A0A059RI90_HUMAN Loading...

NADH-ubiquinone oxidoreductase chain 4L

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Part of the enzyme membrane arm which is embedded in the lipid bilayer and involved in proton translocation.

AlphaFold DB , UniProt , Accession A0A059RI90, Species HUMAN (Homo sapiens, Human), Gene ND4L, Length 83 aa.

						>A0A059RI90_HUMAN|A0A059RI90|ND4L
LLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	58.3	Low	61.2	Low	140 Å²	140	101.6 Å²	101.6	73%	0.733	52%	0.517	S	S	*	.				0	-63.6	0	-113.8	150.4	0	0	0	113.9	G3 M4 L5	L1-G3 VanDerWaalsContact C-N 3.35Å; L1-G3 PolarHBondContact O-N 3.41Å; L1-M4 WeakPolarHBondContact CA-SD 3.29Å; L1-M4 HydrophobicContact CB-SD 4.36Å; L1-M4 HydrophobicContact CG-CE 4.33Å; L1-M4 HydrophobicContact CG-SD 4.21Å; L1-M4 PolarHBondContact N-SD 3.24Å; L1-M4 VanDerWaalsContact N-SD 3.4Å; L1-M4 WeakPolarHBondContact O-CG 3.49Å; L1-M4 PolarHBondContact O-N 3.46Å; L1-M4 VanDerWaalsContact O-SD 3.39Å; L1-L5 HydrophobicContact CD2-CD1 3.85Å; L1-L5 HydrophobicContact CD2-CG 4.5Å; L1-L5 PolarHBondContact O-N 3.1Å
2	L	64	Low	62.3	Low	145 Å²	145	100.2 Å²	100.2	76%	0.759	51%	0.509	S	S	*	.	H	α-helix	trans	-63.1	-37.6	179.3	-70.4	167.8	0	0	0	113.6	M4 L5 V6	L2-M4 VanDerWaalsContact C-N 3.31Å; L2-M4 PolarHBondContact O-N 3.24Å; L2-L5 PolarHBondContact O-N 2.65Å; L2-V6 WeakPolarHBondContact O-CG2 3.38Å; L2-V6 PolarHBondContact O-N 3.05Å; L2-V6 VanDerWaalsContact O-N 3.12Å
3	G	64.5	Low	63.5	Low	46 Å²	46	96.2 Å²	96.2	47%	0.474	50%	0.496	S	S	.	.	H	α-helix	trans	-66.5	-23.8	-179.5	0	0	0	0	0	115.6	L1	L1-G3 VanDerWaalsContact C-N 3.35Å; L1-G3 PolarHBondContact O-N 3.41Å
4	M	59.2	Low	64.5	Low	50 Å²	50	90.9 Å²	90.9	25%	0.246	47%	0.471	C	S	.	.	H	α-helix	trans	-91.6	-26.4	175.7	70.9	-125.2	-118.4	0	0	113.1	L1 L2 V6 C17 M21	L1-M4 WeakPolarHBondContact CA-SD 3.29Å; L1-M4 HydrophobicContact CB-SD 4.36Å; L1-M4 HydrophobicContact CG-CE 4.33Å; L1-M4 HydrophobicContact CG-SD 4.21Å; L1-M4 PolarHBondContact N-SD 3.24Å; L1-M4 VanDerWaalsContact N-SD 3.4Å; L1-M4 WeakPolarHBondContact O-CG 3.49Å; L1-M4 PolarHBondContact O-N 3.46Å; L1-M4 VanDerWaalsContact O-SD 3.39Å; L2-M4 VanDerWaalsContact C-N 3.31Å; L2-M4 PolarHBondContact O-N 3.24Å; M4-V6 VanDerWaalsContact C-N 3.35Å; M4-C17 HydrophobicContact CB-CB 4.47Å; M4-M21 HydrophobicContact CE-CE 3.15Å; M4-M21 HydrophobicContact CE-SD 3.35Å; M4-M21 WeakPolarHBondContact CE-SD 3.37Å; M4-M21 HydrophobicContact SD-CE 3.32Å; M4-M21 WeakPolarHBondContact SD-CE 3.44Å; M4-M21 HydrophobicContact SD-SD 3.21Å
5	L	59.7	Low	65.6	Low	116 Å²	116	86.3 Å²	86.3	61%	0.607	45%	0.447	S	S	*	.	H	α-helix	trans	-74.4	-31.6	176.6	-74	168.5	0	0	0	110.8	L1 L2 Y7	L1-L5 HydrophobicContact CD2-CD1 3.85Å; L1-L5 HydrophobicContact CD2-CG 4.5Å; L1-L5 PolarHBondContact O-N 3.1Å; L2-L5 PolarHBondContact O-N 2.65Å; L5-Y7 VanDerWaalsContact C-N 3.28Å; L5-Y7 PolarHBondContact O-N 2.84Å; L5-Y7 VanDerWaalsContact O-N 3.08Å
6	V	60.4	Low	66.5	Low	93 Å²	93	87.9 Å²	87.9	56%	0.564	46%	0.456	S	S	*	.	S	Bend	trans	-80.8	83	165.8	-175.6	0	0	0	0	107.3	L2 M4 R8	L2-V6 WeakPolarHBondContact O-CG2 3.38Å; L2-V6 PolarHBondContact O-N 3.05Å; L2-V6 VanDerWaalsContact O-N 3.12Å; M4-V6 VanDerWaalsContact C-N 3.35Å; V6-R8 HydrophobicContact CG1-CG 4.47Å; V6-R8 PolarHBondContact O-N 3.15Å
7	Y	55.8	Low	67.5	Low	177 Å²	177	85.4 Å²	85.4	69%	0.694	45%	0.448	S	S	*	.			trans	-59.2	82.5	169.7	-78.6	-87	0	0	0	109.5	L5	L5-Y7 VanDerWaalsContact C-N 3.28Å; L5-Y7 PolarHBondContact O-N 2.84Å; L5-Y7 VanDerWaalsContact O-N 3.08Å
8	R	55	Low	68.2	Low	182 Å²	182	85.4 Å²	85.4	69%	0.687	45%	0.448	S	S	*	.			trans	-62.7	141.8	162.4	-82.4	-77.4	-152	114.8	5.6	106.5	V6 H10	V6-R8 HydrophobicContact CG1-CG 4.47Å; V6-R8 PolarHBondContact O-N 3.15Å; R8-H10 PolarHBondContact O-N 2.92Å
9	S	58.8	Low	69.1	Low	52 Å²	52	86.1 Å²	86.1	36%	0.364	45%	0.448	S	S	.	.	S	Bend	trans	-40.2	-17.9	-177	54.7	0	0	0	0	117.5	Y74	S9-Y74 WeakPolarHBondContact O-CA 3.3Å; S9-Y74 WeakPolarHBondContact O-CD1 3.42Å
10	H	67.9	Low	69.9	Low	80 Å²	80	83.9 Å²	83.9	37%	0.37	45%	0.447	S	S	.	.	B	Isolated β-bridge	trans	-108	116.6	-177.5	-60.3	-72.7	0	0	0	112.8	R8 M12 S13 Y74	R8-H10 PolarHBondContact O-N 2.92Å; H10-M12 PolarHBondContact O-N 3.26Å; H10-S13 PolarHBondContact O-N 3.46Å; H10-S13 PolarHBondContact O-OG 3.25Å; H10-Y74 AromaticContact CE1-CE1 3.58Å; H10-Y74 AromaticContact CE1-CZ 3.88Å; H10-Y74 AromaticContact NE2-CE1 3.95Å
11	L	69.9	Low	70.7	Confident	37 Å²	37	81.8 Å²	81.8	19%	0.194	44%	0.436	C	S	.	.	H	α-helix	trans	-61.1	-26.7	177.6	-152.1	138.5	0	0	0	112.8	S13 S14 L15 L63 I66 V75	L11-S13 VanDerWaalsContact C-N 3.34Å; L11-S13 PolarHBondContact O-N 3.07Å; L11-S14 WeakPolarHBondContact CA-OG 3.49Å; L11-S14 PolarHBondContact O-N 3.15Å; L11-S14 PolarHBondContact O-OG 3.41Å; L11-L15 HydrophobicContact CD2-CD1 4.18Å; L11-L15 HydrophobicContact CD2-CG 4.4Å; L11-L15 PolarHBondContact O-N 3.05Å; L11-L15 VanDerWaalsContact O-N 3.1Å; L11-L63 HydrophobicContact CB-CD1 4.02Å; L11-L63 HydrophobicContact CB-CG 4.48Å; L11-L63 HydrophobicContact CD2-CB 4.05Å; L11-L63 HydrophobicContact CD2-CD1 3.64Å; L11-L63 HydrophobicContact CD2-CG 3.97Å; L11-L63 HydrophobicContact CG-CD1 4.46Å; L11-I66 HydrophobicContact CD1-CD1 4.18Å; L11-V75 HydrophobicContact CB-CG2 4.29Å; L11-V75 HydrophobicContact CD1-CG2 4.04Å
12	M	74.4	Confident	72.1	Confident	84 Å²	84	77.8 Å²	77.8	41%	0.414	41%	0.414	S	S	.	.	H	α-helix	trans	-58.7	-41.5	171.5	-71.4	-62.7	-71.2	0	0	112.9	H10 S14 L15 L16 L63	H10-M12 PolarHBondContact O-N 3.26Å; M12-S14 VanDerWaalsContact C-N 3.34Å; M12-S14 PolarHBondContact O-N 3.11Å; M12-L15 PolarHBondContact O-N 3.4Å; M12-L16 PolarHBondContact O-N 3.25Å; M12-L16 VanDerWaalsContact O-N 3.07Å; M12-L63 HydrophobicContact CB-CD1 4.47Å; M12-L63 HydrophobicContact CG-CD1 3.73Å; M12-L63 HydrophobicContact CG-CD2 4.47Å; M12-L63 HydrophobicContact SD-CD1 3.28Å; M12-L63 WeakPolarHBondContact SD-CD1 3.48Å; M12-L63 HydrophobicContact SD-CD2 3.98Å; M12-L63 HydrophobicContact SD-CG 4.31Å
13	S	77.1	Confident	73.2	Confident	48 Å²	48	75.8 Å²	75.8	34%	0.336	40%	0.403	S	S	.	.	H	α-helix	trans	-69.6	-33.2	-178.4	68.4	0	0	0	0	112.3	H10 L11 C17	H10-S13 PolarHBondContact O-N 3.46Å; H10-S13 PolarHBondContact O-OG 3.25Å; L11-S13 VanDerWaalsContact C-N 3.34Å; L11-S13 PolarHBondContact O-N 3.07Å; S13-C17 PolarHBondContact O-N 2.96Å; S13-C17 VanDerWaalsContact O-N 3.13Å; S13-C17 PolarHBondContact O-SG 3.37Å
14	S	78.4	Confident	74.3	Confident	22 Å²	22	76.8 Å²	76.8	15%	0.154	40%	0.403	C	S	.	.	H	α-helix	trans	-69.3	-37.4	172.1	45.7	0	0	0	0	112.7	L11 M12 C17 L18	L11-S14 WeakPolarHBondContact CA-OG 3.49Å; L11-S14 PolarHBondContact O-N 3.15Å; L11-S14 PolarHBondContact O-OG 3.41Å; M12-S14 VanDerWaalsContact C-N 3.34Å; M12-S14 PolarHBondContact O-N 3.11Å; S14-C17 WeakPolarHBondContact O-CB 3.48Å; S14-C17 PolarHBondContact O-N 2.97Å; S14-L18 PolarHBondContact O-N 3.46Å
15	L	80.6	Confident	75.7	Confident	22 Å²	22	78.4 Å²	78.4	12%	0.115	41%	0.412	C	S	.	.	H	α-helix	trans	-63.7	-44.8	175.6	-76.1	170.5	0	0	0	111.6	L11 M12 C17 L18 E19 L60 L63	L11-L15 HydrophobicContact CD2-CD1 4.18Å; L11-L15 HydrophobicContact CD2-CG 4.4Å; L11-L15 PolarHBondContact O-N 3.05Å; L11-L15 VanDerWaalsContact O-N 3.1Å; M12-L15 PolarHBondContact O-N 3.4Å; L15-C17 VanDerWaalsContact C-N 3.28Å; L15-C17 PolarHBondContact O-N 3.28Å; L15-L18 WeakPolarHBondContact O-CA 3.42Å; L15-L18 WeakPolarHBondContact O-CB 3.36Å; L15-L18 PolarHBondContact O-N 3.47Å; L15-E19 PolarHBondContact O-N 3.17Å; L15-L60 HydrophobicContact CD1-CD2 3.95Å; L15-L60 HydrophobicContact CD1-CG 4.35Å; L15-L63 HydrophobicContact CD1-CB 4.33Å; L15-L63 HydrophobicContact CD1-CD1 3.48Å; L15-L63 VanDerWaalsContact CD1-CD1 3.48Å
16	L	80.6	Confident	77.1	Confident	112 Å²	112	76.1 Å²	76.1	59%	0.586	40%	0.397	S	S	*	.	H	α-helix	trans	-61.4	-36.8	174.5	-72	172.1	0	0	0	112.4	M12 L18 E19 G20	M12-L16 PolarHBondContact O-N 3.25Å; M12-L16 VanDerWaalsContact O-N 3.07Å; L16-L18 VanDerWaalsContact C-N 3.33Å; L16-E19 PolarHBondContact O-N 3.07Å; L16-G20 PolarHBondContact O-N 3.03Å
17	C	82.7	Confident	78.5	Confident	46 Å²	46	75.8 Å²	75.8	31%	0.311	39%	0.391	S	S	.	.	H	α-helix	trans	-65.5	-37	173.8	-70	0	0	0	0	112.2	M4 S13 S14 L15 G20 M21	M4-C17 HydrophobicContact CB-CB 4.47Å; S13-C17 PolarHBondContact O-N 2.96Å; S13-C17 VanDerWaalsContact O-N 3.13Å; S13-C17 PolarHBondContact O-SG 3.37Å; S14-C17 WeakPolarHBondContact O-CB 3.48Å; S14-C17 PolarHBondContact O-N 2.97Å; L15-C17 VanDerWaalsContact C-N 3.28Å; L15-C17 PolarHBondContact O-N 3.28Å; C17-G20 PolarHBondContact O-N 3.03Å; C17-M21 WeakPolarHBondContact O-CG 3.45Å; C17-M21 PolarHBondContact O-N 2.95Å
18	L	81.2	Confident	80.1	Confident	86 Å²	86	72.6 Å²	72.6	45%	0.45	38%	0.384	S	S	.	.	H	α-helix	trans	-63.8	-47.9	174.5	-89.5	161.3	0	0	0	111.5	S14 L15 L16 G20 M21 M22	S14-L18 PolarHBondContact O-N 3.46Å; L15-L18 WeakPolarHBondContact O-CA 3.42Å; L15-L18 WeakPolarHBondContact O-CB 3.36Å; L15-L18 PolarHBondContact O-N 3.47Å; L16-L18 VanDerWaalsContact C-N 3.33Å; L18-G20 VanDerWaalsContact C-N 3.31Å; L18-G20 PolarHBondContact O-N 3.4Å; L18-M21 HydrophobicContact CB-CE 4.39Å; L18-M21 HydrophobicContact CD2-CE 3.56Å; L18-M21 HydrophobicContact CG-CE 3.98Å; L18-M21 PolarHBondContact O-N 3.42Å; L18-M21 VanDerWaalsContact O-N 3.15Å; L18-M22 WeakPolarHBondContact O-CG 3.14Å; L18-M22 PolarHBondContact O-N 3.46Å; L18-M22 VanDerWaalsContact O-N 3.08Å
19	E	84.3	Confident	81.6	Confident	97 Å²	97	65.4 Å²	65.4	45%	0.453	36%	0.364	S	S	.	.	H	α-helix	trans	-57.3	-44.2	175.2	-71.4	-175.1	165.3	0	0	111.8	L15 L16 M21 M22 L23	L15-E19 PolarHBondContact O-N 3.17Å; L16-E19 PolarHBondContact O-N 3.07Å; E19-M21 VanDerWaalsContact C-N 3.31Å; E19-M21 PolarHBondContact O-N 2.85Å; E19-M22 PolarHBondContact O-N 2.88Å; E19-L23 WeakPolarHBondContact O-CB 3.4Å; E19-L23 PolarHBondContact O-N 2.94Å
20	G	85.6	Confident	82.9	Confident	42 Å²	42	64.4 Å²	64.4	43%	0.433	36%	0.356	S	S	.	.	H	α-helix	trans	-59.9	-36.7	177.2	0	0	0	0	0	113.8	L16 C17 L18 S24	L16-G20 PolarHBondContact O-N 3.03Å; C17-G20 PolarHBondContact O-N 3.03Å; L18-G20 VanDerWaalsContact C-N 3.31Å; L18-G20 PolarHBondContact O-N 3.4Å; G20-S24 PolarHBondContact O-N 2.95Å; G20-S24 VanDerWaalsContact O-N 3.1Å
21	M	86.6	Confident	83.9	Confident	41 Å²	41	65.2 Å²	65.2	20%	0.202	36%	0.362	C	S	.	.	H	α-helix	trans	-71.5	-41.7	175.6	-67.9	-175.8	-66.1	0	0	112.6	M4 C17 L18 E19 L23 S24 L25	M4-M21 HydrophobicContact CE-CE 3.15Å; M4-M21 HydrophobicContact CE-SD 3.35Å; M4-M21 WeakPolarHBondContact CE-SD 3.37Å; M4-M21 HydrophobicContact SD-CE 3.32Å; M4-M21 WeakPolarHBondContact SD-CE 3.44Å; M4-M21 HydrophobicContact SD-SD 3.21Å; C17-M21 WeakPolarHBondContact O-CG 3.45Å; C17-M21 PolarHBondContact O-N 2.95Å; L18-M21 HydrophobicContact CB-CE 4.39Å; L18-M21 HydrophobicContact CD2-CE 3.56Å; L18-M21 HydrophobicContact CG-CE 3.98Å; L18-M21 PolarHBondContact O-N 3.42Å; L18-M21 VanDerWaalsContact O-N 3.15Å; E19-M21 VanDerWaalsContact C-N 3.31Å; E19-M21 PolarHBondContact O-N 2.85Å; M21-L23 PolarHBondContact O-N 3.16Å; M21-S24 PolarHBondContact O-N 3.02Å; M21-S24 VanDerWaalsContact O-N 3.13Å; M21-S24 PolarHBondContact O-OG 2.87Å; M21-L25 PolarHBondContact O-N 3.36Å
22	M	87.8	Confident	84.6	Confident	55 Å²	55	69 Å²	69	27%	0.271	38%	0.38	S	S	.	.	H	α-helix	trans	-60.7	-38.9	176.9	-63.7	-55.8	-79	0	0	110.9	L18 E19 L25 F26 A52	L18-M22 WeakPolarHBondContact O-CG 3.14Å; L18-M22 PolarHBondContact O-N 3.46Å; L18-M22 VanDerWaalsContact O-N 3.08Å; E19-M22 PolarHBondContact O-N 2.88Å; M22-L25 PolarHBondContact O-N 3.01Å; M22-L25 HydrophobicContact SD-CD1 4.36Å; M22-F26 WeakPolarHBondContact O-CB 3.41Å; M22-F26 PolarHBondContact O-N 3.05Å; M22-A52 HydrophobicContact CB-CB 4.12Å; M22-A52 HydrophobicContact CE-CB 3.26Å; M22-A52 HydrophobicContact CG-CB 4.11Å
23	L	86.9	Confident	85.1	Confident	104 Å²	104	65.7 Å²	65.7	55%	0.545	37%	0.365	S	S	.	.	H	α-helix	trans	-64.3	-42.3	174.8	-139	161.1	0	0	0	111.7	E19 M21 L25 F26 I27	E19-L23 WeakPolarHBondContact O-CB 3.4Å; E19-L23 PolarHBondContact O-N 2.94Å; M21-L23 PolarHBondContact O-N 3.16Å; L23-L25 PolarHBondContact O-N 2.86Å; L23-F26 WeakPolarHBondContact O-CB 3.39Å; L23-F26 PolarHBondContact O-N 3.5Å; L23-I27 HydrophobicContact CD2-CD1 3.75Å; L23-I27 HydrophobicContact CD2-CG1 4.19Å; L23-I27 WeakPolarHBondContact O-CG1 3.33Å; L23-I27 PolarHBondContact O-N 2.98Å
24	S	88.4	Confident	85.4	Confident	66 Å²	66	68.7 Å²	68.7	46%	0.462	38%	0.377	S	S	.	.	H	α-helix	trans	-63.8	-39.2	176.2	75.8	0	0	0	0	113	G20 M21 I27 M28	G20-S24 PolarHBondContact O-N 2.95Å; G20-S24 VanDerWaalsContact O-N 3.1Å; M21-S24 PolarHBondContact O-N 3.02Å; M21-S24 VanDerWaalsContact O-N 3.13Å; M21-S24 PolarHBondContact O-OG 2.87Å; S24-I27 PolarHBondContact O-N 3.35Å; S24-M28 PolarHBondContact O-N 3.49Å
25	L	87	Confident	85.7	Confident	85 Å²	85	73.5 Å²	73.5	45%	0.445	40%	0.401	S	S	.	.	H	α-helix	trans	-65.8	-39.9	175	-76.9	166	0	0	0	111.4	M21 M22 L23 M28 A29	M21-L25 PolarHBondContact O-N 3.36Å; M22-L25 PolarHBondContact O-N 3.01Å; M22-L25 HydrophobicContact SD-CD1 4.36Å; L23-L25 PolarHBondContact O-N 2.86Å; L25-M28 PolarHBondContact O-N 3.29Å; L25-A29 VanDerWaalsContact O-CB 3.3Å; L25-A29 WeakPolarHBondContact O-CB 3.28Å; L25-A29 PolarHBondContact O-N 3.27Å
26	F	89.6	Confident	85.7	Confident	67 Å²	67	76.9 Å²	76.9	29%	0.294	42%	0.422	S	S	.	.	H	α-helix	trans	-62.4	-45.5	175.4	177.5	-99.2	0	0	0	112.1	M22 L23 M28 A29 T30 P45 L49	M22-F26 WeakPolarHBondContact O-CB 3.41Å; M22-F26 PolarHBondContact O-N 3.05Å; L23-F26 WeakPolarHBondContact O-CB 3.39Å; L23-F26 PolarHBondContact O-N 3.5Å; F26-M28 VanDerWaalsContact C-N 3.35Å; F26-M28 PolarHBondContact O-N 3.47Å; F26-A29 PolarHBondContact O-N 3.34Å; F26-T30 HydrophobicContact CD1-CG2 4.29Å; F26-T30 HydrophobicContact CD2-CG2 4.23Å; F26-T30 HydrophobicContact CE1-CG2 3.88Å; F26-T30 HydrophobicContact CE2-CG2 3.81Å; F26-T30 HydrophobicContact CG-CG2 4.45Å; F26-T30 HydrophobicContact CZ-CG2 3.62Å; F26-T30 WeakPolarHBondContact O-CB 3.47Å; F26-T30 VanDerWaalsContact O-CG2 3.32Å; F26-T30 WeakPolarHBondContact O-CG2 3.39Å; F26-T30 PolarHBondContact O-N 3.33Å; F26-T30 PolarHBondContact O-OG1 2.95Å; F26-P45 HydrophobicContact CD2-CB 3.87Å; F26-P45 HydrophobicContact CE2-CB 3.63Å; F26-L49 HydrophobicContact CD1-CD1 4.48Å; F26-L49 HydrophobicContact CD2-CB 4.33Å; F26-L49 HydrophobicContact CD2-CD1 3.82Å; F26-L49 HydrophobicContact CE1-CD1 4.4Å; F26-L49 HydrophobicContact CE2-CB 4.46Å; F26-L49 HydrophobicContact CE2-CD1 3.71Å; F26-L49 HydrophobicContact CG-CD1 4.2Å; F26-L49 HydrophobicContact CZ-CD1 4.02Å
27	I	90.2	Very high	85.5	Confident	86 Å²	86	79.8 Å²	79.8	44%	0.441	43%	0.433	S	S	.	.	H	α-helix	trans	-61.7	-44.2	176.8	-66.8	167.6	0	0	0	110.6	L23 S24 T30 L31	L23-I27 HydrophobicContact CD2-CD1 3.75Å; L23-I27 HydrophobicContact CD2-CG1 4.19Å; L23-I27 WeakPolarHBondContact O-CG1 3.33Å; L23-I27 PolarHBondContact O-N 2.98Å; S24-I27 PolarHBondContact O-N 3.35Å; I27-T30 WeakPolarHBondContact CA-OG1 3.49Å; I27-T30 PolarHBondContact O-N 3.35Å; I27-T30 PolarHBondContact O-OG1 3.08Å; I27-L31 HydrophobicContact CG2-CD1 3.88Å; I27-L31 HydrophobicContact CG2-CG 4.48Å; I27-L31 WeakPolarHBondContact O-CB 3.37Å; I27-L31 VanDerWaalsContact O-CG 3.3Å; I27-L31 WeakPolarHBondContact O-CG 3.42Å; I27-L31 PolarHBondContact O-N 2.72Å
28	M	89.1	Confident	85.1	Confident	110 Å²	110	79.7 Å²	79.7	54%	0.542	43%	0.432	S	S	.	.	H	α-helix	trans	-64.3	-44.2	178.4	-168	-173.6	75.4	0	0	111.8	S24 L25 F26 L31 M32	S24-M28 PolarHBondContact O-N 3.49Å; L25-M28 PolarHBondContact O-N 3.29Å; F26-M28 VanDerWaalsContact C-N 3.35Å; F26-M28 PolarHBondContact O-N 3.47Å; M28-L31 PolarHBondContact O-N 2.9Å; M28-M32 WeakPolarHBondContact O-CG 3.49Å; M28-M32 PolarHBondContact O-N 2.71Å; M28-M32 VanDerWaalsContact O-N 3.07Å
29	A	86.4	Confident	84.7	Confident	32 Å²	32	83.2 Å²	83.2	26%	0.264	45%	0.451	S	S	.	.	H	α-helix	trans	-63.2	-44.8	179	0	0	0	0	0	111.7	L25 F26 M32 T33 P45	L25-A29 VanDerWaalsContact O-CB 3.3Å; L25-A29 WeakPolarHBondContact O-CB 3.28Å; L25-A29 PolarHBondContact O-N 3.27Å; F26-A29 PolarHBondContact O-N 3.34Å; A29-M32 PolarHBondContact O-N 3.39Å; A29-T33 WeakPolarHBondContact O-CG2 3.47Å; A29-T33 PolarHBondContact O-N 3.36Å; A29-P45 HydrophobicContact CB-CG 4.24Å
30	T	86.6	Confident	84.3	Confident	30 Å²	30	85.8 Å²	85.8	18%	0.184	47%	0.467	C	S	.	.	H	α-helix	trans	-65.4	-38.4	177.7	51.1	0	0	0	0	112.6	F26 I27 M32 T33 L34 P45	F26-T30 HydrophobicContact CD1-CG2 4.29Å; F26-T30 HydrophobicContact CD2-CG2 4.23Å; F26-T30 HydrophobicContact CE1-CG2 3.88Å; F26-T30 HydrophobicContact CE2-CG2 3.81Å; F26-T30 HydrophobicContact CG-CG2 4.45Å; F26-T30 HydrophobicContact CZ-CG2 3.62Å; F26-T30 WeakPolarHBondContact O-CB 3.47Å; F26-T30 VanDerWaalsContact O-CG2 3.32Å; F26-T30 WeakPolarHBondContact O-CG2 3.39Å; F26-T30 PolarHBondContact O-N 3.33Å; F26-T30 PolarHBondContact O-OG1 2.95Å; I27-T30 WeakPolarHBondContact CA-OG1 3.49Å; I27-T30 PolarHBondContact O-N 3.35Å; I27-T30 PolarHBondContact O-OG1 3.08Å; T30-M32 VanDerWaalsContact C-N 3.31Å; T30-M32 PolarHBondContact O-N 3.25Å; T30-T33 WeakPolarHBondContact CA-OG1 3.46Å; T30-T33 PolarHBondContact O-N 3.41Å; T30-T33 PolarHBondContact O-OG1 3.2Å; T30-L34 WeakPolarHBondContact O-CB 3.4Å; T30-L34 WeakPolarHBondContact O-CD1 3.45Å; T30-L34 WeakPolarHBondContact O-CG 3.22Å; T30-L34 PolarHBondContact O-N 3.44Å; T30-P45 HydrophobicContact CG2-CB 3.77Å; T30-P45 HydrophobicContact CG2-CG 4.04Å
31	L	88.1	Confident	84	Confident	97 Å²	97	85.2 Å²	85.2	51%	0.508	46%	0.458	S	S	.	.	H	α-helix	trans	-62.9	-38.5	173.4	-75.2	167.9	0	0	0	112	I27 M28 N35	I27-L31 HydrophobicContact CG2-CD1 3.88Å; I27-L31 HydrophobicContact CG2-CG 4.48Å; I27-L31 WeakPolarHBondContact O-CB 3.37Å; I27-L31 VanDerWaalsContact O-CG 3.3Å; I27-L31 WeakPolarHBondContact O-CG 3.42Å; I27-L31 PolarHBondContact O-N 2.72Å; M28-L31 PolarHBondContact O-N 2.9Å; L31-N35 WeakPolarHBondContact O-CB 3.24Å; L31-N35 PolarHBondContact O-N 3Å; L31-N35 PolarHBondContact O-ND2 3.48Å
32	M	85.3	Confident	83.6	Confident	116 Å²	116	86.5 Å²	86.5	57%	0.571	47%	0.466	S	S	*	.	H	α-helix	trans	-69.3	-39.4	176.7	-70.3	-63.2	-165.2	0	0	112.7	M28 A29 T30 N35 T36	M28-M32 WeakPolarHBondContact O-CG 3.49Å; M28-M32 PolarHBondContact O-N 2.71Å; M28-M32 VanDerWaalsContact O-N 3.07Å; A29-M32 PolarHBondContact O-N 3.39Å; T30-M32 VanDerWaalsContact C-N 3.31Å; T30-M32 PolarHBondContact O-N 3.25Å; M32-N35 PolarHBondContact O-N 3.12Å; M32-T36 WeakPolarHBondContact O-CG2 3.5Å; M32-T36 PolarHBondContact O-N 2.98Å; M32-T36 VanDerWaalsContact O-N 3.12Å; M32-T36 PolarHBondContact O-OG1 3.28Å
33	T	84.8	Confident	83.4	Confident	16 Å²	16	89.2 Å²	89.2	10%	0.098	48%	0.48	C	S	.	.	H	α-helix	trans	-66.7	-39	176	59.5	0	0	0	0	111.5	A29 T30 T36 H37 S38 A41 N42 P45	A29-T33 WeakPolarHBondContact O-CG2 3.47Å; A29-T33 PolarHBondContact O-N 3.36Å; T30-T33 WeakPolarHBondContact CA-OG1 3.46Å; T30-T33 PolarHBondContact O-N 3.41Å; T30-T33 PolarHBondContact O-OG1 3.2Å; T33-T36 PolarHBondContact O-N 2.96Å; T33-T36 PolarHBondContact O-OG1 3.1Å; T33-H37 PolarHBondContact O-N 2.68Å; T33-S38 PolarHBondContact O-N 2.98Å; T33-A41 HydrophobicContact CG2-CB 3.78Å; T33-N42 PolarHBondContact OG1-OD1 3.21Å; T33-N42 VanDerWaalsContact OG1-OD1 3.07Å; T33-P45 HydrophobicContact CG2-CG 4.06Å
34	L	84.1	Confident	83.4	Confident	111 Å²	111	88.5 Å²	88.5	58%	0.581	48%	0.48	S	S	*	.	H	α-helix	trans	-63.5	-46	174.7	-72.3	167.9	0	0	0	111.9	T30 T36 H37	T30-L34 WeakPolarHBondContact O-CB 3.4Å; T30-L34 WeakPolarHBondContact O-CD1 3.45Å; T30-L34 WeakPolarHBondContact O-CG 3.22Å; T30-L34 PolarHBondContact O-N 3.44Å; L34-T36 VanDerWaalsContact C-N 3.29Å; L34-T36 PolarHBondContact O-N 3.07Å; L34-H37 PolarHBondContact O-N 3.27Å
35	N	83.6	Confident	83.3	Confident	123 Å²	123	85.5 Å²	85.5	66%	0.658	46%	0.458	S	S	*	.	H	α-helix	trans	-63.2	-33.4	178.6	-85.8	-27.7	0	0	0	113.3	L31 M32 H37	L31-N35 WeakPolarHBondContact O-CB 3.24Å; L31-N35 PolarHBondContact O-N 3Å; L31-N35 PolarHBondContact O-ND2 3.48Å; M32-N35 PolarHBondContact O-N 3.12Å; N35-H37 VanDerWaalsContact C-N 3.31Å
36	T	80.7	Confident	83.3	Confident	92 Å²	92	86.4 Å²	86.4	56%	0.564	46%	0.463	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.8	1.6	-179.1	54.9	0	0	0	0	113.4	M32 T33 L34 S38	M32-T36 WeakPolarHBondContact O-CG2 3.5Å; M32-T36 PolarHBondContact O-N 2.98Å; M32-T36 VanDerWaalsContact O-N 3.12Å; M32-T36 PolarHBondContact O-OG1 3.28Å; T33-T36 PolarHBondContact O-N 2.96Å; T33-T36 PolarHBondContact O-OG1 3.1Å; L34-T36 VanDerWaalsContact C-N 3.29Å; L34-T36 PolarHBondContact O-N 3.07Å; T36-S38 PolarHBondContact O-N 3.36Å; T36-S38 PolarHBondContact OG1-OG 3.48Å
37	H	76.6	Confident	83.4	Confident	174 Å²	174	85.2 Å²	85.2	81%	0.806	47%	0.465	S	S	*	.	T	Hydrogen-bonded Turn	trans	47	30.1	-176.6	-69	-71.6	0	0	0	113.9	T33 L34 N35 L39	T33-H37 PolarHBondContact O-N 2.68Å; L34-H37 PolarHBondContact O-N 3.27Å; N35-H37 VanDerWaalsContact C-N 3.31Å; H37-L39 PolarHBondContact O-N 3.35Å
38	S	74.1	Confident	83.3	Confident	43 Å²	43	85.8 Å²	85.8	30%	0.301	47%	0.467	S	S	.	.			trans	-97.9	91.7	-174.7	57.7	0	0	0	0	110.3	T33 T36 L40 A41	T33-S38 PolarHBondContact O-N 2.98Å; T36-S38 PolarHBondContact O-N 3.36Å; T36-S38 PolarHBondContact OG1-OG 3.48Å; S38-L40 PolarHBondContact O-N 3.43Å; S38-A41 WeakPolarHBondContact O-CB 3.32Å; S38-A41 PolarHBondContact O-N 2.72Å; S38-A41 WeakPolarHBondContact OG-CB 3.35Å
39	L	72.9	Confident	83.3	Confident	161 Å²	161	84.9 Å²	84.9	84%	0.843	46%	0.464	S	S	*	.	G	3₁₀ helix	trans	-59.4	-31.6	-178.4	-68.6	171.7	0	0	0	113.2	H37 A41 N42	H37-L39 PolarHBondContact O-N 3.35Å; L39-A41 VanDerWaalsContact C-N 3.35Å; L39-N42 WeakPolarHBondContact O-CB 3.22Å; L39-N42 PolarHBondContact O-N 3.07Å
40	L	76.3	Confident	83.6	Confident	151 Å²	151	87.3 Å²	87.3	79%	0.791	48%	0.475	S	S	*	.	G	3₁₀ helix	trans	-68.3	-31.6	175.2	-88.2	156.5	0	0	0	113	S38 N42 I43	S38-L40 PolarHBondContact O-N 3.43Å; L40-N42 PolarHBondContact O-N 3.03Å; L40-I43 PolarHBondContact O-N 3.08Å
41	A	78.8	Confident	83.7	Confident	29 Å²	29	92.8 Å²	92.8	24%	0.24	50%	0.497	C	S	.	.	G	3₁₀ helix	trans	-72	-14.7	-179.7	0	0	0	0	0	112.4	T33 S38 L39 I43 V44 P45	T33-A41 HydrophobicContact CG2-CB 3.78Å; S38-A41 WeakPolarHBondContact O-CB 3.32Å; S38-A41 PolarHBondContact O-N 2.72Å; S38-A41 WeakPolarHBondContact OG-CB 3.35Å; L39-A41 VanDerWaalsContact C-N 3.35Å; A41-I43 PolarHBondContact O-N 3.24Å; A41-V44 WeakPolarHBondContact O-CB 3.45Å; A41-V44 PolarHBondContact O-N 3.33Å; A41-P45 WeakPolarHBondContact O-CD 3.41Å
42	N	77.6	Confident	83.8	Confident	69 Å²	69	89 Å²	89	37%	0.369	48%	0.479	S	S	.	.	G	3₁₀ helix	trans	-66.9	-15.4	177.3	-124.2	25	0	0	0	113.7	T33 L39 L40 V44 P45 I46	T33-N42 PolarHBondContact OG1-OD1 3.21Å; T33-N42 VanDerWaalsContact OG1-OD1 3.07Å; L39-N42 WeakPolarHBondContact O-CB 3.22Å; L39-N42 PolarHBondContact O-N 3.07Å; L40-N42 PolarHBondContact O-N 3.03Å; N42-V44 VanDerWaalsContact C-N 3.27Å; N42-P45 WeakPolarHBondContact O-CD 3.48Å; N42-I46 WeakPolarHBondContact O-CD1 3.46Å; N42-I46 WeakPolarHBondContact O-CG1 3.39Å
43	I	85.1	Confident	83.9	Confident	112 Å²	112	86.2 Å²	86.2	57%	0.574	48%	0.475	S	S	*	.	H	α-helix	trans	-67.6	-31.6	171.6	-60.9	172.3	0	0	0	110.6	L40 A41 I46 A47	L40-I43 PolarHBondContact O-N 3.08Å; A41-I43 PolarHBondContact O-N 3.24Å; I43-I46 PolarHBondContact O-N 3.47Å; I43-A47 WeakPolarHBondContact O-CB 3.25Å; I43-A47 PolarHBondContact O-N 3.03Å
44	V	85.8	Confident	84.1	Confident	89 Å²	89	88.8 Å²	88.8	54%	0.539	49%	0.493	S	S	.	.	H	α-helix	trans	-66.2	-49.9	-175.6	179.2	0	0	0	0	112.3	A41 N42 I46 A47 M48	A41-V44 WeakPolarHBondContact O-CB 3.45Å; A41-V44 PolarHBondContact O-N 3.33Å; N42-V44 VanDerWaalsContact C-N 3.27Å; V44-I46 VanDerWaalsContact C-N 3.27Å; V44-I46 PolarHBondContact O-N 3.37Å; V44-A47 PolarHBondContact O-N 3.12Å; V44-M48 HydrophobicContact CG1-CG 4.4Å; V44-M48 WeakPolarHBondContact O-CB 3.42Å; V44-M48 VanDerWaalsContact O-CG 3.25Å; V44-M48 WeakPolarHBondContact O-CG 3.43Å; V44-M48 PolarHBondContact O-N 2.94Å
45	P	86.2	Confident	84.3	Confident	2 Å²	2	89.8 Å²	89.8	1%	0.013	49%	0.494	C	S	.	.	H	α-helix	trans	-57.8	-36.9	174.2	-24	30.9	0	0	0	113.7	F26 A29 T30 T33 A41 N42 L49	F26-P45 HydrophobicContact CD2-CB 3.87Å; F26-P45 HydrophobicContact CE2-CB 3.63Å; A29-P45 HydrophobicContact CB-CG 4.24Å; T30-P45 HydrophobicContact CG2-CB 3.77Å; T30-P45 HydrophobicContact CG2-CG 4.04Å; T33-P45 HydrophobicContact CG2-CG 4.06Å; A41-P45 WeakPolarHBondContact O-CD 3.41Å; N42-P45 WeakPolarHBondContact O-CD 3.48Å; P45-L49 WeakPolarHBondContact O-CB 3.42Å; P45-L49 PolarHBondContact O-N 3.39Å
46	I	88	Confident	84.4	Confident	105 Å²	105	85 Å²	85	54%	0.538	47%	0.472	S	S	.	.	H	α-helix	trans	-69.7	-47.3	-179.9	-60.9	168.1	0	0	0	110.2	N42 I43 V44 M48 L49 V50	N42-I46 WeakPolarHBondContact O-CD1 3.46Å; N42-I46 WeakPolarHBondContact O-CG1 3.39Å; I43-I46 PolarHBondContact O-N 3.47Å; V44-I46 VanDerWaalsContact C-N 3.27Å; V44-I46 PolarHBondContact O-N 3.37Å; I46-M48 VanDerWaalsContact C-N 3.32Å; I46-M48 PolarHBondContact O-N 3.44Å; I46-L49 PolarHBondContact O-N 3.03Å; I46-V50 WeakPolarHBondContact O-CG2 3.5Å; I46-V50 PolarHBondContact O-N 3.4Å; I46-V50 VanDerWaalsContact O-N 3.09Å
47	A	90.1	Very high	84.8	Confident	42 Å²	42	83.5 Å²	83.5	35%	0.347	47%	0.469	S	S	.	.	H	α-helix	trans	-59.8	-43.7	176	0	0	0	0	0	111.5	I43 V44 L49 V50 F51	I43-A47 WeakPolarHBondContact O-CB 3.25Å; I43-A47 PolarHBondContact O-N 3.03Å; V44-A47 PolarHBondContact O-N 3.12Å; A47-L49 VanDerWaalsContact C-N 3.31Å; A47-L49 PolarHBondContact O-N 3.04Å; A47-V50 PolarHBondContact O-N 2.94Å; A47-F51 VanDerWaalsContact O-CD2 3.22Å; A47-F51 WeakPolarHBondContact O-CD2 3.47Å; A47-F51 PolarHBondContact O-N 3.35Å; A47-F51 VanDerWaalsContact O-N 3.12Å
48	M	89.1	Confident	85.4	Confident	98 Å²	98	79.6 Å²	79.6	48%	0.483	46%	0.457	S	S	.	.	H	α-helix	trans	-57.4	-42	174.6	-75.1	-70.5	-68.1	0	0	112.3	V44 I46 F51 A52	V44-M48 HydrophobicContact CG1-CG 4.4Å; V44-M48 WeakPolarHBondContact O-CB 3.42Å; V44-M48 VanDerWaalsContact O-CG 3.25Å; V44-M48 WeakPolarHBondContact O-CG 3.43Å; V44-M48 PolarHBondContact O-N 2.94Å; I46-M48 VanDerWaalsContact C-N 3.32Å; I46-M48 PolarHBondContact O-N 3.44Å; M48-F51 PolarHBondContact O-N 3.31Å; M48-A52 WeakPolarHBondContact O-CB 3.42Å; M48-A52 PolarHBondContact O-N 3.24Å
49	L	89.3	Confident	86	Confident	90 Å²	90	78.3 Å²	78.3	47%	0.471	45%	0.451	S	S	.	.	H	α-helix	trans	-66.9	-37.9	179.6	-163.7	152.3	0	0	0	112	F26 P45 I46 A47 A52 A53	F26-L49 HydrophobicContact CD1-CD1 4.48Å; F26-L49 HydrophobicContact CD2-CB 4.33Å; F26-L49 HydrophobicContact CD2-CD1 3.82Å; F26-L49 HydrophobicContact CE1-CD1 4.4Å; F26-L49 HydrophobicContact CE2-CB 4.46Å; F26-L49 HydrophobicContact CE2-CD1 3.71Å; F26-L49 HydrophobicContact CG-CD1 4.2Å; F26-L49 HydrophobicContact CZ-CD1 4.02Å; P45-L49 WeakPolarHBondContact O-CB 3.42Å; P45-L49 PolarHBondContact O-N 3.39Å; I46-L49 PolarHBondContact O-N 3.03Å; A47-L49 VanDerWaalsContact C-N 3.31Å; A47-L49 PolarHBondContact O-N 3.04Å; L49-A52 WeakPolarHBondContact O-CB 3.3Å; L49-A52 PolarHBondContact O-N 3.08Å; L49-A53 PolarHBondContact O-N 3.37Å
50	V	92.8	Very high	86.6	Confident	83 Å²	83	74 Å²	74	50%	0.503	43%	0.428	S	S	.	.	H	α-helix	trans	-63.3	-48	175.7	175.6	0	0	0	0	111	I46 A47 A52 A53 C54	I46-V50 WeakPolarHBondContact O-CG2 3.5Å; I46-V50 PolarHBondContact O-N 3.4Å; I46-V50 VanDerWaalsContact O-N 3.09Å; A47-V50 PolarHBondContact O-N 2.94Å; V50-A52 VanDerWaalsContact C-N 3.31Å; V50-A52 PolarHBondContact O-N 3.33Å; V50-A53 PolarHBondContact O-N 3.35Å; V50-C54 PolarHBondContact O-N 3.48Å; V50-C54 VanDerWaalsContact O-N 3.08Å; V50-C54 PolarHBondContact O-SG 3.01Å
51	F	89.1	Confident	87.1	Confident	146 Å²	146	69.9 Å²	69.9	64%	0.64	42%	0.416	S	S	*	.	H	α-helix	trans	-61.9	-39	176.4	-77	-68.9	0	0	0	112.3	A47 M48 A53 C54 E55	A47-F51 VanDerWaalsContact O-CD2 3.22Å; A47-F51 WeakPolarHBondContact O-CD2 3.47Å; A47-F51 PolarHBondContact O-N 3.35Å; A47-F51 VanDerWaalsContact O-N 3.12Å; M48-F51 PolarHBondContact O-N 3.31Å; F51-A53 VanDerWaalsContact C-N 3.35Å; F51-A53 PolarHBondContact O-N 3.17Å; F51-C54 WeakPolarHBondContact O-CB 3.18Å; F51-C54 PolarHBondContact O-N 3.45Å; F51-E55 PolarHBondContact O-N 2.99Å
52	A	88.7	Confident	87.3	Confident	16 Å²	16	73.3 Å²	73.3	13%	0.132	43%	0.429	C	S	.	.	H	α-helix	trans	-58.5	-44.8	175.1	0	0	0	0	0	112.6	M22 M48 L49 V50 C54 E55 A56	M22-A52 HydrophobicContact CB-CB 4.12Å; M22-A52 HydrophobicContact CE-CB 3.26Å; M22-A52 HydrophobicContact CG-CB 4.11Å; M48-A52 WeakPolarHBondContact O-CB 3.42Å; M48-A52 PolarHBondContact O-N 3.24Å; L49-A52 WeakPolarHBondContact O-CB 3.3Å; L49-A52 PolarHBondContact O-N 3.08Å; V50-A52 VanDerWaalsContact C-N 3.31Å; V50-A52 PolarHBondContact O-N 3.33Å; A52-C54 VanDerWaalsContact C-N 3.32Å; A52-C54 PolarHBondContact O-N 3.15Å; A52-E55 PolarHBondContact O-N 3.47Å; A52-A56 WeakPolarHBondContact O-CB 3.42Å; A52-A56 PolarHBondContact O-N 3.18Å
53	A	88.8	Confident	87.5	Confident	58 Å²	58	70.6 Å²	70.6	48%	0.479	42%	0.415	S	S	.	.	H	α-helix	trans	-65.2	-36.8	177.9	0	0	0	0	0	111.8	L49 V50 F51 A56 A57	L49-A53 PolarHBondContact O-N 3.37Å; V50-A53 PolarHBondContact O-N 3.35Å; F51-A53 VanDerWaalsContact C-N 3.35Å; F51-A53 PolarHBondContact O-N 3.17Å; A53-A56 PolarHBondContact O-N 2.89Å; A53-A57 WeakPolarHBondContact O-CB 3.43Å; A53-A57 PolarHBondContact O-N 3.36Å
54	C	89.6	Confident	87.4	Confident	70 Å²	70	69 Å²	69	47%	0.473	41%	0.41	S	S	.	.	H	α-helix	trans	-63.7	-45.4	174.6	-64.9	0	0	0	0	112	V50 F51 A52 A57 V58	V50-C54 PolarHBondContact O-N 3.48Å; V50-C54 VanDerWaalsContact O-N 3.08Å; V50-C54 PolarHBondContact O-SG 3.01Å; F51-C54 WeakPolarHBondContact O-CB 3.18Å; F51-C54 PolarHBondContact O-N 3.45Å; A52-C54 VanDerWaalsContact C-N 3.32Å; A52-C54 PolarHBondContact O-N 3.15Å; C54-A57 PolarHBondContact O-N 3.39Å; C54-V58 WeakPolarHBondContact O-CG2 3.45Å; C54-V58 PolarHBondContact O-N 2.97Å
55	E	86.7	Confident	87.2	Confident	132 Å²	132	67.5 Å²	67.5	62%	0.617	40%	0.404	S	S	*	.	H	α-helix	trans	-62.4	-42.6	176.4	-70.9	-174.6	168	0	0	111.9	F51 A52 A57 V58 G59	F51-E55 PolarHBondContact O-N 2.99Å; A52-E55 PolarHBondContact O-N 3.47Å; E55-A57 PolarHBondContact O-N 3.19Å; E55-V58 PolarHBondContact O-N 3.13Å; E55-G59 PolarHBondContact O-N 3.09Å
56	A	87.3	Confident	86.8	Confident	24 Å²	24	68.8 Å²	68.8	20%	0.198	41%	0.41	C	S	.	.	H	α-helix	trans	-62.2	-42.2	176.1	0	0	0	0	0	112.1	A52 A53 V58 G59 L60	A52-A56 WeakPolarHBondContact O-CB 3.42Å; A52-A56 PolarHBondContact O-N 3.18Å; A53-A56 PolarHBondContact O-N 2.89Å; A56-V58 PolarHBondContact O-N 3.47Å; A56-G59 PolarHBondContact O-N 3.05Å; A56-L60 WeakPolarHBondContact O-CG 3.07Å; A56-L60 PolarHBondContact O-N 3.44Å
57	A	88.9	Confident	86.3	Confident	60 Å²	60	65.3 Å²	65.3	50%	0.496	40%	0.395	S	S	.	.	H	α-helix	trans	-62.2	-43.4	176.7	0	0	0	0	0	112.2	A53 C54 E55 L60 A61	A53-A57 WeakPolarHBondContact O-CB 3.43Å; A53-A57 PolarHBondContact O-N 3.36Å; C54-A57 PolarHBondContact O-N 3.39Å; E55-A57 PolarHBondContact O-N 3.19Å; A57-L60 PolarHBondContact O-N 3.13Å; A57-A61 WeakPolarHBondContact O-CB 3.32Å; A57-A61 PolarHBondContact O-N 3.37Å
58	V	88.2	Confident	85.8	Confident	91 Å²	91	69.4 Å²	69.4	55%	0.552	41%	0.411	S	S	*	.	H	α-helix	trans	-65.6	-41.5	175.2	175.9	0	0	0	0	111	C54 E55 A56 L60 A61 L62	C54-V58 WeakPolarHBondContact O-CG2 3.45Å; C54-V58 PolarHBondContact O-N 2.97Å; E55-V58 PolarHBondContact O-N 3.13Å; A56-V58 PolarHBondContact O-N 3.47Å; V58-L60 PolarHBondContact O-N 3.38Å; V58-A61 PolarHBondContact O-N 2.69Å; V58-L62 HydrophobicContact CG1-CD1 4.38Å; V58-L62 WeakPolarHBondContact O-CG 3.46Å; V58-L62 PolarHBondContact O-N 3.2Å
59	G	86.9	Confident	85.1	Confident	16 Å²	16	69.5 Å²	69.5	17%	0.165	42%	0.418	C	S	.	.	H	α-helix	trans	-60.5	-42.5	176.3	0	0	0	0	0	113.2	E55 A56 L62 L63	E55-G59 PolarHBondContact O-N 3.09Å; A56-G59 PolarHBondContact O-N 3.05Å; G59-L62 PolarHBondContact O-N 3.42Å; G59-L63 PolarHBondContact O-N 3.01Å
60	L	84.7	Confident	84.1	Confident	72 Å²	72	68.7 Å²	68.7	38%	0.377	41%	0.409	S	S	.	.	H	α-helix	trans	-67	-41.7	174.5	-74.7	165.3	0	0	0	112.1	L15 A56 A57 V58 L62 L63 V64	L15-L60 HydrophobicContact CD1-CD2 3.95Å; L15-L60 HydrophobicContact CD1-CG 4.35Å; A56-L60 WeakPolarHBondContact O-CG 3.07Å; A56-L60 PolarHBondContact O-N 3.44Å; A57-L60 PolarHBondContact O-N 3.13Å; V58-L60 PolarHBondContact O-N 3.38Å; L60-L62 VanDerWaalsContact C-N 3.3Å; L60-L62 PolarHBondContact O-N 3.28Å; L60-L63 WeakPolarHBondContact O-CB 3.5Å; L60-L63 PolarHBondContact O-N 3.01Å; L60-L63 VanDerWaalsContact O-N 3.16Å; L60-V64 WeakPolarHBondContact O-CG2 3.44Å; L60-V64 PolarHBondContact O-N 3.28Å
61	A	87	Confident	82.8	Confident	63 Å²	63	67.6 Å²	67.6	52%	0.521	41%	0.414	S	S	.	.	H	α-helix	trans	-60.3	-41	176.2	0	0	0	0	0	111.9	A57 V58 V64 S65	A57-A61 WeakPolarHBondContact O-CB 3.32Å; A57-A61 PolarHBondContact O-N 3.37Å; V58-A61 PolarHBondContact O-N 2.69Å; A61-V64 PolarHBondContact O-N 3.21Å; A61-S65 PolarHBondContact O-N 3.42Å
62	L	82.9	Confident	81.5	Confident	101 Å²	101	65.2 Å²	65.2	53%	0.529	41%	0.408	S	S	.	.	H	α-helix	trans	-63.6	-43	173.3	-74.9	171.6	0	0	0	111.8	V58 G59 L60 V64 S65 I66	V58-L62 HydrophobicContact CG1-CD1 4.38Å; V58-L62 WeakPolarHBondContact O-CG 3.46Å; V58-L62 PolarHBondContact O-N 3.2Å; G59-L62 PolarHBondContact O-N 3.42Å; L60-L62 VanDerWaalsContact C-N 3.3Å; L60-L62 PolarHBondContact O-N 3.28Å; L62-V64 VanDerWaalsContact C-N 3.31Å; L62-V64 PolarHBondContact O-N 2.96Å; L62-S65 WeakPolarHBondContact O-CB 3.34Å; L62-S65 PolarHBondContact O-N 3.22Å; L62-S65 VanDerWaalsContact O-N 3.07Å; L62-S65 PolarHBondContact O-OG 3.38Å; L62-I66 WeakPolarHBondContact O-CG1 3.47Å; L62-I66 PolarHBondContact O-N 3.23Å
63	L	82.5	Confident	80.2	Confident	12 Å²	12	67.1 Å²	67.1	6%	0.063	42%	0.416	C	S	.	.	H	α-helix	trans	-59	-44.5	176.7	-167.1	157.6	0	0	0	111.4	L11 M12 L15 G59 L60 S65 I66 S67	L11-L63 HydrophobicContact CB-CD1 4.02Å; L11-L63 HydrophobicContact CB-CG 4.48Å; L11-L63 HydrophobicContact CD2-CB 4.05Å; L11-L63 HydrophobicContact CD2-CD1 3.64Å; L11-L63 HydrophobicContact CD2-CG 3.97Å; L11-L63 HydrophobicContact CG-CD1 4.46Å; M12-L63 HydrophobicContact CB-CD1 4.47Å; M12-L63 HydrophobicContact CG-CD1 3.73Å; M12-L63 HydrophobicContact CG-CD2 4.47Å; M12-L63 HydrophobicContact SD-CD1 3.28Å; M12-L63 WeakPolarHBondContact SD-CD1 3.48Å; M12-L63 HydrophobicContact SD-CD2 3.98Å; M12-L63 HydrophobicContact SD-CG 4.31Å; L15-L63 HydrophobicContact CD1-CB 4.33Å; L15-L63 HydrophobicContact CD1-CD1 3.48Å; L15-L63 VanDerWaalsContact CD1-CD1 3.48Å; G59-L63 PolarHBondContact O-N 3.01Å; L60-L63 WeakPolarHBondContact O-CB 3.5Å; L60-L63 PolarHBondContact O-N 3.01Å; L60-L63 VanDerWaalsContact O-N 3.16Å; L63-S65 VanDerWaalsContact C-N 3.28Å; L63-S65 PolarHBondContact O-N 3.12Å; L63-I66 PolarHBondContact O-N 3.45Å; L63-S67 PolarHBondContact O-N 2.87Å; L63-S67 PolarHBondContact O-OG 2.91Å
64	V	83.5	Confident	78.9	Confident	78 Å²	78	68.9 Å²	68.9	47%	0.473	41%	0.41	S	S	.	.	H	α-helix	trans	-61.4	-36.5	175.2	174.4	0	0	0	0	111.7	L60 A61 L62 S67 N68	L60-V64 WeakPolarHBondContact O-CG2 3.44Å; L60-V64 PolarHBondContact O-N 3.28Å; A61-V64 PolarHBondContact O-N 3.21Å; L62-V64 VanDerWaalsContact C-N 3.31Å; L62-V64 PolarHBondContact O-N 2.96Å; V64-S67 WeakPolarHBondContact CA-OG 3.41Å; V64-S67 PolarHBondContact O-OG 3.1Å; V64-N68 WeakPolarHBondContact O-CB 3.42Å; V64-N68 VanDerWaalsContact O-CG 3.3Å; V64-N68 PolarHBondContact O-N 2.89Å; V64-N68 PolarHBondContact O-ND2 2.9Å
65	S	81.4	Confident	77.4	Confident	58 Å²	58	67.9 Å²	67.9	41%	0.406	40%	0.402	S	S	.	.	H	α-helix	trans	-68.1	-37.1	175.6	77.2	0	0	0	0	112.8	A61 L62 L63 T69	A61-S65 PolarHBondContact O-N 3.42Å; L62-S65 WeakPolarHBondContact O-CB 3.34Å; L62-S65 PolarHBondContact O-N 3.22Å; L62-S65 VanDerWaalsContact O-N 3.07Å; L62-S65 PolarHBondContact O-OG 3.38Å; L63-S65 VanDerWaalsContact C-N 3.28Å; L63-S65 PolarHBondContact O-N 3.12Å; S65-T69 WeakPolarHBondContact O-CG2 3.41Å; S65-T69 PolarHBondContact O-N 3.46Å; S65-T69 VanDerWaalsContact O-N 3.15Å; S65-T69 PolarHBondContact O-OG1 2.97Å
66	I	76.6	Confident	75.9	Confident	29 Å²	29	69.2 Å²	69.2	15%	0.149	41%	0.408	C	S	.	.	H	α-helix	trans	-70.4	-42.4	176.9	-65.2	164.6	0	0	0	110.2	L11 L62 L63 N68 T69 Y70 L78	L11-I66 HydrophobicContact CD1-CD1 4.18Å; L62-I66 WeakPolarHBondContact O-CG1 3.47Å; L62-I66 PolarHBondContact O-N 3.23Å; L63-I66 PolarHBondContact O-N 3.45Å; I66-N68 VanDerWaalsContact C-N 3.33Å; I66-N68 PolarHBondContact O-N 3.41Å; I66-T69 WeakPolarHBondContact CA-OG1 3.4Å; I66-T69 PolarHBondContact O-N 3.46Å; I66-T69 PolarHBondContact O-OG1 3.43Å; I66-T69 VanDerWaalsContact O-OG1 3.07Å; I66-Y70 HydrophobicContact CG2-CD2 4.13Å; I66-Y70 PolarHBondContact O-N 3.48Å; I66-L78 HydrophobicContact CD1-CD1 4.41Å
67	S	77.6	Confident	74.4	Confident	32 Å²	32	71.6 Å²	71.6	22%	0.224	42%	0.418	C	S	.	.	H	α-helix	trans	-66.2	-36.1	178.2	71	0	0	0	0	111.9	L63 V64 G71 D73	L63-S67 PolarHBondContact O-N 2.87Å; L63-S67 PolarHBondContact O-OG 2.91Å; V64-S67 WeakPolarHBondContact CA-OG 3.41Å; V64-S67 PolarHBondContact O-OG 3.1Å; S67-G71 WeakPolarHBondContact O-CA 3.21Å; S67-G71 PolarHBondContact O-N 3.07Å; S67-D73 WeakPolarHBondContact CB-OD1 3.46Å
68	N	79.6	Confident	73	Confident	128 Å²	128	71.7 Å²	71.7	68%	0.684	41%	0.41	S	S	*	.	H	α-helix	trans	-69.3	-31.9	174.3	-78.1	-42.8	0	0	0	113.7	V64 I66	V64-N68 WeakPolarHBondContact O-CB 3.42Å; V64-N68 VanDerWaalsContact O-CG 3.3Å; V64-N68 PolarHBondContact O-N 2.89Å; V64-N68 PolarHBondContact O-ND2 2.9Å; I66-N68 VanDerWaalsContact C-N 3.33Å; I66-N68 PolarHBondContact O-N 3.41Å
69	T	74.4	Confident	71.6	Confident	101 Å²	101	72 Å²	72	62%	0.62	41%	0.408	S	S	*	.	H	α-helix	trans	-86	-37	-177.8	45.5	0	0	0	0	113	S65 I66	S65-T69 WeakPolarHBondContact O-CG2 3.41Å; S65-T69 PolarHBondContact O-N 3.46Å; S65-T69 VanDerWaalsContact O-N 3.15Å; S65-T69 PolarHBondContact O-OG1 2.97Å; I66-T69 WeakPolarHBondContact CA-OG1 3.4Å; I66-T69 PolarHBondContact O-N 3.46Å; I66-T69 PolarHBondContact O-OG1 3.43Å; I66-T69 VanDerWaalsContact O-OG1 3.07Å
70	Y	69.1	Low	70.3	Confident	72 Å²	72	77.2 Å²	77.2	28%	0.282	43%	0.431	S	S	.	.	H	α-helix	trans	-111	-4	-175.1	-65.9	-78.8	0	0	0	114.3	I66 L72 N77 L78 L80	I66-Y70 HydrophobicContact CG2-CD2 4.13Å; I66-Y70 PolarHBondContact O-N 3.48Å; Y70-L72 PolarHBondContact O-N 3.07Å; Y70-N77 HydrophobicContact CD1-CB 3.75Å; Y70-N77 HydrophobicContact CE1-CB 4.33Å; Y70-N77 WeakPolarHBondContact CE1-O 3.42Å; Y70-N77 HydrophobicContact CG-CB 4.01Å; Y70-L78 HydrophobicContact CE2-CD2 3.87Å; Y70-L80 HydrophobicContact CE1-CD1 3.99Å; Y70-L80 VanDerWaalsContact OH-CD1 3.29Å; Y70-L80 WeakPolarHBondContact OH-CD1 3.45Å
71	G	65.3	Low	69.1	Low	60 Å²	60	81.4 Å²	81.4	62%	0.619	45%	0.453	S	S	*	.	S	Bend	trans	68.2	-9.3	178.4	0	0	0	0	0	115.3	S67	S67-G71 WeakPolarHBondContact O-CA 3.21Å; S67-G71 PolarHBondContact O-N 3.07Å
72	L	61.6	Low	67.6	Low	96 Å²	96	85.4 Å²	85.4	50%	0.503	46%	0.461	S	S	.	.	S	Bend	trans	-143.5	137.2	-175.5	-63.7	170.8	0	0	0	110.1	Y70 Y74	Y70-L72 PolarHBondContact O-N 3.07Å; L72-Y74 HydrophobicContact CB-CD2 3.69Å; L72-Y74 HydrophobicContact CB-CE2 4.26Å; L72-Y74 HydrophobicContact CD1-CD2 4.11Å; L72-Y74 HydrophobicContact CD1-CE2 4.29Å; L72-Y74 HydrophobicContact CG-CD2 4.4Å; L72-Y74 PolarHBondContact O-N 2.99Å
73	D	61.1	Low	66.3	Low	56 Å²	56	88.9 Å²	88.9	30%	0.299	49%	0.492	S	S	.	.			trans	-71.4	22.1	-177.5	-61.3	-30.6	0	0	0	114.6	S67	S67-D73 WeakPolarHBondContact CB-OD1 3.46Å
74	Y	61.3	Low	65.5	Low	95 Å²	95	92.8 Å²	92.8	37%	0.373	51%	0.514	S	S	.	.	B	Isolated β-bridge	trans	-85.6	118.2	-175.7	-70.4	-60.3	0	0	0	111.6	S9 H10 L72 H76 N77	S9-Y74 WeakPolarHBondContact O-CA 3.3Å; S9-Y74 WeakPolarHBondContact O-CD1 3.42Å; H10-Y74 AromaticContact CE1-CE1 3.58Å; H10-Y74 AromaticContact CE1-CZ 3.88Å; H10-Y74 AromaticContact NE2-CE1 3.95Å; L72-Y74 HydrophobicContact CB-CD2 3.69Å; L72-Y74 HydrophobicContact CB-CE2 4.26Å; L72-Y74 HydrophobicContact CD1-CD2 4.11Å; L72-Y74 HydrophobicContact CD1-CE2 4.29Å; L72-Y74 HydrophobicContact CG-CD2 4.4Å; L72-Y74 PolarHBondContact O-N 2.99Å; Y74-H76 PolarHBondContact O-N 3Å; Y74-H76 VanDerWaalsContact O-N 3.11Å; Y74-N77 PolarHBondContact O-N 3.49Å; Y74-N77 VanDerWaalsContact O-N 3.15Å
75	V	58.4	Low	64.5	Low	50 Å²	50	93.5 Å²	93.5	30%	0.303	52%	0.516	S	S	.	.	G	3₁₀ helix	trans	-58.3	-25.3	174.8	-168.6	0	0	0	0	112.1	L11 N77 L78	L11-V75 HydrophobicContact CB-CG2 4.29Å; L11-V75 HydrophobicContact CD1-CG2 4.04Å; V75-N77 PolarHBondContact O-N 2.94Å; V75-L78 HydrophobicContact CG1-CD1 4.39Å; V75-L78 PolarHBondContact O-N 2.94Å
76	H	55.8	Low	63.6	Low	159 Å²	159	95.5 Å²	95.5	74%	0.736	52%	0.522	S	S	*	.	G	3₁₀ helix	trans	-66.8	-18.8	-179.8	-154.7	-37.1	0	0	0	113.8	Y74 L78	Y74-H76 PolarHBondContact O-N 3Å; Y74-H76 VanDerWaalsContact O-N 3.11Å; H76-L78 VanDerWaalsContact C-N 3.29Å; H76-L78 PolarHBondContact O-N 2.99Å
77	N	56.3	Low	62.8	Low	75 Å²	75	99.4 Å²	99.4	40%	0.401	54%	0.544	S	S	.	.	G	3₁₀ helix	trans	-77.6	-10.8	177.1	-96.8	21.6	0	0	0	113.7	Y70 Y74 V75 N79	Y70-N77 HydrophobicContact CD1-CB 3.75Å; Y70-N77 HydrophobicContact CE1-CB 4.33Å; Y70-N77 WeakPolarHBondContact CE1-O 3.42Å; Y70-N77 HydrophobicContact CG-CB 4.01Å; Y74-N77 PolarHBondContact O-N 3.49Å; Y74-N77 VanDerWaalsContact O-N 3.15Å; V75-N77 PolarHBondContact O-N 2.94Å; N77-N79 PolarHBondContact O-N 3.23Å; N77-N79 VanDerWaalsContact O-N 3.1Å
78	L	59	Low	61.9	Low	62 Å²	62	103.6 Å²	103.6	33%	0.325	56%	0.564	S	S	.	*	G	3₁₀ helix	trans	-80.4	23.1	-179.9	-66.2	166.5	0	0	0	113.7	I66 Y70 V75 H76 L80	I66-L78 HydrophobicContact CD1-CD1 4.41Å; Y70-L78 HydrophobicContact CE2-CD2 3.87Å; V75-L78 HydrophobicContact CG1-CD1 4.39Å; V75-L78 PolarHBondContact O-N 2.94Å; H76-L78 VanDerWaalsContact C-N 3.29Å; H76-L78 PolarHBondContact O-N 2.99Å; L78-L80 PolarHBondContact O-N 3.31Å
79	N	59.6	Low	60.7	Low	98 Å²	98	102 Å²	102	52%	0.524	56%	0.556	S	S	.	*	G	3₁₀ helix	trans	-80.3	4.8	-176.1	-130.2	35.7	0	0	0	114.4	N77 L81 Q82	N77-N79 PolarHBondContact O-N 3.23Å; N77-N79 VanDerWaalsContact O-N 3.1Å; N79-L81 VanDerWaalsContact C-N 3.29Å; N79-L81 PolarHBondContact O-N 3.37Å; N79-Q82 PolarHBondContact ND2-OE1 3.41Å; N79-Q82 PolarHBondContact O-N 3.45Å; N79-Q82 PolarHBondContact OD1-OE1 2.99Å
80	L	58.7	Low	59.8	Low	124 Å²	124	102.1 Å²	102.1	65%	0.649	55%	0.551	S	S	*	*	G	3₁₀ helix	trans	-70.5	-21.6	177.6	-84.8	156.7	0	0	0	113.8	Y70 L78 Q82	Y70-L80 HydrophobicContact CE1-CD1 3.99Å; Y70-L80 VanDerWaalsContact OH-CD1 3.29Å; Y70-L80 WeakPolarHBondContact OH-CD1 3.45Å; L78-L80 PolarHBondContact O-N 3.31Å; L80-Q82 VanDerWaalsContact C-N 3.29Å
81	L	59.6	Low	59.1	Low	160 Å²	160	104.4 Å²	104.4	84%	0.838	57%	0.572	S	S	*	*	G	3₁₀ helix	trans	-85.5	2.4	177.5	-78.7	154.6	0	0	0	113.5	N79	N79-L81 VanDerWaalsContact C-N 3.29Å; N79-L81 PolarHBondContact O-N 3.37Å
82	Q	55.2	Low	58.5	Low	148 Å²	148	108.1 Å²	108.1	69%	0.692	57%	0.568	S	S	*	*	G	3₁₀ helix	trans	-84.3	0.3	174.8	-154.5	-178.3	-17	0	0	112.7	N79 L80	N79-Q82 PolarHBondContact ND2-OE1 3.41Å; N79-Q82 PolarHBondContact O-N 3.45Å; N79-Q82 PolarHBondContact OD1-OE1 2.99Å; L80-Q82 VanDerWaalsContact C-N 3.29Å
83	C	55.9	Low	58.3	Low	174 Å²	174	109.2 Å²	109.2	100%	1.176	57%	0.574	S	S	*	*			trans	-84.4	0	168	-68.4	0	0	0	0	110.6

Retrieved 83 of 83 residues in 158.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).