38 VanDerWaalsContact O-CG 3.27Å; I34-L38 WeakPolarHBondContact O-CG 3.41Å; I34-L38 PolarHBondContact O-N 3.48Å; M35-L38 PolarHBondContact O-N 2.94Å; L38-N42 WeakPolarHBondContact O-CB 3.24Å; L38-N42 PolarHBondContact O-N 3.36Å; L38-N42 PolarHBondContact O-ND2 2.69Å
39	M	87.9	Confident	87.1	Confident	117 Å²	117	80 Å²	80	58%	0.576	43%	0.428	S	S	*	.	H	α-helix	trans	-68.6	-40	176.3	-70.3	-61.8	-166.2	0	0	112.7	M35 A36 T37 N42 T43	M35-M39 VanDerWaalsContact O-CG 3.3Å; M35-M39 WeakPolarHBondContact O-CG 3.32Å; M35-M39 PolarHBondContact O-N 3.08Å; A36-M39 PolarHBondContact O-N 3.44Å; T37-M39 VanDerWaalsContact C-N 3.3Å; T37-M39 PolarHBondContact O-N 3.48Å; M39-N42 PolarHBondContact O-N 3.1Å; M39-T43 WeakPolarHBondContact O-CG2 3.21Å; M39-T43 PolarHBondContact O-N 3.29Å; M39-T43 VanDerWaalsContact O-N 3.12Å; M39-T43 PolarHBondContact O-OG1 3.09Å
40	T	87.7	Confident	86.8	Confident	14 Å²	14	83.3 Å²	83.3	9%	0.086	45%	0.445	C	S	.	.	H	α-helix	trans	-66.5	-40.1	176.5	62.5	0	0	0	0	111.5	A36 T37 T43 H44 S45 A48 N49 P52	A36-T40 WeakPolarHBondContact O-CG2 3.47Å; A36-T40 PolarHBondContact O-N 3.09Å; T37-T40 PolarHBondContact O-N 2.68Å; T37-T40 PolarHBondContact O-OG1 3.28Å; T40-T43 PolarHBondContact O-N 3.27Å; T40-T43 PolarHBondContact O-OG1 3.25Å; T40-H44 PolarHBondContact O-N 3.01Å; T40-S45 PolarHBondContact O-N 3.41Å; T40-A48 HydrophobicContact CG2-CB 3.69Å; T40-N49 PolarHBondContact OG1-OD1 2.98Å; T40-N49 VanDerWaalsContact OG1-OD1 3.06Å; T40-P52 HydrophobicContact CG2-CG 4.15Å
41	L	87.3	Confident	86.6	Confident	110 Å²	110	82.2 Å²	82.2	58%	0.576	44%	0.443	S	S	*	.	H	α-helix	trans	-63.5	-45.4	175.5	-71.4	169	0	0	0	112	T37 T43 H44	T37-L41 WeakPolarHBondContact O-CB 3.4Å; T37-L41 WeakPolarHBondContact O-CD1 3.46Å; T37-L41 WeakPolarHBondContact O-CG 3.22Å; T37-L41 PolarHBondContact O-N 3.11Å; L41-T43 VanDerWaalsContact C-N 3.3Å; L41-T43 PolarHBondContact O-N 3.08Å; L41-H44 PolarHBondContact O-N 3.01Å
42	N	87.2	Confident	86.5	Confident	125 Å²	125	81.4 Å²	81.4	67%	0.668	44%	0.437	S	S	*	.	H	α-helix	trans	-63.7	-33.4	178.4	-84.5	-25.2	0	0	0	113.3	L38 M39 H44	L38-N42 WeakPolarHBondContact O-CB 3.24Å; L38-N42 PolarHBondContact O-N 3.36Å; L38-N42 PolarHBondContact O-ND2 2.69Å; M39-N42 PolarHBondContact O-N 3.1Å; N42-H44 VanDerWaalsContact C-N 3.31Å
43	T	84.4	Confident	86.5	Confident	92 Å²	92	83.7 Å²	83.7	56%	0.564	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.6	1.4	-179.6	54.7	0	0	0	0	113.1	M39 T40 L41 S45	M39-T43 WeakPolarHBondContact O-CG2 3.21Å; M39-T43 PolarHBondContact O-N 3.29Å; M39-T43 VanDerWaalsContact O-N 3.12Å; M39-T43 PolarHBondContact O-OG1 3.09Å; T40-T43 PolarHBondContact O-N 3.27Å; T40-T43 PolarHBondContact O-OG1 3.25Å; L41-T43 VanDerWaalsContact C-N 3.3Å; L41-T43 PolarHBondContact O-N 3.08Å; T43-S45 PolarHBondContact O-N 3.21Å; T43-S45 PolarHBondContact OG1-OG 3.42Å
44	H	80.8	Confident	86.5	Confident	171 Å²	171	82.4 Å²	82.4	79%	0.792	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	47.6	29.9	-175.2	-66.3	-69.6	0	0	0	113.8	T40 L41 N42 L46	T40-H44 PolarHBondContact O-N 3.01Å; L41-H44 PolarHBondContact O-N 3.01Å; N42-H44 VanDerWaalsContact C-N 3.31Å; H44-L46 PolarHBondContact O-N 2.96Å
45	S	77.3	Confident	86.4	Confident	42 Å²	42	82.4 Å²	82.4	29%	0.294	45%	0.449	S	S	.	.			trans	-95.7	91.4	-174.3	57.7	0	0	0	0	110.6	T40 T43 L47 A48	T40-S45 PolarHBondContact O-N 3.41Å; T43-S45 PolarHBondContact O-N 3.21Å; T43-S45 PolarHBondContact OG1-OG 3.42Å; S45-L47 VanDerWaalsContact C-N 3.26Å; S45-L47 PolarHBondContact O-N 3.43Å; S45-A48 WeakPolarHBondContact O-CB 3.33Å; S45-A48 PolarHBondContact O-N 3.05Å; S45-A48 VanDerWaalsContact OG-CB 3.22Å; S45-A48 WeakPolarHBondContact OG-CB 3.27Å
46	L	76	Confident	86.5	Confident	157 Å²	157	83.2 Å²	83.2	82%	0.822	46%	0.455	S	S	*	.	G	3₁₀ helix	trans	-60.3	-33.3	-177.9	-67.5	172.3	0	0	0	113.3	H44 A48 N49	H44-L46 PolarHBondContact O-N 2.96Å; L46-A48 VanDerWaalsContact C-N 3.33Å; L46-A48 PolarHBondContact O-N 3.08Å; L46-N49 WeakPolarHBondContact O-CB 3.39Å; L46-N49 PolarHBondContact O-N 3.27Å
47	L	80.2	Confident	86.8	Confident	151 Å²	151	86 Å²	86	79%	0.791	47%	0.469	S	S	*	.	G	3₁₀ helix	trans	-67.1	-32.1	175.7	-84	156.8	0	0	0	112.8	S45 N49 I50	S45-L47 VanDerWaalsContact C-N 3.26Å; S45-L47 PolarHBondContact O-N 3.43Å; L47-N49 PolarHBondContact O-N 3.41Å; L47-I50 PolarHBondContact O-N 3.44Å
48	A	82.2	Confident	86.9	Confident	30 Å²	30	91.4 Å²	91.4	25%	0.248	49%	0.49	C	S	.	.	G	3₁₀ helix	trans	-70.8	-15.8	179.9	0	0	0	0	0	112.3	T40 S45 L46 I50 V51 P52	T40-A48 HydrophobicContact CG2-CB 3.69Å; S45-A48 WeakPolarHBondContact O-CB 3.33Å; S45-A48 PolarHBondContact O-N 3.05Å; S45-A48 VanDerWaalsContact OG-CB 3.22Å; S45-A48 WeakPolarHBondContact OG-CB 3.27Å; L46-A48 VanDerWaalsContact C-N 3.33Å; L46-A48 PolarHBondContact O-N 3.08Å; A48-I50 PolarHBondContact O-N 2.74Å; A48-I50 VanDerWaalsContact O-N 3.16Å; A48-V51 WeakPolarHBondContact O-CB 3.48Å; A48-V51 PolarHBondContact O-N 3.21Å; A48-P52 WeakPolarHBondContact O-CD 3.38Å
49	N	81.1	Confident	86.9	Confident	69 Å²	69	87.7 Å²	87.7	37%	0.369	47%	0.473	S	S	.	.	G	3₁₀ helix	trans	-66.7	-14.3	179.6	-129	28.6	0	0	0	113.6	T40 L46 L47 V51 P52 I53	T40-N49 PolarHBondContact OG1-OD1 2.98Å; T40-N49 VanDerWaalsContact OG1-OD1 3.06Å; L46-N49 WeakPolarHBondContact O-CB 3.39Å; L46-N49 PolarHBondContact O-N 3.27Å; L47-N49 PolarHBondContact O-N 3.41Å; N49-V51 VanDerWaalsContact C-N 3.28Å; N49-P52 WeakPolarHBondContact O-CD 3.48Å; N49-I53 WeakPolarHBondContact O-CD1 3.43Å; N49-I53 WeakPolarHBondContact O-CG1 3.09Å
50	I	88.1	Confident	87.1	Confident	109 Å²	109	85 Å²	85	56%	0.559	47%	0.469	S	S	*	.	H	α-helix	trans	-67.3	-31.9	171.2	-60	171.8	0	0	0	110.7	L47 A48 I53 A54	L47-I50 PolarHBondContact O-N 3.44Å; A48-I50 PolarHBondContact O-N 2.74Å; A48-I50 VanDerWaalsContact O-N 3.16Å; I50-I53 PolarHBondContact O-N 3.14Å; I50-A54 WeakPolarHBondContact O-CB 3.46Å; I50-A54 PolarHBondContact O-N 3.34Å
51	V	88.3	Confident	87.3	Confident	89 Å²	89	87.6 Å²	87.6	54%	0.539	49%	0.487	S	S	.	.	H	α-helix	trans	-65.8	-50.8	-175	178.2	0	0	0	0	112.3	A48 N49 I53 A54 M55	A48-V51 WeakPolarHBondContact O-CB 3.48Å; A48-V51 PolarHBondContact O-N 3.21Å; N49-V51 VanDerWaalsContact C-N 3.28Å; V51-I53 VanDerWaalsContact C-N 3.26Å; V51-I53 PolarHBondContact O-N 3Å; V51-A54 PolarHBondContact O-N 2.93Å; V51-M55 HydrophobicContact CG1-CG 4.45Å; V51-M55 WeakPolarHBondContact O-CB 3.49Å; V51-M55 VanDerWaalsContact O-CG 3.27Å; V51-M55 WeakPolarHBondContact O-CG 3.42Å; V51-M55 PolarHBondContact O-N 3.34Å
52	P	89.6	Confident	87.5	Confident	2 Å²	2	87.9 Å²	87.9	1%	0.013	49%	0.485	C	S	.	.	H	α-helix	trans	-58.3	-35.8	174.8	-23.4	31.2	0	0	0	113.7	F33 A36 T37 T40 A48 N49 L56	F33-P52 HydrophobicContact CD2-CB 3.72Å; F33-P52 WeakPolarHBondContact CD2-O 3.4Å; F33-P52 HydrophobicContact CE2-CB 3.57Å; A36-P52 HydrophobicContact CB-CB 4.39Å; A36-P52 HydrophobicContact CB-CG 3.99Å; T37-P52 HydrophobicContact CG2-CB 3.65Å; T37-P52 HydrophobicContact CG2-CG 3.9Å; T40-P52 HydrophobicContact CG2-CG 4.15Å; A48-P52 WeakPolarHBondContact O-CD 3.38Å; N49-P52 WeakPolarHBondContact O-CD 3.48Å; P52-L56 PolarHBondContact O-N 3.38Å; P52-L56 VanDerWaalsContact O-N 3.12Å
53	I	91.2	Very high	87.6	Confident	104 Å²	104	82.9 Å²	82.9	53%	0.533	46%	0.461	S	S	.	.	H	α-helix	trans	-69.5	-48.4	179.5	-60.8	169.5	0	0	0	110.2	N49 I50 V51 M55 L56 V57	N49-I53 WeakPolarHBondContact O-CD1 3.43Å; N49-I53 WeakPolarHBondContact O-CG1 3.09Å; I50-I53 PolarHBondContact O-N 3.14Å; V51-I53 VanDerWaalsContact C-N 3.26Å; V51-I53 PolarHBondContact O-N 3Å; I53-M55 VanDerWaalsContact C-N 3.3Å; I53-M55 PolarHBondContact O-N 3.09Å; I53-L56 WeakPolarHBondContact O-CB 3.47Å; I53-L56 PolarHBondContact O-N 3.29Å; I53-L56 VanDerWaalsContact O-N 3.09Å; I53-V57 WeakPolarHBondContact O-CG2 3.46Å; I53-V57 PolarHBondContact O-N 2.91Å; I53-V57 VanDerWaalsContact O-N 3.09Å
54	A	92.8	Very high	88	Confident	39 Å²	39	81.3 Å²	81.3	32%	0.322	46%	0.458	S	S	.	.	H	α-helix	trans	-58.7	-42.7	176.6	0	0	0	0	0	111.6	I50 V51 L56 V57 F58	I50-A54 WeakPolarHBondContact O-CB 3.46Å; I50-A54 PolarHBondContact O-N 3.34Å; V51-A54 PolarHBondContact O-N 2.93Å; A54-L56 VanDerWaalsContact C-N 3.29Å; A54-L56 PolarHBondContact O-N 3.34Å; A54-V57 PolarHBondContact O-N 3.39Å; A54-F58 WeakPolarHBondContact O-CD2 3.42Å; A54-F58 PolarHBondContact O-N 2.97Å; A54-F58 VanDerWaalsContact O-N 3.14Å
55	M	92.3	Very high	88.5	Confident	84 Å²	84	77.5 Å²	77.5	41%	0.414	45%	0.446	S	S	.	.	H	α-helix	trans	-56.8	-41.1	174.1	-75.2	-70.6	-65.7	0	0	112.5	V51 I53 F58 A59	V51-M55 HydrophobicContact CG1-CG 4.45Å; V51-M55 WeakPolarHBondContact O-CB 3.49Å; V51-M55 VanDerWaalsContact O-CG 3.27Å; V51-M55 WeakPolarHBondContact O-CG 3.42Å; V51-M55 PolarHBondContact O-N 3.34Å; I53-M55 VanDerWaalsContact C-N 3.3Å; I53-M55 PolarHBondContact O-N 3.09Å; M55-F58 PolarHBondContact O-N 3.09Å; M55-A59 WeakPolarHBondContact O-CB 3.47Å; M55-A59 PolarHBondContact O-N 2.92Å
56	L	92.2	Very high	89	Confident	91 Å²	91	76.1 Å²	76.1	48%	0.476	44%	0.439	S	S	.	.	H	α-helix	trans	-69	-37.5	-179.8	-150.8	161.3	0	0	0	111.6	F33 P52 I53 A54 A59 A60	F33-L56 HydrophobicContact CD2-CB 4.45Å; F33-L56 HydrophobicContact CD2-CD1 3.85Å; F33-L56 HydrophobicContact CE1-CD1 4.44Å; F33-L56 HydrophobicContact CE2-CD1 3.74Å; F33-L56 HydrophobicContact CG-CD1 4.25Å; F33-L56 HydrophobicContact CZ-CD1 4.05Å; P52-L56 PolarHBondContact O-N 3.38Å; P52-L56 VanDerWaalsContact O-N 3.12Å; I53-L56 WeakPolarHBondContact O-CB 3.47Å; I53-L56 PolarHBondContact O-N 3.29Å; I53-L56 VanDerWaalsContact O-N 3.09Å; A54-L56 VanDerWaalsContact C-N 3.29Å; A54-L56 PolarHBondContact O-N 3.34Å; L56-A59 WeakPolarHBondContact O-CB 3.4Å; L56-A59 PolarHBondContact O-N 3.39Å; L56-A60 PolarHBondContact O-N 3.46Å
57	V	95.1	Very high	89.6	Confident	86 Å²	86	72.4 Å²	72.4	52%	0.521	42%	0.419	S	S	.	.	H	α-helix	trans	-61.6	-48.7	174.9	178.5	0	0	0	0	110.7	I53 A54 A59 A60 C61	I53-V57 WeakPolarHBondContact O-CG2 3.46Å; I53-V57 PolarHBondContact O-N 2.91Å; I53-V57 VanDerWaalsContact O-N 3.09Å; A54-V57 PolarHBondContact O-N 3.39Å; V57-A59 VanDerWaalsContact C-N 3.32Å; V57-A59 PolarHBondContact O-N 2.97Å; V57-A60 PolarHBondContact O-N 2.77Å; V57-C61 PolarHBondContact O-N 3.36Å; V57-C61 VanDerWaalsContact O-N 3.09Å; V57-C61 PolarHBondContact O-SG 3.24Å
58	F	92.4	Very high	90.1	Very high	143 Å²	143	68.2 Å²	68.2	63%	0.627	41%	0.407	S	S	*	.	H	α-helix	trans	-63	-38.7	177.1	-75.3	-67.2	0	0	0	112.3	A54 M55 A60 C61 E62	A54-F58 WeakPolarHBondContact O-CD2 3.42Å; A54-F58 PolarHBondContact O-N 2.97Å; A54-F58 VanDerWaalsContact O-N 3.14Å; M55-F58 PolarHBondContact O-N 3.09Å; F58-A60 VanDerWaalsContact C-N 3.33Å; F58-A60 PolarHBondContact O-N 3.3Å; F58-C61 WeakPolarHBondContact O-CB 3.33Å; F58-C61 PolarHBondContact O-N 3.12Å; F58-E62 PolarHBondContact O-N 2.97Å
59	A	91.9	Very high	90.3	Very high	17 Å²	17	71.6 Å²	71.6	14%	0.14	42%	0.42	C	S	.	.	H	α-helix	trans	-57.5	-45.3	174.5	0	0	0	0	0	112.4	M29 M55 L56 V57 C61 E62 A63	M29-A59 HydrophobicContact CB-CB 3.95Å; M29-A59 HydrophobicContact CE-CB 3.35Å; M29-A59 HydrophobicContact CG-CB 3.93Å; M55-A59 WeakPolarHBondContact O-CB 3.47Å; M55-A59 PolarHBondContact O-N 2.92Å; L56-A59 WeakPolarHBondContact O-CB 3.4Å; L56-A59 PolarHBondContact O-N 3.39Å; V57-A59 VanDerWaalsContact C-N 3.32Å; V57-A59 PolarHBondContact O-N 2.97Å; A59-C61 VanDerWaalsContact C-N 3.32Å; A59-C61 PolarHBondContact O-N 3.44Å; A59-E62 PolarHBondContact O-N 3.03Å; A59-A63 WeakPolarHBondContact O-CB 3.21Å; A59-A63 PolarHBondContact O-N 3.41Å
60	A	91.6	Very high	90.5	Very high	59 Å²	59	68.9 Å²	68.9	49%	0.488	41%	0.405	S	S	.	.	H	α-helix	trans	-65.5	-36.7	178.3	0	0	0	0	0	111.9	L56 V57 F58 A63 A64	L56-A60 PolarHBondContact O-N 3.46Å; V57-A60 PolarHBondContact O-N 2.77Å; F58-A60 VanDerWaalsContact C-N 3.33Å; F58-A60 PolarHBondContact O-N 3.3Å; A60-A63 PolarHBondContact O-N 2.96Å; A60-A64 WeakPolarHBondContact O-CB 3.16Å; A60-A64 PolarHBondContact O-N 3.29Å
61	C	92.4	Very high	90.4	Very high	69 Å²	69	67.5 Å²	67.5	47%	0.466	40%	0.402	S	S	.	.	H	α-helix	trans	-64	-45.6	174.5	-65	0	0	0	0	112	V57 F58 A59 A64 V65	V57-C61 PolarHBondContact O-N 3.36Å; V57-C61 VanDerWaalsContact O-N 3.09Å; V57-C61 PolarHBondContact O-SG 3.24Å; F58-C61 WeakPolarHBondContact O-CB 3.33Å; F58-C61 PolarHBondContact O-N 3.12Å; A59-C61 VanDerWaalsContact C-N 3.32Å; A59-C61 PolarHBondContact O-N 3.44Å; C61-A64 PolarHBondContact O-N 3.05Å; C61-V65 WeakPolarHBondContact O-CG2 3.22Å; C61-V65 PolarHBondContact O-N 3.16Å
62	E	90.1	Very high	90.2	Very high	116 Å²	116	65.8 Å²	65.8	54%	0.542	39%	0.394	S	S	.	.	H	α-helix	trans	-62	-43.1	176.4	-71.4	-178.2	172.9	0	0	111.8	F58 A59 A64 V65 G66	F58-E62 PolarHBondContact O-N 2.97Å; A59-E62 PolarHBondContact O-N 3.03Å; E62-A64 PolarHBondContact O-N 3.44Å; E62-V65 PolarHBondContact O-N 2.89Å; E62-G66 PolarHBondContact O-N 3.45Å
63	A	90.4	Very high	89.9	Confident	20 Å²	20	67 Å²	67	17%	0.165	40%	0.4	C	S	.	.	H	α-helix	trans	-62.6	-41.9	176.4	0	0	0	0	0	112.2	A59 A60 V65 G66 L67	A59-A63 WeakPolarHBondContact O-CB 3.21Å; A59-A63 PolarHBondContact O-N 3.41Å; A60-A63 PolarHBondContact O-N 2.96Å; A63-V65 PolarHBondContact O-N 3Å; A63-G66 PolarHBondContact O-N 3.5Å; A63-L67 WeakPolarHBondContact O-CG 3.48Å; A63-L67 PolarHBondContact O-N 2.88Å
64	A	91.4	Very high	89.4	Confident	59 Å²	59	63.6 Å²	63.6	49%	0.488	39%	0.385	S	S	.	.	H	α-helix	trans	-62.1	-43.2	176.8	0	0	0	0	0	112.2	A60 C61 E62 L67 A68	A60-A64 WeakPolarHBondContact O-CB 3.16Å; A60-A64 PolarHBondContact O-N 3.29Å; C61-A64 PolarHBondContact O-N 3.05Å; E62-A64 PolarHBondContact O-N 3.44Å; A64-L67 PolarHBondContact O-N 3.37Å; A64-A68 WeakPolarHBondContact O-CB 3.36Å; A64-A68 PolarHBondContact O-N 3.31Å
65	V	91.2	Very high	89	Confident	91 Å²	91	67.9 Å²	67.9	55%	0.552	40%	0.403	S	S	*	.	H	α-helix	trans	-66.5	-41.3	175.3	176.2	0	0	0	0	110.8	C61 E62 A63 L67 A68 L69	C61-V65 WeakPolarHBondContact O-CG2 3.22Å; C61-V65 PolarHBondContact O-N 3.16Å; E62-V65 PolarHBondContact O-N 2.89Å; A63-V65 PolarHBondContact O-N 3Å; V65-L67 PolarHBondContact O-N 3.05Å; V65-A68 PolarHBondContact O-N 3.3Å; V65-L69 HydrophobicContact CG1-CD1 4.44Å; V65-L69 WeakPolarHBondContact O-CG 3.46Å; V65-L69 PolarHBondContact O-N 3.47Å
66	G	89.5	Confident	88.3	Confident	13 Å²	13	68.7 Å²	68.7	13%	0.134	41%	0.413	C	S	.	.	H	α-helix	trans	-60	-42.4	176.3	0	0	0	0	0	113.1	E62 A63 L69 L70	E62-G66 PolarHBondContact O-N 3.45Å; A63-G66 PolarHBondContact O-N 3.5Å; G66-L69 PolarHBondContact O-N 3.32Å; G66-L70 PolarHBondContact O-N 3.05Å
67	L	88	Confident	87.4	Confident	79 Å²	79	68.1 Å²	68.1	41%	0.414	41%	0.405	S	S	.	.	H	α-helix	trans	-67	-41.2	174.5	-74.8	163.4	0	0	0	112.2	M19 L22 A63 A64 V65 L69 L70 V71	M19-L67 HydrophobicContact SD-CD2 4.41Å; L22-L67 HydrophobicContact CD1-CD2 4.22Å; L22-L67 HydrophobicContact CD1-CG 4.48Å; A63-L67 WeakPolarHBondContact O-CG 3.48Å; A63-L67 PolarHBondContact O-N 2.88Å; A64-L67 PolarHBondContact O-N 3.37Å; V65-L67 PolarHBondContact O-N 3.05Å; L67-L69 VanDerWaalsContact C-N 3.3Å; L67-L69 PolarHBondContact O-N 3.14Å; L67-L70 WeakPolarHBondContact O-CB 3.46Å; L67-L70 PolarHBondContact O-N 3.05Å; L67-L70 VanDerWaalsContact O-N 3.16Å; L67-V71 WeakPolarHBondContact O-CG2 3.36Å; L67-V71 PolarHBondContact O-N 3.26Å
68	A	89.8	Confident	86.2	Confident	64 Å²	64	66.9 Å²	66.9	53%	0.529	41%	0.409	S	S	.	.	H	α-helix	trans	-60.8	-40.6	175.9	0	0	0	0	0	111.8	A64 V65 V71 S72	A64-A68 WeakPolarHBondContact O-CB 3.36Å; A64-A68 PolarHBondContact O-N 3.31Å; V65-A68 PolarHBondContact O-N 3.3Å; A68-V71 PolarHBondContact O-N 2.95Å; A68-S72 PolarHBondContact O-N 3.32Å; A68-S72 VanDerWaalsContact O-N 3.11Å
69	L	86.1	Confident	85	Confident	100 Å²	100	64.6 Å²	64.6	52%	0.524	40%	0.403	S	S	.	.	H	α-helix	trans	-63.4	-43.1	173	-74.4	172.7	0	0	0	111.7	V65 G66 L67 V71 S72 I73	V65-L69 HydrophobicContact CG1-CD1 4.44Å; V65-L69 WeakPolarHBondContact O-CG 3.46Å; V65-L69 PolarHBondContact O-N 3.47Å; G66-L69 PolarHBondContact O-N 3.32Å; L67-L69 VanDerWaalsContact C-N 3.3Å; L67-L69 PolarHBondContact O-N 3.14Å; L69-V71 VanDerWaalsContact C-N 3.31Å; L69-V71 PolarHBondContact O-N 3.02Å; L69-S72 WeakPolarHBondContact O-CB 3.36Å; L69-S72 PolarHBondContact O-N 2.83Å; L69-S72 PolarHBondContact O-OG 3.22Å; L69-I73 WeakPolarHBondContact O-CG1 3.42Å; L69-I73 PolarHBondContact O-N 2.86Å
70	L	86.1	Confident	83.6	Confident	13 Å²	13	66.3 Å²	66.3	7%	0.068	41%	0.41	C	S	.	.	H	α-helix	trans	-59.1	-43.7	177.4	-166.1	155.6	0	0	0	111.6	L18 M19 L22 G66 L67 S72 I73 S74	L18-L70 HydrophobicContact CB-CD1 4.1Å; L18-L70 HydrophobicContact CD2-CB 4.02Å; L18-L70 HydrophobicContact CD2-CD1 3.73Å; L18-L70 HydrophobicContact CD2-CG 4.01Å; M19-L70 HydrophobicContact CB-CD1 4.46Å; M19-L70 HydrophobicContact CG-CD1 3.67Å; M19-L70 HydrophobicContact SD-CD1 3.23Å; M19-L70 WeakPolarHBondContact SD-CD1 3.47Å; M19-L70 HydrophobicContact SD-CD2 4.15Å; M19-L70 HydrophobicContact SD-CG 4.34Å; L22-L70 HydrophobicContact CD1-CD1 3.66Å; G66-L70 PolarHBondContact O-N 3.05Å; L67-L70 WeakPolarHBondContact O-CB 3.46Å; L67-L70 PolarHBondContact O-N 3.05Å; L67-L70 VanDerWaalsContact O-N 3.16Å; L70-S72 VanDerWaalsContact C-N 3.28Å; L70-S72 PolarHBondContact O-N 3.26Å; L70-I73 PolarHBondContact O-N 3.23Å; L70-I73 VanDerWaalsContact O-N 3.17Å; L70-S74 PolarHBondContact O-N 3.34Å; L70-S74 PolarHBondContact O-OG 3.46Å
71	V	86.8	Confident	82.3	Confident	79 Å²	79	68 Å²	68	48%	0.479	40%	0.404	S	S	.	.	H	α-helix	trans	-61.4	-36.9	174.9	174.7	0	0	0	0	111.7	L67 A68 L69 S74 N75	L67-V71 WeakPolarHBondContact O-CG2 3.36Å; L67-V71 PolarHBondContact O-N 3.26Å; A68-V71 PolarHBondContact O-N 2.95Å; L69-V71 VanDerWaalsContact C-N 3.31Å; L69-V71 PolarHBondContact O-N 3.02Å; V71-S74 WeakPolarHBondContact CA-OG 3.46Å; V71-S74 PolarHBondContact O-OG 2.87Å; V71-N75 WeakPolarHBondContact O-CB 3.48Å; V71-N75 PolarHBondContact O-N 2.99Å; V71-N75 PolarHBondContact O-ND2 3.12Å; V71-N75 VanDerWaalsContact O-ND2 3.12Å
72	S	84.3	Confident	80.8	Confident	53 Å²	53	67 Å²	67	37%	0.371	40%	0.396	S	S	.	.	H	α-helix	trans	-68.3	-35.4	175.8	76.4	0	0	0	0	113	A68 L69 L70 T76	A68-S72 PolarHBondContact O-N 3.32Å; A68-S72 VanDerWaalsContact O-N 3.11Å; L69-S72 WeakPolarHBondContact O-CB 3.36Å; L69-S72 PolarHBondContact O-N 2.83Å; L69-S72 PolarHBondContact O-OG 3.22Å; L70-S72 VanDerWaalsContact C-N 3.28Å; L70-S72 PolarHBondContact O-N 3.26Å; S72-T76 WeakPolarHBondContact O-CG2 3.32Å; S72-T76 PolarHBondContact O-N 3.34Å; S72-T76 PolarHBondContact O-OG1 3.02Å
73	I	81.6	Confident	79.4	Confident	27 Å²	27	68.5 Å²	68.5	14%	0.138	40%	0.403	C	S	.	.	H	α-helix	trans	-71	-43.1	176.6	-65.2	164.8	0	0	0	109.9	L18 L69 L70 N75 T76 Y77 L85	L18-I73 HydrophobicContact CD1-CD1 4.27Å; L69-I73 WeakPolarHBondContact O-CG1 3.42Å; L69-I73 PolarHBondContact O-N 2.86Å; L70-I73 PolarHBondContact O-N 3.23Å; L70-I73 VanDerWaalsContact O-N 3.17Å; I73-N75 VanDerWaalsContact C-N 3.33Å; I73-N75 PolarHBondContact O-N 2.95Å; I73-T76 WeakPolarHBondContact CA-OG1 3.27Å; I73-T76 PolarHBondContact O-N 3.35Å; I73-T76 PolarHBondContact O-OG1 3.12Å; I73-Y77 HydrophobicContact CG2-CD2 4.11Å; I73-Y77 PolarHBondContact O-N 3.21Å; I73-L85 HydrophobicContact CD1-CD1 4.33Å
74	S	82.3	Confident	78	Confident	33 Å²	33	70.5 Å²	70.5	23%	0.231	41%	0.411	C	S	.	.	H	α-helix	trans	-66.1	-35.7	178	71.3	0	0	0	0	111.9	L70 V71 T76 G78 D80	L70-S74 PolarHBondContact O-N 3.34Å; L70-S74 PolarHBondContact O-OG 3.46Å; V71-S74 WeakPolarHBondContact CA-OG 3.46Å; V71-S74 PolarHBondContact O-OG 2.87Å; S74-T76 VanDerWaalsContact C-N 3.35Å; S74-T76 PolarHBondContact O-N 3.48Å; S74-G78 WeakPolarHBondContact O-CA 3.3Å; S74-G78 PolarHBondContact O-N 3.42Å; S74-D80 WeakPolarHBondContact CB-OD1 3.43Å
75	N	83.2	Confident	76.6	Confident	129 Å²	129	70.9 Å²	70.9	69%	0.69	40%	0.404	S	S	*	.	H	α-helix	trans	-68.7	-29.2	174	-75.3	-29.2	0	0	0	113.7	V71 I73	V71-N75 WeakPolarHBondContact O-CB 3.48Å; V71-N75 PolarHBondContact O-N 2.99Å; V71-N75 PolarHBondContact O-ND2 3.12Å; V71-N75 VanDerWaalsContact O-ND2 3.12Å; I73-N75 VanDerWaalsContact C-N 3.33Å; I73-N75 PolarHBondContact O-N 2.95Å
76	T	79.1	Confident	75.5	Confident	102 Å²	102	70.8 Å²	70.8	63%	0.626	40%	0.401	S	S	*	.	H	α-helix	trans	-88.7	-36.8	-177.8	43.8	0	0	0	0	113.1	S72 I73 S74	S72-T76 WeakPolarHBondContact O-CG2 3.32Å; S72-T76 PolarHBondContact O-N 3.34Å; S72-T76 PolarHBondContact O-OG1 3.02Å; I73-T76 WeakPolarHBondContact CA-OG1 3.27Å; I73-T76 PolarHBondContact O-N 3.35Å; I73-T76 PolarHBondContact O-OG1 3.12Å; S74-T76 VanDerWaalsContact C-N 3.35Å; S74-T76 PolarHBondContact O-N 3.48Å
77	Y	73.4	Confident	74.5	Confident	78 Å²	78	76.2 Å²	76.2	31%	0.306	43%	0.426	S	S	.	.	H	α-helix	trans	-113.2	-4.1	-175.8	-62.8	-80.2	0	0	0	114.4	I73 L79 N84 L85 L87	I73-Y77 HydrophobicContact CG2-CD2 4.11Å; I73-Y77 PolarHBondContact O-N 3.21Å; Y77-L79 PolarHBondContact O-N 3.42Å; Y77-N84 HydrophobicContact CD1-CB 3.72Å; Y77-N84 HydrophobicContact CE1-CB 4.18Å; Y77-N84 WeakPolarHBondContact CE1-O 3.42Å; Y77-N84 HydrophobicContact CG-CB 3.9Å; Y77-L85 HydrophobicContact CE2-CD2 3.91Å; Y77-L87 HydrophobicContact CE1-CD1 4.39Å; Y77-L87 WeakPolarHBondContact OH-CD1 3.38Å
78	G	68.6	Low	73.7	Confident	60 Å²	60	80.1 Å²	80.1	62%	0.619	45%	0.446	S	S	*	.	S	Bend	trans	70.4	-7.2	-179.1	0	0	0	0	0	115.2	S74	S74-G78 WeakPolarHBondContact O-CA 3.3Å; S74-G78 PolarHBondContact O-N 3.42Å
79	L	66.8	Low	72.6	Confident	96 Å²	96	84.6 Å²	84.6	50%	0.503	46%	0.456	S	S	.	.	S	Bend	trans	-145.9	143	-174.1	-64.4	170.4	0	0	0	110.9	Y77 Y81	Y77-L79 PolarHBondContact O-N 3.42Å; L79-Y81 HydrophobicContact CB-CD2 3.69Å; L79-Y81 HydrophobicContact CB-CE2 4.23Å; L79-Y81 HydrophobicContact CD1-CD2 3.99Å; L79-Y81 HydrophobicContact CD1-CE2 4.1Å; L79-Y81 HydrophobicContact CD2-CE2 4.49Å; L79-Y81 HydrophobicContact CG-CD2 4.35Å; L79-Y81 PolarHBondContact O-N 3.42Å
80	D	63.4	Low	71.4	Confident	52 Å²	52	88.1 Å²	88.1	28%	0.278	49%	0.487	S	S	.	.			trans	-77.7	25.3	-176.8	-58.2	-27.5	0	0	0	114.5	L18 S74	L18-D80 PolarHBondContact N-O 3.06Å; S74-D80 WeakPolarHBondContact CB-OD1 3.43Å
81	Y	64.4	Low	70.6	Confident	95 Å²	95	91.9 Å²	91.9	37%	0.373	51%	0.508	S	S	.	.	B	Isolated β-bridge	trans	-85.8	122.6	-174.7	-72.3	-62.1	0	0	0	112.1	S16 H17 L79 H83 N84	S16-Y81 WeakPolarHBondContact O-CA 3.5Å; S16-Y81 WeakPolarHBondContact O-CD1 3.21Å; H17-Y81 AromaticContact CE1-CE1 3.39Å; H17-Y81 WeakPolarHBondContact CE1-CE1 3.4Å; H17-Y81 AromaticContact CE1-CZ 3.72Å; H17-Y81 AromaticContact NE2-CE1 3.81Å; L79-Y81 HydrophobicContact CB-CD2 3.69Å; L79-Y81 HydrophobicContact CB-CE2 4.23Å; L79-Y81 HydrophobicContact CD1-CD2 3.99Å; L79-Y81 HydrophobicContact CD1-CE2 4.1Å; L79-Y81 HydrophobicContact CD2-CE2 4.49Å; L79-Y81 HydrophobicContact CG-CD2 4.35Å; L79-Y81 PolarHBondContact O-N 3.42Å; Y81-H83 PolarHBondContact O-N 2.94Å; Y81-N84 PolarHBondContact O-N 3.02Å
82	V	61.3	Low	69.8	Low	48 Å²	48	92.6 Å²	92.6	29%	0.291	51%	0.51	S	S	.	.	G	3₁₀ helix	trans	-61.3	-28	178.3	-171.7	0	0	0	0	112.3	S16 L18 N84 L85	S16-V82 PolarHBondContact O-N 2.92Å; L18-V82 HydrophobicContact CB-CG2 4.33Å; L18-V82 HydrophobicContact CD1-CG2 4.07Å; V82-N84 PolarHBondContact O-N 3.42Å; V82-L85 PolarHBondContact O-N 3.06Å
83	H	60.3	Low	69	Low	148 Å²	148	94.8 Å²	94.8	69%	0.685	52%	0.518	S	S	*	.	G	3₁₀ helix	trans	-65.8	-18.2	-179.2	-165.9	-65	0	0	0	113.8	Y81 L85	Y81-H83 PolarHBondContact O-N 2.94Å; H83-L85 PolarHBondContact O-N 2.93Å
84	N	59.9	Low	68.2	Low	62 Å²	62	98.8 Å²	98.8	33%	0.332	54%	0.54	S	S	.	.	G	3₁₀ helix	trans	-76.7	-10.4	178.7	-77.3	6.7	0	0	0	113.2	Y77 Y81 V82 N86	Y77-N84 HydrophobicContact CD1-CB 3.72Å; Y77-N84 HydrophobicContact CE1-CB 4.18Å; Y77-N84 WeakPolarHBondContact CE1-O 3.42Å; Y77-N84 HydrophobicContact CG-CB 3.9Å; Y81-N84 PolarHBondContact O-N 3.02Å; V82-N84 PolarHBondContact O-N 3.42Å; N84-N86 PolarHBondContact O-N 3.38Å
85	L	62.6	Low	67.4	Low	67 Å²	67	102.9 Å²	102.9	35%	0.351	56%	0.559	S	S	.	*	G	3₁₀ helix	trans	-83.9	22.3	-178.9	-63.4	168.9	0	0	0	114.3	I73 Y77 V82 H83 L87	I73-L85 HydrophobicContact CD1-CD1 4.33Å; Y77-L85 HydrophobicContact CE2-CD2 3.91Å; V82-L85 PolarHBondContact O-N 3.06Å; H83-L85 PolarHBondContact O-N 2.93Å; L85-L87 VanDerWaalsContact C-N 3.26Å; L85-L87 PolarHBondContact O-N 3.22Å
86	N	68.8	Low	66.3	Low	89 Å²	89	101.1 Å²	101.1	48%	0.476	55%	0.551	S	S	.	*	G	3₁₀ helix	trans	-78.5	2.1	-178.4	-89	1.7	0	0	0	115.2	N84 L88 Q89	N84-N86 PolarHBondContact O-N 3.38Å; N86-L88 PolarHBondContact O-N 3.38Å; N86-Q89 WeakPolarHBondContact O-CB 3.4Å; N86-Q89 PolarHBondContact O-N 3.41Å
87	L	67.9	Low	65.4	Low	126 Å²	126	101.1 Å²	101.1	66%	0.66	55%	0.545	S	S	*	.	G	3₁₀ helix	trans	-66.2	-21.1	179.8	-79.4	166.4	0	0	0	114	Y77 L85 Q89	Y77-L87 HydrophobicContact CE1-CD1 4.39Å; Y77-L87 WeakPolarHBondContact OH-CD1 3.38Å; L85-L87 VanDerWaalsContact C-N 3.26Å; L85-L87 PolarHBondContact O-N 3.22Å; L87-Q89 VanDerWaalsContact C-N 3.27Å; L87-Q89 PolarHBondContact O-N 2.98Å
88	L	71.3	Confident	64.8	Low	161 Å²	161	102.8 Å²	102.8	84%	0.843	56%	0.564	S	S	*	*	G	3₁₀ helix	trans	-83.3	1.5	177.5	-76	158.5	0	0	0	113.6	N86 C90	N86-L88 PolarHBondContact O-N 3.38Å; L88-C90 VanDerWaalsContact C-N 3.27Å
89	Q	66.9	Low	64.5	Low	159 Å²	159	106.4 Å²	106.4	74%	0.743	56%	0.559	S	S	*	*	G	3₁₀ helix	trans	-84	-3.1	175.3	-158.5	177.5	-15.5	0	0	112.7	N86 L87	N86-Q89 WeakPolarHBondContact O-CB 3.4Å; N86-Q89 PolarHBondContact O-N 3.41Å; L87-Q89 VanDerWaalsContact C-N 3.27Å; L87-Q89 PolarHBondContact O-N 2.98Å
90	C	59.9	Low	64.3	Low	174 Å²	174	107.4 Å²	107.4	100%	1.176	56%	0.564	S	S	*	*			trans	-83.7	0	170	-65.7	0	0	0	0	110.9	L88	L88-C90 VanDerWaalsContact C-N 3.27Å

Retrieved 90 of 90 residues in 62.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).