A0A059RP56_HUMAN Loading...

NADH-ubiquinone oxidoreductase chain 4L

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Part of the enzyme membrane arm which is embedded in the lipid bilayer and involved in proton translocation.

AlphaFold DB , UniProt , Accession A0A059RP56, Species HUMAN (Homo sapiens, Human), Gene ND4L, Length 79 aa.

						>A0A059RP56_HUMAN|A0A059RP56|ND4L
LVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	L	40.6	Very low	63.7	Low	203 Å²	203	92.8 Å²	92.8	100%	1.063	46%	0.46	S	S	*	.				0	-21.4	0	-115.8	150.3	0	0	0	113.9
2	V	48.3	Very low	65.3	Low	131 Å²	131	94.4 Å²	94.4	79%	0.794	47%	0.471	S	S	*	.			trans	-91.1	-18.2	-172.3	-177.1	0	0	0	0	115	R4	V2-R4 PolarHBondContact O-N 3.45Å
3	Y	49.1	Very low	66.9	Low	172 Å²	172	93.4 Å²	93.4	68%	0.675	48%	0.477	S	S	*	.			trans	-76.7	65.2	166.8	-95.1	-88.2	0	0	0	110.2	S5 V71	Y3-S5 VanDerWaalsContact C-N 3.27Å; Y3-S5 PolarHBondContact O-N 3.39Å; Y3-V71 HydrophobicContact CD1-CG2 4.39Å
4	R	50.6	Low	68.2	Low	190 Å²	190	93.1 Å²	93.1	72%	0.717	48%	0.476	S	S	*	.			trans	-74.3	89.1	172.6	-98.3	-99.5	177.4	123.5	-3.3	107.5	V2 H6	V2-R4 PolarHBondContact O-N 3.45Å; R4-H6 PolarHBondContact O-N 3.41Å
5	S	56.3	Low	69.4	Low	35 Å²	35	93.1 Å²	93.1	25%	0.245	47%	0.473	C	S	.	.	S	Bend	trans	55.3	-24	158.6	47.7	0	0	0	0	120.5	Y3 D69 Y70	Y3-S5 VanDerWaalsContact C-N 3.27Å; Y3-S5 PolarHBondContact O-N 3.39Å; S5-D69 CarbonylContact O-C 3.53Å; S5-Y70 WeakPolarHBondContact O-CA 3.44Å
6	H	66.1	Low	70.5	Confident	79 Å²	79	89.9 Å²	89.9	37%	0.366	47%	0.471	S	S	.	.			trans	-120.1	111.4	-169.4	-63.9	-74.1	0	0	0	109.4	R4 M8 S9	R4-H6 PolarHBondContact O-N 3.41Å; H6-M8 PolarHBondContact O-N 3.4Å; H6-M8 VanDerWaalsContact O-N 3.12Å; H6-S9 PolarHBondContact O-N 3.4Å; H6-S9 PolarHBondContact O-OG 3.07Å
7	L	70.5	Confident	71.7	Confident	33 Å²	33	90.8 Å²	90.8	17%	0.173	47%	0.474	C	S	.	.	H	α-helix	trans	-56.3	-26.1	175	-149.3	151.4	0	0	0	111.5	S9 S10 L11 L59 I62 V71	L7-S9 PolarHBondContact O-N 3.33Å; L7-S10 WeakPolarHBondContact CA-OG 3.46Å; L7-S10 PolarHBondContact O-N 2.65Å; L7-S10 PolarHBondContact O-OG 3.02Å; L7-L11 HydrophobicContact CD2-CD1 4.06Å; L7-L11 HydrophobicContact CD2-CG 4.28Å; L7-L11 PolarHBondContact O-N 3.09Å; L7-L59 HydrophobicContact CB-CD1 3.76Å; L7-L59 HydrophobicContact CB-CG 4.18Å; L7-L59 HydrophobicContact CD2-CB 4.25Å; L7-L59 HydrophobicContact CD2-CD1 3.77Å; L7-L59 HydrophobicContact CD2-CG 4.17Å; L7-L59 HydrophobicContact CG-CD1 4.35Å; L7-I62 HydrophobicContact CD1-CD1 3.88Å; L7-V71 HydrophobicContact CB-CG2 4.39Å; L7-V71 HydrophobicContact CD1-CG2 4.19Å; L7-V71 HydrophobicContact CG-CG2 4.44Å
8	M	76.3	Confident	72.7	Confident	83 Å²	83	88.6 Å²	88.6	41%	0.409	46%	0.461	S	S	.	.	H	α-helix	trans	-57	-42.2	170.5	-68.7	-61	-71.4	0	0	113.5	H6 L11 L12 L56 L59	H6-M8 PolarHBondContact O-N 3.4Å; H6-M8 VanDerWaalsContact O-N 3.12Å; M8-L11 PolarHBondContact O-N 3.49Å; M8-L12 PolarHBondContact O-N 3.06Å; M8-L56 HydrophobicContact CE-CD2 4.49Å; M8-L56 HydrophobicContact SD-CD2 4.26Å; M8-L59 HydrophobicContact CB-CD1 4.45Å; M8-L59 HydrophobicContact CG-CD1 3.72Å; M8-L59 HydrophobicContact CG-CD2 4.42Å; M8-L59 HydrophobicContact SD-CD1 3.32Å; M8-L59 WeakPolarHBondContact SD-CD1 3.31Å; M8-L59 HydrophobicContact SD-CD2 4.05Å; M8-L59 HydrophobicContact SD-CG 4.34Å
9	S	79.2	Confident	73.6	Confident	50 Å²	50	89.5 Å²	89.5	35%	0.35	47%	0.467	S	S	.	.	H	α-helix	trans	-69.2	-35.8	-178.8	66.3	0	0	0	0	112.1	H6 L7 C13	H6-S9 PolarHBondContact O-N 3.4Å; H6-S9 PolarHBondContact O-OG 3.07Å; L7-S9 PolarHBondContact O-N 3.33Å; S9-C13 PolarHBondContact O-N 3.13Å; S9-C13 VanDerWaalsContact O-N 3.1Å
10	S	80.9	Confident	74.5	Confident	22 Å²	22	88.4 Å²	88.4	15%	0.154	47%	0.466	C	S	.	.	H	α-helix	trans	-67.8	-37	172.4	46	0	0	0	0	112.7	L7 C13 L14	L7-S10 WeakPolarHBondContact CA-OG 3.46Å; L7-S10 PolarHBondContact O-N 2.65Å; L7-S10 PolarHBondContact O-OG 3.02Å; S10-C13 PolarHBondContact O-N 3.38Å; S10-L14 PolarHBondContact O-N 3.04Å
11	L	82.9	Confident	75.2	Confident	23 Å²	23	88.2 Å²	88.2	12%	0.12	47%	0.466	C	S	.	.	H	α-helix	trans	-63.6	-44.9	175.3	-77.3	165.8	0	0	0	111.3	L7 M8 C13 L14 E15 L56 L59	L7-L11 HydrophobicContact CD2-CD1 4.06Å; L7-L11 HydrophobicContact CD2-CG 4.28Å; L7-L11 PolarHBondContact O-N 3.09Å; M8-L11 PolarHBondContact O-N 3.49Å; L11-C13 VanDerWaalsContact C-N 3.32Å; L11-C13 PolarHBondContact O-N 3.22Å; L11-L14 WeakPolarHBondContact O-CB 3.5Å; L11-L14 PolarHBondContact O-N 2.95Å; L11-L14 VanDerWaalsContact O-N 3.12Å; L11-E15 PolarHBondContact O-N 3.02Å; L11-L56 HydrophobicContact CD1-CD2 3.97Å; L11-L56 HydrophobicContact CD1-CG 4.37Å; L11-L59 HydrophobicContact CD1-CB 4.44Å; L11-L59 HydrophobicContact CD1-CD1 3.5Å; L11-L59 VanDerWaalsContact CD1-CD1 3.5Å
12	L	83.2	Confident	77.6	Confident	112 Å²	112	81.8 Å²	81.8	59%	0.586	43%	0.429	S	S	*	.	H	α-helix	trans	-61.6	-38.3	175.4	-73.8	170.1	0	0	0	112.6	M8 E15 G16	M8-L12 PolarHBondContact O-N 3.06Å; L12-E15 PolarHBondContact O-N 2.96Å; L12-G16 PolarHBondContact O-N 2.89Å
13	C	85.8	Confident	79.7	Confident	81 Å²	81	79.5 Å²	79.5	55%	0.547	41%	0.412	S	S	.	.	H	α-helix	trans	-64.5	-39.6	173.5	-79.4	0	0	0	0	112.3	S9 S10 L11 G16 M17	S9-C13 PolarHBondContact O-N 3.13Å; S9-C13 VanDerWaalsContact O-N 3.1Å; S10-C13 PolarHBondContact O-N 3.38Å; L11-C13 VanDerWaalsContact C-N 3.32Å; L11-C13 PolarHBondContact O-N 3.22Å; C13-G16 PolarHBondContact O-N 2.92Å; C13-M17 WeakPolarHBondContact O-CG 3.39Å; C13-M17 PolarHBondContact O-N 3.08Å
14	L	84.6	Confident	81.6	Confident	89 Å²	89	76.6 Å²	76.6	47%	0.466	41%	0.405	S	S	.	.	H	α-helix	trans	-62.3	-45.1	174.5	-95.7	160.1	0	0	0	111.6	S10 L11 G16 M17 M18	S10-L14 PolarHBondContact O-N 3.04Å; L11-L14 WeakPolarHBondContact O-CB 3.5Å; L11-L14 PolarHBondContact O-N 2.95Å; L11-L14 VanDerWaalsContact O-N 3.12Å; L14-G16 VanDerWaalsContact C-N 3.31Å; L14-G16 PolarHBondContact O-N 3.28Å; L14-M17 HydrophobicContact CB-CE 4.47Å; L14-M17 HydrophobicContact CD2-CE 3.76Å; L14-M17 HydrophobicContact CG-CE 3.92Å; L14-M17 PolarHBondContact O-N 3.08Å; L14-M18 WeakPolarHBondContact O-CG 3.18Å; L14-M18 PolarHBondContact O-N 3.15Å
15	E	86.5	Confident	83.4	Confident	93 Å²	93	68.9 Å²	68.9	44%	0.435	38%	0.383	S	S	.	.	H	α-helix	trans	-59.1	-42.3	174.2	-72.4	-175.2	167.1	0	0	111.9	L11 L12 M17 M18 L19	L11-E15 PolarHBondContact O-N 3.02Å; L12-E15 PolarHBondContact O-N 2.96Å; E15-M17 PolarHBondContact O-N 3.08Å; E15-M18 PolarHBondContact O-N 3.27Å; E15-L19 WeakPolarHBondContact O-CB 3.47Å; E15-L19 PolarHBondContact O-N 2.98Å
16	G	87.8	Confident	84.9	Confident	43 Å²	43	68.5 Å²	68.5	44%	0.443	38%	0.379	S	S	.	.	H	α-helix	trans	-60.6	-41.7	175.3	0	0	0	0	0	113.4	L12 C13 L14 L19 S20	L12-G16 PolarHBondContact O-N 2.89Å; C13-G16 PolarHBondContact O-N 2.92Å; L14-G16 VanDerWaalsContact C-N 3.31Å; L14-G16 PolarHBondContact O-N 3.28Å; G16-L19 PolarHBondContact O-N 3.28Å; G16-S20 PolarHBondContact O-N 2.96Å
17	M	89.6	Confident	86	Confident	104 Å²	104	69.3 Å²	69.3	51%	0.512	39%	0.385	S	S	.	.	H	α-helix	trans	-64.2	-45.1	175.3	-70.9	-173.1	-66.8	0	0	111.8	C13 L14 E15 L19 S20 L21	C13-M17 WeakPolarHBondContact O-CG 3.39Å; C13-M17 PolarHBondContact O-N 3.08Å; L14-M17 HydrophobicContact CB-CE 4.47Å; L14-M17 HydrophobicContact CD2-CE 3.76Å; L14-M17 HydrophobicContact CG-CE 3.92Å; L14-M17 PolarHBondContact O-N 3.08Å; E15-M17 PolarHBondContact O-N 3.08Å; M17-L19 VanDerWaalsContact C-N 3.3Å; M17-L19 PolarHBondContact O-N 3.32Å; M17-S20 PolarHBondContact O-N 3.5Å; M17-S20 PolarHBondContact O-OG 3.31Å; M17-L21 PolarHBondContact O-N 3.02Å; M17-L21 VanDerWaalsContact O-N 3.07Å
18	M	90.4	Very high	86.8	Confident	51 Å²	51	73.1 Å²	73.1	25%	0.251	40%	0.403	S	S	.	.	H	α-helix	trans	-62.3	-38.5	177.6	-65.2	-57.6	-79.4	0	0	112	L14 E15 L21 F22 A48	L14-M18 WeakPolarHBondContact O-CG 3.18Å; L14-M18 PolarHBondContact O-N 3.15Å; E15-M18 PolarHBondContact O-N 3.27Å; M18-L21 PolarHBondContact O-N 2.86Å; M18-L21 HydrophobicContact SD-CD1 4.35Å; M18-F22 PolarHBondContact O-N 3.49Å; M18-A48 HydrophobicContact CB-CB 4.11Å; M18-A48 HydrophobicContact CE-CB 3.34Å; M18-A48 HydrophobicContact CG-CB 4.12Å
19	L	89.6	Confident	87.2	Confident	107 Å²	107	70 Å²	70	56%	0.56	39%	0.389	S	S	*	.	H	α-helix	trans	-66.4	-40.2	176.6	-160.5	149.7	0	0	0	111.6	E15 G16 M17 L21 F22 I23	E15-L19 WeakPolarHBondContact O-CB 3.47Å; E15-L19 PolarHBondContact O-N 2.98Å; G16-L19 PolarHBondContact O-N 3.28Å; M17-L19 VanDerWaalsContact C-N 3.3Å; M17-L19 PolarHBondContact O-N 3.32Å; L19-L21 VanDerWaalsContact C-N 3.35Å; L19-L21 PolarHBondContact O-N 3.46Å; L19-F22 WeakPolarHBondContact O-CB 3.34Å; L19-F22 PolarHBondContact O-N 3.35Å; L19-I23 HydrophobicContact CD2-CD1 3.61Å; L19-I23 HydrophobicContact CD2-CG1 4.24Å; L19-I23 WeakPolarHBondContact O-CG1 3.46Å; L19-I23 PolarHBondContact O-N 3.05Å
20	S	91.1	Very high	87.5	Confident	66 Å²	66	73 Å²	73	46%	0.462	40%	0.401	S	S	.	.	H	α-helix	trans	-62.6	-40.1	174.7	76.8	0	0	0	0	112.9	G16 M17 F22 I23 M24	G16-S20 PolarHBondContact O-N 2.96Å; M17-S20 PolarHBondContact O-N 3.5Å; M17-S20 PolarHBondContact O-OG 3.31Å; S20-F22 VanDerWaalsContact C-N 3.35Å; S20-I23 PolarHBondContact O-N 3.47Å; S20-M24 PolarHBondContact O-N 2.94Å
21	L	89.1	Confident	87.7	Confident	86 Å²	86	77.8 Å²	77.8	45%	0.45	43%	0.425	S	S	.	.	H	α-helix	trans	-65.6	-39.3	176.3	-77.2	168.1	0	0	0	111.3	M17 M18 L19 M24 A25	M17-L21 PolarHBondContact O-N 3.02Å; M17-L21 VanDerWaalsContact O-N 3.07Å; M18-L21 PolarHBondContact O-N 2.86Å; M18-L21 HydrophobicContact SD-CD1 4.35Å; L19-L21 VanDerWaalsContact C-N 3.35Å; L19-L21 PolarHBondContact O-N 3.46Å; L21-M24 PolarHBondContact O-N 2.96Å; L21-A25 VanDerWaalsContact O-CB 3.3Å; L21-A25 WeakPolarHBondContact O-CB 3.4Å; L21-A25 PolarHBondContact O-N 3.49Å
22	F	91.4	Very high	87.7	Confident	68 Å²	68	81.1 Å²	81.1	30%	0.298	45%	0.446	S	S	.	.	H	α-helix	trans	-61.8	-45.7	174.6	177.3	-97.4	0	0	0	112.1	M18 L19 S20 M24 A25 T26 P41 L45	M18-F22 PolarHBondContact O-N 3.49Å; L19-F22 WeakPolarHBondContact O-CB 3.34Å; L19-F22 PolarHBondContact O-N 3.35Å; S20-F22 VanDerWaalsContact C-N 3.35Å; F22-M24 PolarHBondContact O-N 3.16Å; F22-A25 PolarHBondContact O-N 2.88Å; F22-T26 HydrophobicContact CD1-CG2 4.25Å; F22-T26 HydrophobicContact CD2-CG2 4.25Å; F22-T26 HydrophobicContact CE1-CG2 3.84Å; F22-T26 HydrophobicContact CE2-CG2 3.86Å; F22-T26 HydrophobicContact CG-CG2 4.44Å; F22-T26 HydrophobicContact CZ-CG2 3.63Å; F22-T26 WeakPolarHBondContact O-CB 3.5Å; F22-T26 VanDerWaalsContact O-CG2 3.31Å; F22-T26 WeakPolarHBondContact O-CG2 3.42Å; F22-T26 PolarHBondContact O-N 2.96Å; F22-T26 PolarHBondContact O-OG1 3.29Å; F22-P41 HydrophobicContact CD2-CB 3.83Å; F22-P41 WeakPolarHBondContact CD2-O 3.44Å; F22-P41 HydrophobicContact CE2-CB 3.74Å; F22-L45 HydrophobicContact CD1-CD1 4.48Å; F22-L45 HydrophobicContact CD2-CB 4.29Å; F22-L45 HydrophobicContact CD2-CD1 3.78Å; F22-L45 HydrophobicContact CE1-CD1 4.39Å; F22-L45 HydrophobicContact CE2-CB 4.41Å; F22-L45 HydrophobicContact CE2-CD1 3.65Å; F22-L45 HydrophobicContact CG-CD1 4.19Å; F22-L45 HydrophobicContact CZ-CD1 3.98Å
23	I	91.9	Very high	87.5	Confident	83 Å²	83	84 Å²	84	43%	0.426	46%	0.456	S	S	.	.	H	α-helix	trans	-61.6	-44.8	176.6	-66.3	170.7	0	0	0	110.8	L19 S20 A25 T26 L27	L19-I23 HydrophobicContact CD2-CD1 3.61Å; L19-I23 HydrophobicContact CD2-CG1 4.24Å; L19-I23 WeakPolarHBondContact O-CG1 3.46Å; L19-I23 PolarHBondContact O-N 3.05Å; S20-I23 PolarHBondContact O-N 3.47Å; I23-A25 PolarHBondContact O-N 3.37Å; I23-T26 WeakPolarHBondContact CA-OG1 3.21Å; I23-T26 PolarHBondContact O-N 3.17Å; I23-T26 PolarHBondContact O-OG1 3.4Å; I23-L27 HydrophobicContact CG2-CD1 3.89Å; I23-L27 HydrophobicContact CG2-CG 4.45Å; I23-L27 WeakPolarHBondContact O-CB 3.39Å; I23-L27 VanDerWaalsContact O-CG 3.3Å; I23-L27 WeakPolarHBondContact O-CG 3.39Å; I23-L27 PolarHBondContact O-N 3.42Å
24	M	90.6	Very high	87	Confident	110 Å²	110	82.1 Å²	82.1	54%	0.542	44%	0.444	S	S	.	.	H	α-helix	trans	-63.1	-44.8	178.6	-166.3	-164.1	78.7	0	0	111.7	S20 L21 F22 L27 M28	S20-M24 PolarHBondContact O-N 2.94Å; L21-M24 PolarHBondContact O-N 2.96Å; F22-M24 PolarHBondContact O-N 3.16Å; M24-L27 PolarHBondContact O-N 3.03Å; M24-M28 WeakPolarHBondContact O-CG 3.44Å; M24-M28 PolarHBondContact O-N 3.42Å
25	A	87.4	Confident	86.4	Confident	29 Å²	29	85.3 Å²	85.3	24%	0.24	46%	0.46	C	S	.	.	H	α-helix	trans	-63.2	-47.1	179.4	0	0	0	0	0	111.6	L21 F22 I23 L27 M28 T29 P41	L21-A25 VanDerWaalsContact O-CB 3.3Å; L21-A25 WeakPolarHBondContact O-CB 3.4Å; L21-A25 PolarHBondContact O-N 3.49Å; F22-A25 PolarHBondContact O-N 2.88Å; I23-A25 PolarHBondContact O-N 3.37Å; A25-L27 PolarHBondContact O-N 2.89Å; A25-M28 PolarHBondContact O-N 3.42Å; A25-T29 WeakPolarHBondContact O-CG2 3.45Å; A25-T29 PolarHBondContact O-N 3.06Å; A25-P41 HydrophobicContact CB-CB 4.27Å
26	T	87.9	Confident	86	Confident	27 Å²	27	87.9 Å²	87.9	17%	0.166	48%	0.477	C	S	.	.	H	α-helix	trans	-61	-44.6	178.1	50.8	0	0	0	0	111.8	F22 I23 M28 T29 L30 P41	F22-T26 HydrophobicContact CD1-CG2 4.25Å; F22-T26 HydrophobicContact CD2-CG2 4.25Å; F22-T26 HydrophobicContact CE1-CG2 3.84Å; F22-T26 HydrophobicContact CE2-CG2 3.86Å; F22-T26 HydrophobicContact CG-CG2 4.44Å; F22-T26 HydrophobicContact CZ-CG2 3.63Å; F22-T26 WeakPolarHBondContact O-CB 3.5Å; F22-T26 VanDerWaalsContact O-CG2 3.31Å; F22-T26 WeakPolarHBondContact O-CG2 3.42Å; F22-T26 PolarHBondContact O-N 2.96Å; F22-T26 PolarHBondContact O-OG1 3.29Å; I23-T26 WeakPolarHBondContact CA-OG1 3.21Å; I23-T26 PolarHBondContact O-N 3.17Å; I23-T26 PolarHBondContact O-OG1 3.4Å; T26-M28 VanDerWaalsContact C-N 3.31Å; T26-M28 PolarHBondContact O-N 3.27Å; T26-T29 WeakPolarHBondContact CA-OG1 3.48Å; T26-T29 PolarHBondContact O-N 3.36Å; T26-T29 PolarHBondContact O-OG1 3.34Å; T26-L30 WeakPolarHBondContact O-CG 3.44Å; T26-L30 PolarHBondContact O-N 3.37Å; T26-P41 HydrophobicContact CG2-CB 3.77Å; T26-P41 HydrophobicContact CG2-CG 4.02Å
27	L	89.5	Confident	85.6	Confident	95 Å²	95	87.3 Å²	87.3	50%	0.497	47%	0.467	S	S	.	.	H	α-helix	trans	-58.5	-41	174.4	-74.4	169.7	0	0	0	112.5	I23 M24 A25 L30 N31	I23-L27 HydrophobicContact CG2-CD1 3.89Å; I23-L27 HydrophobicContact CG2-CG 4.45Å; I23-L27 WeakPolarHBondContact O-CB 3.39Å; I23-L27 VanDerWaalsContact O-CG 3.3Å; I23-L27 WeakPolarHBondContact O-CG 3.39Å; I23-L27 PolarHBondContact O-N 3.42Å; M24-L27 PolarHBondContact O-N 3.03Å; A25-L27 PolarHBondContact O-N 2.89Å; L27-L30 PolarHBondContact O-N 3.49Å; L27-N31 WeakPolarHBondContact O-CB 3.46Å; L27-N31 PolarHBondContact O-N 2.95Å; L27-N31 PolarHBondContact O-ND2 3.48Å; L27-N31 VanDerWaalsContact O-ND2 3.12Å
28	M	86.8	Confident	85.1	Confident	113 Å²	113	85.7 Å²	85.7	56%	0.557	46%	0.461	S	S	*	.	H	α-helix	trans	-65.9	-40.8	175.9	-71.6	-63.1	-159.4	0	0	112.6	M24 A25 T26 L30 N31 T32	M24-M28 WeakPolarHBondContact O-CG 3.44Å; M24-M28 PolarHBondContact O-N 3.42Å; A25-M28 PolarHBondContact O-N 3.42Å; T26-M28 VanDerWaalsContact C-N 3.31Å; T26-M28 PolarHBondContact O-N 3.27Å; M28-L30 VanDerWaalsContact C-N 3.35Å; M28-N31 PolarHBondContact O-N 3.45Å; M28-T32 WeakPolarHBondContact O-CG2 3.39Å; M28-T32 PolarHBondContact O-N 2.98Å; M28-T32 VanDerWaalsContact O-N 3.14Å; M28-T32 PolarHBondContact O-OG1 3.12Å
29	T	85.9	Confident	84.9	Confident	17 Å²	17	88.6 Å²	88.6	10%	0.104	48%	0.476	C	S	.	.	H	α-helix	trans	-65.9	-37.6	176.4	61.6	0	0	0	0	112.4	A25 T26 T32 H33 S34 A37 P41	A25-T29 WeakPolarHBondContact O-CG2 3.45Å; A25-T29 PolarHBondContact O-N 3.06Å; T26-T29 WeakPolarHBondContact CA-OG1 3.48Å; T26-T29 PolarHBondContact O-N 3.36Å; T26-T29 PolarHBondContact O-OG1 3.34Å; T29-T32 PolarHBondContact O-N 2.9Å; T29-T32 PolarHBondContact O-OG1 2.7Å; T29-H33 PolarHBondContact O-N 3.34Å; T29-S34 PolarHBondContact O-N 2.95Å; T29-A37 HydrophobicContact CG2-CB 3.79Å; T29-P41 HydrophobicContact CG2-CG 4.48Å
30	L	85.3	Confident	84.8	Confident	115 Å²	115	87.7 Å²	87.7	60%	0.602	48%	0.475	S	S	*	.	H	α-helix	trans	-66.5	-44.7	176.2	-71.4	169.3	0	0	0	111.3	T26 L27 M28 T32 H33	T26-L30 WeakPolarHBondContact O-CG 3.44Å; T26-L30 PolarHBondContact O-N 3.37Å; L27-L30 PolarHBondContact O-N 3.49Å; M28-L30 VanDerWaalsContact C-N 3.35Å; L30-T32 VanDerWaalsContact C-N 3.27Å; L30-T32 PolarHBondContact O-N 3.49Å; L30-H33 PolarHBondContact O-N 3.43Å
31	N	85.3	Confident	84.6	Confident	122 Å²	122	84.6 Å²	84.6	65%	0.652	45%	0.453	S	S	*	.	H	α-helix	trans	-62.2	-33.2	177.8	-81.4	-39.6	0	0	0	113.1	L27 M28 H33	L27-N31 WeakPolarHBondContact O-CB 3.46Å; L27-N31 PolarHBondContact O-N 2.95Å; L27-N31 PolarHBondContact O-ND2 3.48Å; L27-N31 VanDerWaalsContact O-ND2 3.12Å; M28-N31 PolarHBondContact O-N 3.45Å; N31-H33 VanDerWaalsContact C-N 3.33Å
32	T	82.1	Confident	84.6	Confident	92 Å²	92	85.4 Å²	85.4	56%	0.564	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.7	1.4	-179.1	54.6	0	0	0	0	113.5	M28 T29 L30 S34	M28-T32 WeakPolarHBondContact O-CG2 3.39Å; M28-T32 PolarHBondContact O-N 2.98Å; M28-T32 VanDerWaalsContact O-N 3.14Å; M28-T32 PolarHBondContact O-OG1 3.12Å; T29-T32 PolarHBondContact O-N 2.9Å; T29-T32 PolarHBondContact O-OG1 2.7Å; L30-T32 VanDerWaalsContact C-N 3.27Å; L30-T32 PolarHBondContact O-N 3.49Å; T32-S34 PolarHBondContact O-N 3.44Å; T32-S34 PolarHBondContact OG1-OG 3.25Å
33	H	78.1	Confident	84.6	Confident	172 Å²	172	84.1 Å²	84.1	80%	0.796	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	47.2	29.7	-176.3	-69.2	-72.6	0	0	0	114	T29 L30 N31 L35	T29-H33 PolarHBondContact O-N 3.34Å; L30-H33 PolarHBondContact O-N 3.43Å; N31-H33 VanDerWaalsContact C-N 3.33Å; H33-L35 PolarHBondContact O-N 3.05Å
34	S	75	Confident	84.5	Confident	42 Å²	42	84.6 Å²	84.6	29%	0.294	46%	0.461	S	S	.	.			trans	-98	90.9	-174.3	57.8	0	0	0	0	110.3	T29 T32 L36 A37	T29-S34 PolarHBondContact O-N 2.95Å; T32-S34 PolarHBondContact O-N 3.44Å; T32-S34 PolarHBondContact OG1-OG 3.25Å; S34-L36 PolarHBondContact O-N 3.1Å; S34-A37 WeakPolarHBondContact O-CB 3.32Å; S34-A37 PolarHBondContact O-N 3.09Å; S34-A37 WeakPolarHBondContact OG-CB 3.45Å
35	L	73.8	Confident	84.5	Confident	156 Å²	156	83.8 Å²	83.8	82%	0.817	46%	0.458	S	S	*	.	G	3₁₀ helix	trans	-58.5	-32.6	-178.6	-69	171	0	0	0	113.1	H33 A37 N38	H33-L35 PolarHBondContact O-N 3.05Å; L35-A37 VanDerWaalsContact C-N 3.34Å; L35-N38 WeakPolarHBondContact O-CB 3.5Å; L35-N38 PolarHBondContact O-N 3.39Å
36	L	77.6	Confident	84.8	Confident	148 Å²	148	86.4 Å²	86.4	78%	0.775	47%	0.471	S	S	*	.	G	3₁₀ helix	trans	-67.9	-30.8	175.4	-81.8	159.9	0	0	0	112.9	S34 N38 I39	S34-L36 PolarHBondContact O-N 3.1Å; L36-N38 PolarHBondContact O-N 2.95Å; L36-I39 PolarHBondContact O-N 2.92Å
37	A	79.3	Confident	84.9	Confident	30 Å²	30	92 Å²	92	25%	0.248	49%	0.493	C	S	.	.	G	3₁₀ helix	trans	-71.8	-15.2	179.7	0	0	0	0	0	112.4	T29 S34 L35 I39 V40 P41	T29-A37 HydrophobicContact CG2-CB 3.79Å; S34-A37 WeakPolarHBondContact O-CB 3.32Å; S34-A37 PolarHBondContact O-N 3.09Å; S34-A37 WeakPolarHBondContact OG-CB 3.45Å; L35-A37 VanDerWaalsContact C-N 3.34Å; A37-I39 PolarHBondContact O-N 3.16Å; A37-V40 WeakPolarHBondContact O-CB 3.37Å; A37-V40 PolarHBondContact O-N 3.02Å; A37-P41 WeakPolarHBondContact O-CD 3.44Å
38	N	78.9	Confident	84.9	Confident	70 Å²	70	88.3 Å²	88.3	37%	0.374	48%	0.476	S	S	.	.	G	3₁₀ helix	trans	-67.1	-15.8	178.8	-143.9	23.1	0	0	0	113.1	L35 L36 V40 P41 I42	L35-N38 WeakPolarHBondContact O-CB 3.5Å; L35-N38 PolarHBondContact O-N 3.39Å; L36-N38 PolarHBondContact O-N 2.95Å; N38-V40 VanDerWaalsContact C-N 3.28Å; N38-V40 PolarHBondContact O-N 3.37Å; N38-P41 VanDerWaalsContact O-CD 3.31Å; N38-P41 WeakPolarHBondContact O-CD 3.15Å; N38-P41 WeakPolarHBondContact O-CG 3.39Å; N38-I42 WeakPolarHBondContact O-CD1 3.34Å; N38-I42 WeakPolarHBondContact O-CG1 3.4Å
39	I	86.2	Confident	85.1	Confident	113 Å²	113	85.6 Å²	85.6	58%	0.579	47%	0.472	S	S	*	.	H	α-helix	trans	-66.4	-32.9	171.8	-62.6	172.6	0	0	0	111	L36 A37 I42 A43	L36-I39 PolarHBondContact O-N 2.92Å; A37-I39 PolarHBondContact O-N 3.16Å; I39-I42 PolarHBondContact O-N 3.38Å; I39-A43 WeakPolarHBondContact O-CB 3.31Å; I39-A43 PolarHBondContact O-N 3.05Å
40	V	86.6	Confident	85.3	Confident	88 Å²	88	88.1 Å²	88.1	53%	0.533	49%	0.49	S	S	.	.	H	α-helix	trans	-62.3	-53.4	-177.5	-179.2	0	0	0	0	112.8	A37 N38 I42 A43 M44	A37-V40 WeakPolarHBondContact O-CB 3.37Å; A37-V40 PolarHBondContact O-N 3.02Å; N38-V40 VanDerWaalsContact C-N 3.28Å; N38-V40 PolarHBondContact O-N 3.37Å; V40-I42 VanDerWaalsContact C-N 3.27Å; V40-I42 PolarHBondContact O-N 3.06Å; V40-A43 PolarHBondContact O-N 2.95Å; V40-M44 HydrophobicContact CG1-CG 4.48Å; V40-M44 WeakPolarHBondContact O-CB 3.46Å; V40-M44 VanDerWaalsContact O-CG 3.29Å; V40-M44 WeakPolarHBondContact O-CG 3.46Å; V40-M44 PolarHBondContact O-N 3Å
41	P	87.3	Confident	85.4	Confident	1 Å²	1	88.8 Å²	88.8	1%	0.006	49%	0.489	C	S	.	.	H	α-helix	trans	-63.8	-31.4	178.2	23.2	-32.5	0	0	0	112.7	F22 A25 T26 T29 A37 N38 L45	F22-P41 HydrophobicContact CD2-CB 3.83Å; F22-P41 WeakPolarHBondContact CD2-O 3.44Å; F22-P41 HydrophobicContact CE2-CB 3.74Å; A25-P41 HydrophobicContact CB-CB 4.27Å; T26-P41 HydrophobicContact CG2-CB 3.77Å; T26-P41 HydrophobicContact CG2-CG 4.02Å; T29-P41 HydrophobicContact CG2-CG 4.48Å; A37-P41 WeakPolarHBondContact O-CD 3.44Å; N38-P41 VanDerWaalsContact O-CD 3.31Å; N38-P41 WeakPolarHBondContact O-CD 3.15Å; N38-P41 WeakPolarHBondContact O-CG 3.39Å; P41-L45 WeakPolarHBondContact O-CB 3.47Å; P41-L45 PolarHBondContact O-N 3.1Å
42	I	89.4	Confident	85.6	Confident	103 Å²	103	83.9 Å²	83.9	53%	0.528	47%	0.466	S	S	.	.	H	α-helix	trans	-68.1	-47.9	175.3	-62.8	166.1	0	0	0	110.8	N38 I39 V40 M44 L45 V46	N38-I42 WeakPolarHBondContact O-CD1 3.34Å; N38-I42 WeakPolarHBondContact O-CG1 3.4Å; I39-I42 PolarHBondContact O-N 3.38Å; V40-I42 VanDerWaalsContact C-N 3.27Å; V40-I42 PolarHBondContact O-N 3.06Å; I42-M44 VanDerWaalsContact C-N 3.32Å; I42-M44 PolarHBondContact O-N 3.34Å; I42-L45 PolarHBondContact O-N 3.42Å; I42-L45 VanDerWaalsContact O-N 3.16Å; I42-V46 WeakPolarHBondContact O-CG2 3.35Å; I42-V46 PolarHBondContact O-N 2.93Å; I42-V46 VanDerWaalsContact O-N 3.09Å
43	A	91.2	Very high	86	Confident	41 Å²	41	82.3 Å²	82.3	34%	0.339	46%	0.463	S	S	.	.	H	α-helix	trans	-60.4	-42.8	176.9	0	0	0	0	0	111.6	I39 V40 L45 V46 F47	I39-A43 WeakPolarHBondContact O-CB 3.31Å; I39-A43 PolarHBondContact O-N 3.05Å; V40-A43 PolarHBondContact O-N 2.95Å; A43-L45 VanDerWaalsContact C-N 3.31Å; A43-L45 PolarHBondContact O-N 3.12Å; A43-V46 PolarHBondContact O-N 3.4Å; A43-F47 WeakPolarHBondContact O-CD2 3.48Å; A43-F47 PolarHBondContact O-N 3.29Å; A43-F47 VanDerWaalsContact O-N 3.1Å
44	M	90	Very high	86.6	Confident	93 Å²	93	78.5 Å²	78.5	46%	0.458	45%	0.451	S	S	.	.	H	α-helix	trans	-56.9	-42.3	173.9	-75.3	-71.8	-69.3	0	0	112.3	V40 I42 F47 A48	V40-M44 HydrophobicContact CG1-CG 4.48Å; V40-M44 WeakPolarHBondContact O-CB 3.46Å; V40-M44 VanDerWaalsContact O-CG 3.29Å; V40-M44 WeakPolarHBondContact O-CG 3.46Å; V40-M44 PolarHBondContact O-N 3Å; I42-M44 VanDerWaalsContact C-N 3.32Å; I42-M44 PolarHBondContact O-N 3.34Å; M44-F47 PolarHBondContact O-N 2.98Å; M44-A48 WeakPolarHBondContact O-CB 3.29Å; M44-A48 PolarHBondContact O-N 2.74Å
45	L	90.7	Very high	87.2	Confident	92 Å²	92	77.2 Å²	77.2	48%	0.482	45%	0.445	S	S	.	.	H	α-helix	trans	-67.2	-37.7	179.8	-161.7	152.4	0	0	0	111.8	F22 P41 I42 A43 A48 A49	F22-L45 HydrophobicContact CD1-CD1 4.48Å; F22-L45 HydrophobicContact CD2-CB 4.29Å; F22-L45 HydrophobicContact CD2-CD1 3.78Å; F22-L45 HydrophobicContact CE1-CD1 4.39Å; F22-L45 HydrophobicContact CE2-CB 4.41Å; F22-L45 HydrophobicContact CE2-CD1 3.65Å; F22-L45 HydrophobicContact CG-CD1 4.19Å; F22-L45 HydrophobicContact CZ-CD1 3.98Å; P41-L45 WeakPolarHBondContact O-CB 3.47Å; P41-L45 PolarHBondContact O-N 3.1Å; I42-L45 PolarHBondContact O-N 3.42Å; I42-L45 VanDerWaalsContact O-N 3.16Å; A43-L45 VanDerWaalsContact C-N 3.31Å; A43-L45 PolarHBondContact O-N 3.12Å; L45-A48 WeakPolarHBondContact O-CB 3.44Å; L45-A48 PolarHBondContact O-N 2.94Å; L45-A49 PolarHBondContact O-N 2.66Å
46	V	93.8	Very high	87.8	Confident	84 Å²	84	73.3 Å²	73.3	51%	0.509	42%	0.424	S	S	.	.	H	α-helix	trans	-62.8	-47.4	174.7	176.2	0	0	0	0	110.9	I42 A43 A48 A49 C50	I42-V46 WeakPolarHBondContact O-CG2 3.35Å; I42-V46 PolarHBondContact O-N 2.93Å; I42-V46 VanDerWaalsContact O-N 3.09Å; A43-V46 PolarHBondContact O-N 3.4Å; V46-A48 VanDerWaalsContact C-N 3.33Å; V46-A48 PolarHBondContact O-N 3.06Å; V46-A49 PolarHBondContact O-N 3.5Å; V46-C50 PolarHBondContact O-N 3.2Å; V46-C50 PolarHBondContact O-SG 2.87Å
47	F	90.3	Very high	88.3	Confident	144 Å²	144	69.2 Å²	69.2	63%	0.632	41%	0.412	S	S	*	.	H	α-helix	trans	-62.7	-39.8	176.5	-77.1	-68	0	0	0	112.3	A43 M44 A49 C50 E51	A43-F47 WeakPolarHBondContact O-CD2 3.48Å; A43-F47 PolarHBondContact O-N 3.29Å; A43-F47 VanDerWaalsContact O-N 3.1Å; M44-F47 PolarHBondContact O-N 2.98Å; F47-A49 VanDerWaalsContact C-N 3.33Å; F47-A49 PolarHBondContact O-N 3.45Å; F47-C50 WeakPolarHBondContact O-CB 3.45Å; F47-C50 PolarHBondContact O-N 3.29Å; F47-E51 PolarHBondContact O-N 3.34Å
48	A	90.1	Very high	88.5	Confident	18 Å²	18	72.5 Å²	72.5	15%	0.149	42%	0.424	C	S	.	.	H	α-helix	trans	-58	-44.6	175.1	0	0	0	0	0	112.3	M18 M44 L45 V46 C50 E51 A52	M18-A48 HydrophobicContact CB-CB 4.11Å; M18-A48 HydrophobicContact CE-CB 3.34Å; M18-A48 HydrophobicContact CG-CB 4.12Å; M44-A48 WeakPolarHBondContact O-CB 3.29Å; M44-A48 PolarHBondContact O-N 2.74Å; L45-A48 WeakPolarHBondContact O-CB 3.44Å; L45-A48 PolarHBondContact O-N 2.94Å; V46-A48 VanDerWaalsContact C-N 3.33Å; V46-A48 PolarHBondContact O-N 3.06Å; A48-C50 VanDerWaalsContact C-N 3.33Å; A48-C50 PolarHBondContact O-N 3.4Å; A48-E51 PolarHBondContact O-N 3.38Å; A48-A52 WeakPolarHBondContact O-CB 3.36Å; A48-A52 PolarHBondContact O-N 3.31Å
49	A	89.9	Confident	88.7	Confident	57 Å²	57	69.7 Å²	69.7	47%	0.471	41%	0.41	S	S	.	.	H	α-helix	trans	-65.4	-37.1	177.5	0	0	0	0	0	112	L45 V46 F47 A52 A53	L45-A49 PolarHBondContact O-N 2.66Å; V46-A49 PolarHBondContact O-N 3.5Å; F47-A49 VanDerWaalsContact C-N 3.33Å; F47-A49 PolarHBondContact O-N 3.45Å; A49-A52 PolarHBondContact O-N 3.07Å; A49-A53 WeakPolarHBondContact O-CB 3.42Å; A49-A53 PolarHBondContact O-N 3.22Å
50	C	90.9	Very high	88.6	Confident	70 Å²	70	68.1 Å²	68.1	47%	0.473	41%	0.405	S	S	.	.	H	α-helix	trans	-64	-44.8	174.3	-65.8	0	0	0	0	112.1	V46 F47 A48 A53 V54	V46-C50 PolarHBondContact O-N 3.2Å; V46-C50 PolarHBondContact O-SG 2.87Å; F47-C50 WeakPolarHBondContact O-CB 3.45Å; F47-C50 PolarHBondContact O-N 3.29Å; A48-C50 VanDerWaalsContact C-N 3.33Å; A48-C50 PolarHBondContact O-N 3.4Å; C50-A53 PolarHBondContact O-N 2.7Å; C50-V54 WeakPolarHBondContact O-CG2 3.15Å; C50-V54 PolarHBondContact O-N 3.44Å
51	E	88.1	Confident	88.4	Confident	128 Å²	128	66.6 Å²	66.6	60%	0.598	40%	0.398	S	S	*	.	H	α-helix	trans	-62.5	-43	176.1	-71.3	-175.3	170.5	0	0	111.8	F47 A48 A53 V54 G55	F47-E51 PolarHBondContact O-N 3.34Å; A48-E51 PolarHBondContact O-N 3.38Å; E51-A53 PolarHBondContact O-N 3.29Å; E51-V54 PolarHBondContact O-N 2.95Å; E51-G55 PolarHBondContact O-N 3.21Å
52	A	89	Confident	87.9	Confident	20 Å²	20	67.9 Å²	67.9	17%	0.165	41%	0.405	C	S	.	.	H	α-helix	trans	-61.9	-42.7	176	0	0	0	0	0	111.9	A48 A49 V54 G55 L56	A48-A52 WeakPolarHBondContact O-CB 3.36Å; A48-A52 PolarHBondContact O-N 3.31Å; A49-A52 PolarHBondContact O-N 3.07Å; A52-V54 PolarHBondContact O-N 3.32Å; A52-G55 PolarHBondContact O-N 3.01Å; A52-L56 WeakPolarHBondContact O-CB 3.44Å; A52-L56 WeakPolarHBondContact O-CG 3.48Å; A52-L56 PolarHBondContact O-N 3.05Å
53	A	90.1	Very high	87.4	Confident	59 Å²	59	64.5 Å²	64.5	49%	0.488	39%	0.39	S	S	.	.	H	α-helix	trans	-61.8	-43.8	176.8	0	0	0	0	0	112.2	A49 C50 E51 L56 A57	A49-A53 WeakPolarHBondContact O-CB 3.42Å; A49-A53 PolarHBondContact O-N 3.22Å; C50-A53 PolarHBondContact O-N 2.7Å; E51-A53 PolarHBondContact O-N 3.29Å; A53-L56 PolarHBondContact O-N 2.99Å; A53-A57 WeakPolarHBondContact O-CB 3.39Å; A53-A57 PolarHBondContact O-N 3.41Å
54	V	89.8	Confident	86.8	Confident	92 Å²	92	68.7 Å²	68.7	56%	0.558	41%	0.407	S	S	*	.	H	α-helix	trans	-65.9	-41.6	175.5	175.1	0	0	0	0	111	C50 E51 A52 L56 A57 L58	C50-V54 WeakPolarHBondContact O-CG2 3.15Å; C50-V54 PolarHBondContact O-N 3.44Å; E51-V54 PolarHBondContact O-N 2.95Å; A52-V54 PolarHBondContact O-N 3.32Å; V54-L56 PolarHBondContact O-N 3.01Å; V54-A57 PolarHBondContact O-N 3.32Å; V54-L58 HydrophobicContact CG1-CD1 4.34Å; V54-L58 WeakPolarHBondContact O-CG 3.3Å; V54-L58 PolarHBondContact O-N 3.46Å
55	G	87.8	Confident	86.1	Confident	15 Å²	15	69 Å²	69	16%	0.155	41%	0.414	C	S	.	.	H	α-helix	trans	-60.3	-42.2	176.4	0	0	0	0	0	113.1	E51 A52 L58 L59	E51-G55 PolarHBondContact O-N 3.21Å; A52-G55 PolarHBondContact O-N 3.01Å; G55-L58 PolarHBondContact O-N 3.2Å; G55-L59 PolarHBondContact O-N 2.95Å
56	L	86.2	Confident	85.1	Confident	73 Å²	73	68.2 Å²	68.2	38%	0.382	41%	0.405	S	S	.	.	H	α-helix	trans	-67.5	-41.6	174.4	-73.9	166.3	0	0	0	112.1	M8 L11 A52 A53 V54 L58 L59 V60	M8-L56 HydrophobicContact CE-CD2 4.49Å; M8-L56 HydrophobicContact SD-CD2 4.26Å; L11-L56 HydrophobicContact CD1-CD2 3.97Å; L11-L56 HydrophobicContact CD1-CG 4.37Å; A52-L56 WeakPolarHBondContact O-CB 3.44Å; A52-L56 WeakPolarHBondContact O-CG 3.48Å; A52-L56 PolarHBondContact O-N 3.05Å; A53-L56 PolarHBondContact O-N 2.99Å; V54-L56 PolarHBondContact O-N 3.01Å; L56-L58 VanDerWaalsContact C-N 3.3Å; L56-L58 PolarHBondContact O-N 2.87Å; L56-L59 WeakPolarHBondContact O-CB 3.35Å; L56-L59 PolarHBondContact O-N 3.18Å; L56-L59 VanDerWaalsContact O-N 3.16Å; L56-V60 WeakPolarHBondContact O-CG2 3.43Å; L56-V60 PolarHBondContact O-N 3.47Å
57	A	88.4	Confident	83.7	Confident	63 Å²	63	67 Å²	67	52%	0.521	41%	0.41	S	S	.	.	H	α-helix	trans	-60.3	-41.4	176.2	0	0	0	0	0	111.8	A53 V54 V60 S61	A53-A57 WeakPolarHBondContact O-CB 3.39Å; A53-A57 PolarHBondContact O-N 3.41Å; V54-A57 PolarHBondContact O-N 3.32Å; A57-V60 PolarHBondContact O-N 2.98Å; A57-S61 PolarHBondContact O-N 3.06Å
58	L	84.6	Confident	82.3	Confident	98 Å²	98	65 Å²	65	51%	0.513	41%	0.405	S	S	.	.	H	α-helix	trans	-63.3	-43.1	173.4	-74.6	171.6	0	0	0	111.7	V54 G55 L56 V60 S61 I62	V54-L58 HydrophobicContact CG1-CD1 4.34Å; V54-L58 WeakPolarHBondContact O-CG 3.3Å; V54-L58 PolarHBondContact O-N 3.46Å; G55-L58 PolarHBondContact O-N 3.2Å; L56-L58 VanDerWaalsContact C-N 3.3Å; L56-L58 PolarHBondContact O-N 2.87Å; L58-V60 VanDerWaalsContact C-N 3.32Å; L58-V60 PolarHBondContact O-N 2.9Å; L58-S61 PolarHBondContact O-N 3.46Å; L58-S61 VanDerWaalsContact O-N 3.09Å; L58-S61 PolarHBondContact O-OG 3.35Å; L58-I62 WeakPolarHBondContact O-CG1 3.41Å; L58-I62 PolarHBondContact O-N 2.74Å
59	L	83.4	Confident	80.9	Confident	12 Å²	12	66.6 Å²	66.6	6%	0.063	41%	0.411	C	S	.	.	H	α-helix	trans	-59.4	-44.5	177	-164.2	157.9	0	0	0	111.5	L7 M8 L11 G55 L56 S61 I62 S63	L7-L59 HydrophobicContact CB-CD1 3.76Å; L7-L59 HydrophobicContact CB-CG 4.18Å; L7-L59 HydrophobicContact CD2-CB 4.25Å; L7-L59 HydrophobicContact CD2-CD1 3.77Å; L7-L59 HydrophobicContact CD2-CG 4.17Å; L7-L59 HydrophobicContact CG-CD1 4.35Å; M8-L59 HydrophobicContact CB-CD1 4.45Å; M8-L59 HydrophobicContact CG-CD1 3.72Å; M8-L59 HydrophobicContact CG-CD2 4.42Å; M8-L59 HydrophobicContact SD-CD1 3.32Å; M8-L59 WeakPolarHBondContact SD-CD1 3.31Å; M8-L59 HydrophobicContact SD-CD2 4.05Å; M8-L59 HydrophobicContact SD-CG 4.34Å; L11-L59 HydrophobicContact CD1-CB 4.44Å; L11-L59 HydrophobicContact CD1-CD1 3.5Å; L11-L59 VanDerWaalsContact CD1-CD1 3.5Å; G55-L59 PolarHBondContact O-N 2.95Å; L56-L59 WeakPolarHBondContact O-CB 3.35Å; L56-L59 PolarHBondContact O-N 3.18Å; L56-L59 VanDerWaalsContact O-N 3.16Å; L59-S61 VanDerWaalsContact C-N 3.3Å; L59-S61 PolarHBondContact O-N 3.4Å; L59-I62 PolarHBondContact O-N 2.94Å; L59-S63 WeakPolarHBondContact O-CB 3.47Å; L59-S63 PolarHBondContact O-N 3.5Å; L59-S63 PolarHBondContact O-OG 3.18Å
60	V	84	Confident	79.5	Confident	80 Å²	80	68.7 Å²	68.7	49%	0.485	41%	0.408	S	S	.	.	H	α-helix	trans	-61.7	-37.3	174.8	174.1	0	0	0	0	111.7	L56 A57 L58 S63 N64	L56-V60 WeakPolarHBondContact O-CG2 3.43Å; L56-V60 PolarHBondContact O-N 3.47Å; A57-V60 PolarHBondContact O-N 2.98Å; L58-V60 VanDerWaalsContact C-N 3.32Å; L58-V60 PolarHBondContact O-N 2.9Å; V60-S63 WeakPolarHBondContact CA-OG 3.33Å; V60-S63 PolarHBondContact O-OG 3.49Å; V60-N64 WeakPolarHBondContact O-CB 3.45Å; V60-N64 VanDerWaalsContact O-CG 3.32Å; V60-N64 PolarHBondContact O-N 2.9Å; V60-N64 PolarHBondContact O-ND2 3.37Å
61	S	82.3	Confident	77.9	Confident	55 Å²	55	68.1 Å²	68.1	39%	0.385	40%	0.402	S	S	.	.	H	α-helix	trans	-66.3	-41.6	175.6	74.9	0	0	0	0	112.3	A57 L58 L59 N64 T65	A57-S61 PolarHBondContact O-N 3.06Å; L58-S61 PolarHBondContact O-N 3.46Å; L58-S61 VanDerWaalsContact O-N 3.09Å; L58-S61 PolarHBondContact O-OG 3.35Å; L59-S61 VanDerWaalsContact C-N 3.3Å; L59-S61 PolarHBondContact O-N 3.4Å; S61-N64 PolarHBondContact O-N 2.92Å; S61-T65 PolarHBondContact O-N 3.47Å; S61-T65 PolarHBondContact O-OG1 3.02Å; S61-T65 VanDerWaalsContact O-OG1 3.13Å
62	I	76.8	Confident	76.3	Confident	28 Å²	28	69.8 Å²	69.8	14%	0.144	41%	0.409	C	S	.	.	H	α-helix	trans	-66.8	-42.9	178.7	-66.7	164.4	0	0	0	110.4	L7 L58 L59 N64 T65 Y66 L74	L7-I62 HydrophobicContact CD1-CD1 3.88Å; L58-I62 WeakPolarHBondContact O-CG1 3.41Å; L58-I62 PolarHBondContact O-N 2.74Å; L59-I62 PolarHBondContact O-N 2.94Å; I62-N64 VanDerWaalsContact C-N 3.33Å; I62-N64 PolarHBondContact O-N 2.88Å; I62-T65 PolarHBondContact O-N 3.48Å; I62-T65 PolarHBondContact O-OG1 3.02Å; I62-T65 VanDerWaalsContact O-OG1 3.07Å; I62-Y66 HydrophobicContact CG2-CD2 4.09Å; I62-Y66 PolarHBondContact O-N 3.36Å; I62-L74 HydrophobicContact CD1-CD1 4.39Å
63	S	77.8	Confident	74.7	Confident	33 Å²	33	72.5 Å²	72.5	23%	0.231	42%	0.421	C	S	.	.	H	α-helix	trans	-65.6	-36.6	177.9	70.2	0	0	0	0	111.8	L59 V60 G67 D69	L59-S63 WeakPolarHBondContact O-CB 3.47Å; L59-S63 PolarHBondContact O-N 3.5Å; L59-S63 PolarHBondContact O-OG 3.18Å; V60-S63 WeakPolarHBondContact CA-OG 3.33Å; V60-S63 PolarHBondContact O-OG 3.49Å; S63-G67 WeakPolarHBondContact O-CA 3.44Å; S63-G67 PolarHBondContact O-N 2.99Å; S63-D69 WeakPolarHBondContact CB-OD1 3.45Å
64	N	79.7	Confident	73.3	Confident	129 Å²	129	72.6 Å²	72.6	69%	0.69	41%	0.413	S	S	*	.	H	α-helix	trans	-67.6	-35.7	173.4	-78.5	-42.8	0	0	0	113.4	V60 S61 I62	V60-N64 WeakPolarHBondContact O-CB 3.45Å; V60-N64 VanDerWaalsContact O-CG 3.32Å; V60-N64 PolarHBondContact O-N 2.9Å; V60-N64 PolarHBondContact O-ND2 3.37Å; S61-N64 PolarHBondContact O-N 2.92Å; I62-N64 VanDerWaalsContact C-N 3.33Å; I62-N64 PolarHBondContact O-N 2.88Å
65	T	74.6	Confident	71.8	Confident	100 Å²	100	73 Å²	73	61%	0.613	41%	0.412	S	S	*	.	H	α-helix	trans	-82.5	-35.2	-179.1	50.5	0	0	0	0	113.9	S61 I62	S61-T65 PolarHBondContact O-N 3.47Å; S61-T65 PolarHBondContact O-OG1 3.02Å; S61-T65 VanDerWaalsContact O-OG1 3.13Å; I62-T65 PolarHBondContact O-N 3.48Å; I62-T65 PolarHBondContact O-OG1 3.02Å; I62-T65 VanDerWaalsContact O-OG1 3.07Å
66	Y	69.4	Low	70.5	Confident	74 Å²	74	78.3 Å²	78.3	29%	0.29	44%	0.436	S	S	.	.	H	α-helix	trans	-111.4	-3.8	-173.2	-66.2	-76.8	0	0	0	113.8	I62 L68 N73 L74 L76	I62-Y66 HydrophobicContact CG2-CD2 4.09Å; I62-Y66 PolarHBondContact O-N 3.36Å; Y66-L68 PolarHBondContact O-N 3.03Å; Y66-N73 HydrophobicContact CD1-CB 3.69Å; Y66-N73 HydrophobicContact CE1-CB 4.23Å; Y66-N73 WeakPolarHBondContact CE1-O 3.3Å; Y66-N73 HydrophobicContact CG-CB 3.95Å; Y66-L74 HydrophobicContact CE2-CD2 3.82Å; Y66-L76 HydrophobicContact CE1-CD1 4.21Å; Y66-L76 WeakPolarHBondContact OH-CD1 3.45Å
67	G	64.9	Low	69.3	Low	59 Å²	59	82.3 Å²	82.3	61%	0.608	46%	0.457	S	S	*	.	S	Bend	trans	68.3	-9.4	177.9	0	0	0	0	0	115.3	S63	S63-G67 WeakPolarHBondContact O-CA 3.44Å; S63-G67 PolarHBondContact O-N 2.99Å
68	L	60.9	Low	67.8	Low	102 Å²	102	86.4 Å²	86.4	53%	0.534	47%	0.466	S	S	.	.	S	Bend	trans	-145.7	140.6	-176.9	-60.4	167.8	0	0	0	110.3	Y66 Y70	Y66-L68 PolarHBondContact O-N 3.03Å; L68-Y70 HydrophobicContact CB-CD2 3.67Å; L68-Y70 HydrophobicContact CB-CE2 4.18Å; L68-Y70 HydrophobicContact CD1-CD2 4.27Å; L68-Y70 HydrophobicContact CD1-CE2 4.39Å; L68-Y70 HydrophobicContact CG-CD2 4.5Å; L68-Y70 PolarHBondContact O-N 3.47Å
69	D	60.7	Low	66.5	Low	51 Å²	51	90.4 Å²	90.4	27%	0.273	50%	0.5	S	S	.	.			trans	-69.8	14.3	-175.6	-61.2	-34.7	0	0	0	115.4	S5 S63 V71	S5-D69 CarbonylContact O-C 3.53Å; S63-D69 WeakPolarHBondContact CB-OD1 3.45Å; D69-V71 PolarHBondContact O-N 3.21Å
70	Y	59.8	Low	65.6	Low	102 Å²	102	94.3 Å²	94.3	40%	0.4	52%	0.521	S	S	.	.			trans	-78.2	116.4	-175.7	-68.5	-83.8	0	0	0	111.6	S5 L68 H72 N73	S5-Y70 WeakPolarHBondContact O-CA 3.44Å; L68-Y70 HydrophobicContact CB-CD2 3.67Å; L68-Y70 HydrophobicContact CB-CE2 4.18Å; L68-Y70 HydrophobicContact CD1-CD2 4.27Å; L68-Y70 HydrophobicContact CD1-CE2 4.39Å; L68-Y70 HydrophobicContact CG-CD2 4.5Å; L68-Y70 PolarHBondContact O-N 3.47Å; Y70-H72 PolarHBondContact O-N 3.43Å; Y70-N73 PolarHBondContact O-N 3.33Å; Y70-N73 VanDerWaalsContact O-N 3.15Å
71	V	58.3	Low	64.7	Low	57 Å²	57	95.1 Å²	95.1	35%	0.345	52%	0.523	S	S	.	.	G	3₁₀ helix	trans	-54	-23.4	170.2	-176.3	0	0	0	0	112.3	Y3 L7 D69 N73 L74	Y3-V71 HydrophobicContact CD1-CG2 4.39Å; L7-V71 HydrophobicContact CB-CG2 4.39Å; L7-V71 HydrophobicContact CD1-CG2 4.19Å; L7-V71 HydrophobicContact CG-CG2 4.44Å; D69-V71 PolarHBondContact O-N 3.21Å; V71-N73 VanDerWaalsContact C-N 3.26Å; V71-N73 PolarHBondContact O-N 3.19Å; V71-L74 PolarHBondContact O-N 2.94Å
72	H	54.3	Low	63.7	Low	163 Å²	163	97.3 Å²	97.3	76%	0.755	53%	0.531	S	S	*	.	G	3₁₀ helix	trans	-70.2	-16.8	-178.4	-149	36.2	0	0	0	114.3	Y70 L74	Y70-H72 PolarHBondContact O-N 3.43Å; H72-L74 VanDerWaalsContact C-N 3.31Å; H72-L74 PolarHBondContact O-N 3.45Å
73	N	55.8	Low	62.9	Low	77 Å²	77	101.4 Å²	101.4	41%	0.412	55%	0.554	S	S	.	*	G	3₁₀ helix	trans	-78.8	-9.7	176.2	-90.6	20.1	0	0	0	113.8	Y66 Y70 V71 N75	Y66-N73 HydrophobicContact CD1-CB 3.69Å; Y66-N73 HydrophobicContact CE1-CB 4.23Å; Y66-N73 WeakPolarHBondContact CE1-O 3.3Å; Y66-N73 HydrophobicContact CG-CB 3.95Å; Y70-N73 PolarHBondContact O-N 3.33Å; Y70-N73 VanDerWaalsContact O-N 3.15Å; V71-N73 VanDerWaalsContact C-N 3.26Å; V71-N73 PolarHBondContact O-N 3.19Å; N73-N75 PolarHBondContact O-N 3.34Å; N73-N75 VanDerWaalsContact O-N 3.08Å
74	L	59.2	Low	62	Low	62 Å²	62	105.6 Å²	105.6	33%	0.325	57%	0.574	S	S	.	*			trans	-80.5	25.7	179.8	-66.3	168	0	0	0	113.7	I62 Y66 V71 H72 L76	I62-L74 HydrophobicContact CD1-CD1 4.39Å; Y66-L74 HydrophobicContact CE2-CD2 3.82Å; V71-L74 PolarHBondContact O-N 2.94Å; H72-L74 VanDerWaalsContact C-N 3.31Å; H72-L74 PolarHBondContact O-N 3.45Å; L74-L76 VanDerWaalsContact C-N 3.25Å; L74-L76 PolarHBondContact O-N 3.14Å
75	N	59.9	Low	60.8	Low	99 Å²	99	104.1 Å²	104.1	53%	0.529	57%	0.566	S	S	.	*	G	3₁₀ helix	trans	-82.7	3.2	-176.3	-132.1	33.7	0	0	0	114.4	N73 L77 Q78	N73-N75 PolarHBondContact O-N 3.34Å; N73-N75 VanDerWaalsContact O-N 3.08Å; N75-L77 VanDerWaalsContact C-N 3.27Å; N75-L77 PolarHBondContact O-N 3.44Å; N75-Q78 PolarHBondContact ND2-OE1 2.98Å; N75-Q78 VanDerWaalsContact ND2-OE1 3.08Å; N75-Q78 PolarHBondContact O-N 3.36Å; N75-Q78 PolarHBondContact OD1-OE1 3.44Å; N75-Q78 VanDerWaalsContact OD1-OE1 3.08Å
76	L	59.2	Low	59.8	Low	127 Å²	127	104.4 Å²	104.4	67%	0.665	56%	0.563	S	S	*	*	G	3₁₀ helix	trans	-69.6	-19.8	176.9	-83.6	160.2	0	0	0	113.8	Y66 L74 Q78	Y66-L76 HydrophobicContact CE1-CD1 4.21Å; Y66-L76 WeakPolarHBondContact OH-CD1 3.45Å; L74-L76 VanDerWaalsContact C-N 3.25Å; L74-L76 PolarHBondContact O-N 3.14Å; L76-Q78 VanDerWaalsContact C-N 3.33Å
77	L	60.7	Low	59.1	Low	158 Å²	158	106.7 Å²	106.7	83%	0.827	58%	0.584	S	S	*	*	G	3₁₀ helix	trans	-88.6	2.9	178	-81.4	148.4	0	0	0	113.5	N75 C79	N75-L77 VanDerWaalsContact C-N 3.27Å; N75-L77 PolarHBondContact O-N 3.44Å; L77-C79 PolarHBondContact O-N 3.12Å
78	Q	57.7	Low	58.6	Low	149 Å²	149	110.7 Å²	110.7	70%	0.696	58%	0.582	S	S	*	*	G	3₁₀ helix	trans	-84.6	7.3	175.9	-149.7	-176.7	-15.7	0	0	112.8	N75 L76	N75-Q78 PolarHBondContact ND2-OE1 2.98Å; N75-Q78 VanDerWaalsContact ND2-OE1 3.08Å; N75-Q78 PolarHBondContact O-N 3.36Å; N75-Q78 PolarHBondContact OD1-OE1 3.44Å; N75-Q78 VanDerWaalsContact OD1-OE1 3.08Å; L76-Q78 VanDerWaalsContact C-N 3.33Å
79	C	56.7	Low	58.4	Low	181 Å²	181	111.5 Å²	111.5	100%	1.223	59%	0.586	S	S	*	*			trans	-84	0	173.1	-72.3	0	0	0	0	112.2	L77	L77-C79 PolarHBondContact O-N 3.12Å

Retrieved 79 of 79 residues in 71.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).