A0A059RWX8_HUMAN Loading...

NADH-ubiquinone oxidoreductase chain 4L

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Part of the enzyme membrane arm which is embedded in the lipid bilayer and involved in proton translocation.

AlphaFold DB , UniProt , Accession A0A059RWX8, Species HUMAN (Homo sapiens, Human), Gene ND4L, Length 88 aa.

						>A0A059RWX8_HUMAN|A0A059RWX8|ND4L
AFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	76.6	Confident	84.1	Confident	90 Å²	90	77.5 Å²	77.5	74%	0.744	45%	0.454	S	S	*	.				0	-52.6	0	0	0	0	0	0	111.7	T3 I4 S5	A1-T3 PolarHBondContact O-N 3.09Å; A1-I4 PolarHBondContact O-N 3.35Å; A1-S5 PolarHBondContact O-N 3.38Å; A1-S5 PolarHBondContact O-OG 3.15Å
2	F	86.3	Confident	82.3	Confident	82 Å²	82	85.6 Å²	85.6	36%	0.36	47%	0.473	S	S	.	.	H	α-helix	trans	-55	-49.8	178.6	-172.9	-99.9	0	0	0	113.9	I4 S5 L6 M26 S29 L30	F2-I4 VanDerWaalsContact C-N 3.33Å; F2-I4 PolarHBondContact O-N 3.27Å; F2-S5 WeakPolarHBondContact CA-OG 3.34Å; F2-S5 PolarHBondContact O-N 3.28Å; F2-S5 PolarHBondContact O-OG 3.02Å; F2-L6 HydrophobicContact CE1-CD1 4.15Å; F2-L6 HydrophobicContact CZ-CD1 4.27Å; F2-L6 VanDerWaalsContact O-CB 3.31Å; F2-L6 WeakPolarHBondContact O-CB 3.48Å; F2-L6 PolarHBondContact O-N 3.11Å; F2-M26 HydrophobicContact CD2-CB 4.18Å; F2-M26 HydrophobicContact CD2-CG 4.29Å; F2-M26 HydrophobicContact CE2-CB 4.07Å; F2-M26 HydrophobicContact CE2-CG 4.25Å; F2-M26 HydrophobicContact CE2-SD 4.42Å; F2-S29 WeakPolarHBondContact CB-OG 3.4Å; F2-L30 HydrophobicContact CD2-CD1 4.45Å; F2-L30 HydrophobicContact CD2-CD2 4.38Å; F2-L30 HydrophobicContact CD2-CG 4.04Å; F2-L30 HydrophobicContact CE2-CD1 3.86Å; F2-L30 HydrophobicContact CE2-CD2 4.24Å; F2-L30 HydrophobicContact CE2-CG 3.92Å
3	T	86.5	Confident	80.8	Confident	93 Å²	93	93.4 Å²	93.4	57%	0.571	49%	0.491	S	S	*	.	H	α-helix	trans	-63.8	-34.9	179.7	51.6	0	0	0	0	113.6	A1 L7	A1-T3 PolarHBondContact O-N 3.09Å; T3-L7 WeakPolarHBondContact O-CB 3.36Å; T3-L7 VanDerWaalsContact O-CG 3.24Å; T3-L7 WeakPolarHBondContact O-CG 3.38Å; T3-L7 PolarHBondContact O-N 3.29Å
4	I	86.6	Confident	79.5	Confident	122 Å²	122	91.1 Å²	91.1	63%	0.626	49%	0.487	S	S	*	.	H	α-helix	trans	-71.3	-41.9	179.1	-60	167.9	0	0	0	110.5	A1 F2 L7 G8	A1-I4 PolarHBondContact O-N 3.35Å; F2-I4 VanDerWaalsContact C-N 3.33Å; F2-I4 PolarHBondContact O-N 3.27Å; I4-L7 PolarHBondContact O-N 2.65Å; I4-G8 PolarHBondContact O-N 3.42Å
5	S	86.1	Confident	79.2	Confident	16 Å²	16	90.3 Å²	90.3	11%	0.112	48%	0.479	C	S	.	.	H	α-helix	trans	-70.6	-35.7	176.5	45.6	0	0	0	0	112.1	A1 F2 G8 M9 M26	A1-S5 PolarHBondContact O-N 3.38Å; A1-S5 PolarHBondContact O-OG 3.15Å; F2-S5 WeakPolarHBondContact CA-OG 3.34Å; F2-S5 PolarHBondContact O-N 3.28Å; F2-S5 PolarHBondContact O-OG 3.02Å; S5-G8 PolarHBondContact O-N 3.07Å; S5-M9 PolarHBondContact O-N 3.1Å; S5-M26 WeakPolarHBondContact OG-CG 3.45Å
6	L	86.1	Confident	78.9	Confident	65 Å²	65	86.8 Å²	86.8	34%	0.34	46%	0.46	S	S	.	.	H	α-helix	trans	-61.8	-47.4	171.2	-171.9	112.3	0	0	0	111.7	F2 G8 M9 L10 M26	F2-L6 HydrophobicContact CE1-CD1 4.15Å; F2-L6 HydrophobicContact CZ-CD1 4.27Å; F2-L6 VanDerWaalsContact O-CB 3.31Å; F2-L6 WeakPolarHBondContact O-CB 3.48Å; F2-L6 PolarHBondContact O-N 3.11Å; L6-G8 VanDerWaalsContact C-N 3.3Å; L6-G8 PolarHBondContact O-N 3.26Å; L6-M9 PolarHBondContact O-N 3.38Å; L6-L10 HydrophobicContact CD2-CD1 3.97Å; L6-L10 HydrophobicContact CG-CD1 4.33Å; L6-L10 WeakPolarHBondContact O-CG 3.44Å; L6-L10 PolarHBondContact O-N 2.88Å; L6-M26 HydrophobicContact CB-SD 4.07Å; L6-M26 HydrophobicContact CD1-SD 4.16Å
7	L	86.1	Confident	79	Confident	107 Å²	107	86.5 Å²	86.5	56%	0.56	46%	0.457	S	S	*	.	H	α-helix	trans	-61.6	-39.4	174.2	-73.7	168.8	0	0	0	111.6	T3 I4 M9 L10 V11	T3-L7 WeakPolarHBondContact O-CB 3.36Å; T3-L7 VanDerWaalsContact O-CG 3.24Å; T3-L7 WeakPolarHBondContact O-CG 3.38Å; T3-L7 PolarHBondContact O-N 3.29Å; I4-L7 PolarHBondContact O-N 2.65Å; L7-M9 VanDerWaalsContact C-N 3.31Å; L7-M9 PolarHBondContact O-N 3.03Å; L7-L10 PolarHBondContact O-N 2.96Å; L7-V11 WeakPolarHBondContact O-CG2 3.5Å; L7-V11 PolarHBondContact O-N 3.07Å
8	G	85.6	Confident	79.3	Confident	32 Å²	32	84.1 Å²	84.1	33%	0.33	45%	0.448	S	S	.	.	H	α-helix	trans	-62.8	-34.2	175.6	0	0	0	0	0	113.8	I4 S5 L6	I4-G8 PolarHBondContact O-N 3.42Å; S5-G8 PolarHBondContact O-N 3.07Å; L6-G8 VanDerWaalsContact C-N 3.3Å; L6-G8 PolarHBondContact O-N 3.26Å
9	M	83.4	Confident	79.5	Confident	51 Å²	51	81.3 Å²	81.3	25%	0.251	44%	0.436	S	S	.	.	H	α-helix	trans	-74.2	-42.8	175.1	-178.9	-87.1	-73.3	0	0	112.1	S5 L6 L7 V11 C22 M26	S5-M9 PolarHBondContact O-N 3.1Å; L6-M9 PolarHBondContact O-N 3.38Å; L7-M9 VanDerWaalsContact C-N 3.31Å; L7-M9 PolarHBondContact O-N 3.03Å; M9-V11 VanDerWaalsContact C-N 3.29Å; M9-V11 PolarHBondContact O-N 3.48Å; M9-C22 HydrophobicContact CB-CB 4.34Å; M9-M26 HydrophobicContact CB-CE 4.24Å; M9-M26 HydrophobicContact CE-CE 4.27Å; M9-M26 HydrophobicContact CG-CE 4.36Å
10	L	81.6	Confident	79.8	Confident	97 Å²	97	78.5 Å²	78.5	51%	0.508	42%	0.42	S	S	.	.	H	α-helix	trans	-65.3	-33.1	178.5	-71.6	170.6	0	0	0	112.5	L6 L7 Y12	L6-L10 HydrophobicContact CD2-CD1 3.97Å; L6-L10 HydrophobicContact CG-CD1 4.33Å; L6-L10 WeakPolarHBondContact O-CG 3.44Å; L6-L10 PolarHBondContact O-N 2.88Å; L7-L10 PolarHBondContact O-N 2.96Å; L10-Y12 VanDerWaalsContact C-N 3.26Å; L10-Y12 WeakPolarHBondContact O-CD2 3.13Å; L10-Y12 PolarHBondContact O-N 3.21Å
11	V	80.1	Confident	80.1	Confident	97 Å²	97	80 Å²	80	59%	0.588	43%	0.428	S	S	*	.	S	Bend	trans	-79.4	82.2	170.1	-178.6	0	0	0	0	107.8	L7 M9 R13	L7-V11 WeakPolarHBondContact O-CG2 3.5Å; L7-V11 PolarHBondContact O-N 3.07Å; M9-V11 VanDerWaalsContact C-N 3.29Å; M9-V11 PolarHBondContact O-N 3.48Å; V11-R13 PolarHBondContact O-N 3.4Å
12	Y	63.2	Low	80.6	Confident	175 Å²	175	77.4 Å²	77.4	69%	0.686	40%	0.404	S	S	*	.			trans	-54	95.9	176	-73.3	-80.1	0	0	0	110.8	L10	L10-Y12 VanDerWaalsContact C-N 3.26Å; L10-Y12 WeakPolarHBondContact O-CD2 3.13Å; L10-Y12 PolarHBondContact O-N 3.21Å
13	R	62.6	Low	80.6	Confident	187 Å²	187	76.9 Å²	76.9	71%	0.706	40%	0.404	S	S	*	.			trans	-72.5	150.1	165.4	-77.2	-84.8	-163.2	121	2.8	108	V11 H15	V11-R13 PolarHBondContact O-N 3.4Å; R13-H15 PolarHBondContact O-N 3.02Å
14	S	62.3	Low	80.6	Confident	62 Å²	62	77.3 Å²	77.3	43%	0.434	40%	0.4	S	S	.	.	S	Bend	trans	-51.3	-24.5	-177.8	53.8	0	0	0	0	115	Y79 V80	S14-Y79 WeakPolarHBondContact O-CA 3.45Å; S14-V80 PolarHBondContact O-N 2.99Å
15	H	75.3	Confident	80.7	Confident	79 Å²	79	73.1 Å²	73.1	37%	0.366	39%	0.386	S	S	.	.	B	Isolated β-bridge	trans	-103.6	120.6	-176.7	-62.4	-74.8	0	0	0	112.8	R13 M17 S18 Y79	R13-H15 PolarHBondContact O-N 3.02Å; H15-M17 PolarHBondContact O-N 3.05Å; H15-S18 PolarHBondContact O-N 3.4Å; H15-S18 VanDerWaalsContact O-N 3.09Å; H15-S18 PolarHBondContact O-OG 3Å; H15-Y79 AromaticContact CE1-CE1 3.47Å; H15-Y79 VanDerWaalsContact CE1-CE1 3.47Å; H15-Y79 WeakPolarHBondContact CE1-CE1 3.42Å; H15-Y79 AromaticContact CE1-CZ 3.83Å; H15-Y79 AromaticContact NE2-CE1 3.83Å
16	L	74.4	Confident	80.9	Confident	34 Å²	34	73 Å²	73	18%	0.178	39%	0.385	C	S	.	.	H	α-helix	trans	-61	-32.5	177.5	-153.3	139.8	0	0	0	112.3	S18 S19 L20 L68 I71 V80	L16-S18 VanDerWaalsContact C-N 3.3Å; L16-S18 PolarHBondContact O-N 2.85Å; L16-S19 PolarHBondContact O-N 2.94Å; L16-S19 VanDerWaalsContact O-N 3.12Å; L16-S19 PolarHBondContact O-OG 3.15Å; L16-L20 HydrophobicContact CD2-CD1 4.12Å; L16-L20 HydrophobicContact CD2-CG 4.28Å; L16-L20 PolarHBondContact O-N 3.26Å; L16-L20 VanDerWaalsContact O-N 3.12Å; L16-L68 HydrophobicContact CB-CD1 4.13Å; L16-L68 HydrophobicContact CD2-CB 4.14Å; L16-L68 HydrophobicContact CD2-CD1 3.69Å; L16-L68 HydrophobicContact CD2-CG 4.06Å; L16-I71 HydrophobicContact CD1-CD1 4.04Å; L16-V80 HydrophobicContact CB-CG2 4.26Å; L16-V80 HydrophobicContact CD1-CG2 4.22Å
17	M	81.1	Confident	81.2	Confident	82 Å²	82	72.1 Å²	72.1	40%	0.404	38%	0.379	S	S	.	.	H	α-helix	trans	-54.3	-41.8	172.7	-73	-61.2	-69	0	0	113.4	H15 S19 L20 L21 L65 L68	H15-M17 PolarHBondContact O-N 3.05Å; M17-S19 VanDerWaalsContact C-N 3.31Å; M17-S19 PolarHBondContact O-N 3.34Å; M17-L20 PolarHBondContact O-N 3.04Å; M17-L21 PolarHBondContact O-N 3Å; M17-L21 VanDerWaalsContact O-N 3.13Å; M17-L65 HydrophobicContact SD-CD2 4.49Å; M17-L68 HydrophobicContact CB-CD1 4.48Å; M17-L68 HydrophobicContact CG-CD1 3.71Å; M17-L68 HydrophobicContact SD-CD1 3.24Å; M17-L68 WeakPolarHBondContact SD-CD1 3.41Å; M17-L68 HydrophobicContact SD-CD2 4.1Å; M17-L68 HydrophobicContact SD-CG 4.33Å
18	S	83.1	Confident	81.4	Confident	43 Å²	43	72.2 Å²	72.2	30%	0.301	38%	0.38	S	S	.	.	H	α-helix	trans	-68	-33.6	-179.5	66.1	0	0	0	0	112.1	H15 L16 L21 C22	H15-S18 PolarHBondContact O-N 3.4Å; H15-S18 VanDerWaalsContact O-N 3.09Å; H15-S18 PolarHBondContact O-OG 3Å; L16-S18 VanDerWaalsContact C-N 3.3Å; L16-S18 PolarHBondContact O-N 2.85Å; S18-L21 PolarHBondContact O-N 3.25Å; S18-C22 PolarHBondContact O-N 2.86Å; S18-C22 VanDerWaalsContact O-N 3.11Å; S18-C22 PolarHBondContact O-SG 3.29Å; S18-C22 VanDerWaalsContact O-SG 3.34Å
19	S	83.8	Confident	81.7	Confident	31 Å²	31	71.7 Å²	71.7	22%	0.217	37%	0.371	C	S	.	.	H	α-helix	trans	-68.9	-38.1	174.9	73	0	0	0	0	112.5	L16 M17 C22 L23	L16-S19 PolarHBondContact O-N 2.94Å; L16-S19 VanDerWaalsContact O-N 3.12Å; L16-S19 PolarHBondContact O-OG 3.15Å; M17-S19 VanDerWaalsContact C-N 3.31Å; M17-S19 PolarHBondContact O-N 3.34Å; S19-C22 PolarHBondContact O-N 3.19Å; S19-L23 PolarHBondContact O-N 3.16Å
20	L	85.6	Confident	82	Confident	24 Å²	24	72 Å²	72	13%	0.126	37%	0.373	C	S	.	.	H	α-helix	trans	-63.1	-43.6	174.8	-70.5	170.8	0	0	0	111.5	L16 M17 C22 L23 E24 L65 L68	L16-L20 HydrophobicContact CD2-CD1 4.12Å; L16-L20 HydrophobicContact CD2-CG 4.28Å; L16-L20 PolarHBondContact O-N 3.26Å; L16-L20 VanDerWaalsContact O-N 3.12Å; M17-L20 PolarHBondContact O-N 3.04Å; L20-C22 VanDerWaalsContact C-N 3.33Å; L20-C22 PolarHBondContact O-N 3.5Å; L20-L23 WeakPolarHBondContact O-CA 3.45Å; L20-L23 VanDerWaalsContact O-CB 3.27Å; L20-L23 WeakPolarHBondContact O-CB 3.46Å; L20-L23 PolarHBondContact O-N 3.01Å; L20-L23 VanDerWaalsContact O-N 3.08Å; L20-E24 PolarHBondContact O-N 3.45Å; L20-L65 HydrophobicContact CD1-CD2 4.03Å; L20-L65 HydrophobicContact CD1-CG 4.4Å; L20-L68 HydrophobicContact CD1-CB 4.5Å; L20-L68 HydrophobicContact CD1-CD1 3.57Å
21	L	85.8	Confident	82.5	Confident	112 Å²	112	70.7 Å²	70.7	59%	0.586	36%	0.364	S	S	*	.	H	α-helix	trans	-62.5	-37.8	175.1	-72.1	172	0	0	0	112.5	M17 S18 L23 E24 G25	M17-L21 PolarHBondContact O-N 3Å; M17-L21 VanDerWaalsContact O-N 3.13Å; S18-L21 PolarHBondContact O-N 3.25Å; L21-L23 VanDerWaalsContact C-N 3.29Å; L21-L23 PolarHBondContact O-N 3.42Å; L21-E24 PolarHBondContact O-N 2.96Å; L21-G25 PolarHBondContact O-N 2.96Å
22	C	86.6	Confident	83.1	Confident	34 Å²	34	70.1 Å²	70.1	23%	0.23	36%	0.356	C	S	.	.	H	α-helix	trans	-64	-36.9	172.9	-69.7	0	0	0	0	111.9	M9 S18 S19 L20 G25 M26	M9-C22 HydrophobicContact CB-CB 4.34Å; S18-C22 PolarHBondContact O-N 2.86Å; S18-C22 VanDerWaalsContact O-N 3.11Å; S18-C22 PolarHBondContact O-SG 3.29Å; S18-C22 VanDerWaalsContact O-SG 3.34Å; S19-C22 PolarHBondContact O-N 3.19Å; L20-C22 VanDerWaalsContact C-N 3.33Å; L20-C22 PolarHBondContact O-N 3.5Å; C22-G25 PolarHBondContact O-N 3.45Å; C22-M26 WeakPolarHBondContact O-CG 3.35Å; C22-M26 PolarHBondContact O-N 2.93Å
23	L	86.1	Confident	84.4	Confident	71 Å²	71	66.9 Å²	66.9	37%	0.372	35%	0.349	S	S	.	.	H	α-helix	trans	-64.3	-46.3	175.6	-125	163.7	0	0	0	111.8	S19 L20 L21 G25 M26 M27	S19-L23 PolarHBondContact O-N 3.16Å; L20-L23 WeakPolarHBondContact O-CA 3.45Å; L20-L23 VanDerWaalsContact O-CB 3.27Å; L20-L23 WeakPolarHBondContact O-CB 3.46Å; L20-L23 PolarHBondContact O-N 3.01Å; L20-L23 VanDerWaalsContact O-N 3.08Å; L21-L23 VanDerWaalsContact C-N 3.29Å; L21-L23 PolarHBondContact O-N 3.42Å; L23-G25 VanDerWaalsContact C-N 3.29Å; L23-G25 PolarHBondContact O-N 3.39Å; L23-M26 HydrophobicContact CB-CE 4.32Å; L23-M26 HydrophobicContact CD2-CE 4.1Å; L23-M26 HydrophobicContact CG-CE 3.79Å; L23-M26 WeakPolarHBondContact O-CB 3.45Å; L23-M26 PolarHBondContact O-N 3.42Å; L23-M26 VanDerWaalsContact O-N 3.13Å; L23-M27 WeakPolarHBondContact O-CG 3.46Å; L23-M27 PolarHBondContact O-N 3Å
24	E	88.1	Confident	85.7	Confident	103 Å²	103	59.3 Å²	59.3	48%	0.481	33%	0.327	S	S	.	.	H	α-helix	trans	-58.9	-41.4	173.1	-71.2	-174.7	165.7	0	0	111.8	L20 L21 M26 M27 L28	L20-E24 PolarHBondContact O-N 3.45Å; L21-E24 PolarHBondContact O-N 2.96Å; E24-M26 VanDerWaalsContact C-N 3.34Å; E24-M26 PolarHBondContact O-N 3.25Å; E24-M27 PolarHBondContact O-N 3.47Å; E24-L28 WeakPolarHBondContact O-CB 3.41Å; E24-L28 PolarHBondContact O-N 3.37Å
25	G	88.4	Confident	87	Confident	33 Å²	33	57.8 Å²	57.8	34%	0.34	31%	0.314	S	S	.	.	H	α-helix	trans	-61.5	-38.1	174.8	0	0	0	0	0	113.7	L21 C22 L23 S29	L21-G25 PolarHBondContact O-N 2.96Å; C22-G25 PolarHBondContact O-N 3.45Å; L23-G25 VanDerWaalsContact C-N 3.29Å; L23-G25 PolarHBondContact O-N 3.39Å; G25-S29 PolarHBondContact O-N 3.12Å; G25-S29 VanDerWaalsContact O-N 3.13Å
26	M	90.3	Very high	87.7	Confident	15 Å²	15	58.5 Å²	58.5	7%	0.074	32%	0.321	C	S	.	.	H	α-helix	trans	-63.6	-49.1	173.8	-73.6	-172.4	-68.6	0	0	110.9	F2 S5 L6 M9 C22 L23 E24 L28 S29 L30	F2-M26 HydrophobicContact CD2-CB 4.18Å; F2-M26 HydrophobicContact CD2-CG 4.29Å; F2-M26 HydrophobicContact CE2-CB 4.07Å; F2-M26 HydrophobicContact CE2-CG 4.25Å; F2-M26 HydrophobicContact CE2-SD 4.42Å; S5-M26 WeakPolarHBondContact OG-CG 3.45Å; L6-M26 HydrophobicContact CB-SD 4.07Å; L6-M26 HydrophobicContact CD1-SD 4.16Å; M9-M26 HydrophobicContact CB-CE 4.24Å; M9-M26 HydrophobicContact CE-CE 4.27Å; M9-M26 HydrophobicContact CG-CE 4.36Å; C22-M26 WeakPolarHBondContact O-CG 3.35Å; C22-M26 PolarHBondContact O-N 2.93Å; L23-M26 HydrophobicContact CB-CE 4.32Å; L23-M26 HydrophobicContact CD2-CE 4.1Å; L23-M26 HydrophobicContact CG-CE 3.79Å; L23-M26 WeakPolarHBondContact O-CB 3.45Å; L23-M26 PolarHBondContact O-N 3.42Å; L23-M26 VanDerWaalsContact O-N 3.13Å; E24-M26 VanDerWaalsContact C-N 3.34Å; E24-M26 PolarHBondContact O-N 3.25Å; M26-L28 VanDerWaalsContact C-N 3.34Å; M26-L28 PolarHBondContact O-N 2.64Å; M26-S29 PolarHBondContact O-N 3.21Å; M26-S29 PolarHBondContact O-OG 3.3Å; M26-L30 PolarHBondContact O-N 2.99Å
27	M	91.9	Very high	88.3	Confident	45 Å²	45	62.4 Å²	62.4	22%	0.222	34%	0.339	C	S	.	.	H	α-helix	trans	-62	-40.9	-178.9	-63.4	-54.9	-79.5	0	0	112.1	L23 E24 S29 L30 F31 A57	L23-M27 WeakPolarHBondContact O-CG 3.46Å; L23-M27 PolarHBondContact O-N 3Å; E24-M27 PolarHBondContact O-N 3.47Å; M27-S29 PolarHBondContact O-N 3.49Å; M27-L30 PolarHBondContact O-N 3.48Å; M27-L30 HydrophobicContact SD-CD1 4.45Å; M27-F31 PolarHBondContact O-N 3.34Å; M27-A57 HydrophobicContact CB-CB 4.02Å; M27-A57 HydrophobicContact CE-CB 3.29Å; M27-A57 HydrophobicContact CG-CB 3.96Å; M27-A57 HydrophobicContact SD-CB 4.47Å
28	L	90.4	Very high	88.6	Confident	110 Å²	110	59.2 Å²	59.2	58%	0.576	32%	0.324	S	S	*	.	H	α-helix	trans	-65.1	-39.5	176.7	-165.5	146.9	0	0	0	111.7	E24 M26 F31 I32	E24-L28 WeakPolarHBondContact O-CB 3.41Å; E24-L28 PolarHBondContact O-N 3.37Å; M26-L28 VanDerWaalsContact C-N 3.34Å; M26-L28 PolarHBondContact O-N 2.64Å; L28-F31 PolarHBondContact O-N 3.09Å; L28-I32 HydrophobicContact CD2-CD1 3.57Å; L28-I32 HydrophobicContact CD2-CG1 4.3Å; L28-I32 WeakPolarHBondContact O-CG1 3.4Å; L28-I32 PolarHBondContact O-N 3.08Å
29	S	92.4	Very high	88.7	Confident	21 Å²	21	62.5 Å²	62.5	15%	0.147	34%	0.338	C	S	.	.	H	α-helix	trans	-67.3	-36.1	176.7	74.2	0	0	0	0	113.2	F2 G25 M26 M27 M33	F2-S29 WeakPolarHBondContact CB-OG 3.4Å; G25-S29 PolarHBondContact O-N 3.12Å; G25-S29 VanDerWaalsContact O-N 3.13Å; M26-S29 PolarHBondContact O-N 3.21Å; M26-S29 PolarHBondContact O-OG 3.3Å; M27-S29 PolarHBondContact O-N 3.49Å; S29-M33 PolarHBondContact O-N 3.12Å; S29-M33 VanDerWaalsContact O-N 3.11Å
30	L	90.1	Very high	88.9	Confident	58 Å²	58	66.9 Å²	66.9	30%	0.304	36%	0.359	S	S	.	.	H	α-helix	trans	-66.3	-40.6	172.9	-76.9	170.1	0	0	0	111.5	F2 M26 M27 M33 A34	F2-L30 HydrophobicContact CD2-CD1 4.45Å; F2-L30 HydrophobicContact CD2-CD2 4.38Å; F2-L30 HydrophobicContact CD2-CG 4.04Å; F2-L30 HydrophobicContact CE2-CD1 3.86Å; F2-L30 HydrophobicContact CE2-CD2 4.24Å; F2-L30 HydrophobicContact CE2-CG 3.92Å; M26-L30 PolarHBondContact O-N 2.99Å; M27-L30 PolarHBondContact O-N 3.48Å; M27-L30 HydrophobicContact SD-CD1 4.45Å; L30-M33 HydrophobicContact CD2-CE 4.29Å; L30-M33 PolarHBondContact O-N 2.7Å; L30-A34 WeakPolarHBondContact O-CB 3.47Å; L30-A34 PolarHBondContact O-N 2.96Å
31	F	92.2	Very high	88.7	Confident	68 Å²	68	70.1 Å²	70.1	30%	0.298	38%	0.38	S	S	.	.	H	α-helix	trans	-61	-46.3	175.7	176.8	-99.4	0	0	0	112.1	M27 L28 M33 A34 T35 P50 L54	M27-F31 PolarHBondContact O-N 3.34Å; L28-F31 PolarHBondContact O-N 3.09Å; F31-M33 VanDerWaalsContact C-N 3.34Å; F31-M33 PolarHBondContact O-N 3.28Å; F31-A34 PolarHBondContact O-N 2.91Å; F31-T35 HydrophobicContact CD1-CG2 4.3Å; F31-T35 HydrophobicContact CD2-CG2 4.21Å; F31-T35 HydrophobicContact CE1-CG2 3.88Å; F31-T35 HydrophobicContact CE2-CG2 3.79Å; F31-T35 HydrophobicContact CG-CG2 4.45Å; F31-T35 HydrophobicContact CZ-CG2 3.61Å; F31-T35 WeakPolarHBondContact O-CB 3.24Å; F31-T35 VanDerWaalsContact O-CG2 3.32Å; F31-T35 WeakPolarHBondContact O-CG2 3.21Å; F31-T35 PolarHBondContact O-N 2.94Å; F31-T35 PolarHBondContact O-OG1 3.31Å; F31-P50 HydrophobicContact CD2-CB 3.77Å; F31-P50 WeakPolarHBondContact CD2-O 3.19Å; F31-P50 HydrophobicContact CE2-CB 3.61Å; F31-L54 HydrophobicContact CD2-CB 4.44Å; F31-L54 HydrophobicContact CD2-CD1 3.89Å; F31-L54 HydrophobicContact CE2-CD1 3.79Å; F31-L54 HydrophobicContact CG-CD1 4.31Å; F31-L54 HydrophobicContact CZ-CD1 4.13Å
32	I	92.3	Very high	88.4	Confident	85 Å²	85	73.1 Å²	73.1	44%	0.436	39%	0.391	S	S	.	.	H	α-helix	trans	-61.5	-43.7	177.1	-66.9	171.6	0	0	0	110.8	L28 T35 L36	L28-I32 HydrophobicContact CD2-CD1 3.57Å; L28-I32 HydrophobicContact CD2-CG1 4.3Å; L28-I32 WeakPolarHBondContact O-CG1 3.4Å; L28-I32 PolarHBondContact O-N 3.08Å; I32-T35 WeakPolarHBondContact CA-OG1 3.45Å; I32-T35 PolarHBondContact O-OG1 3.01Å; I32-L36 HydrophobicContact CG2-CD1 3.88Å; I32-L36 HydrophobicContact CG2-CG 4.46Å; I32-L36 WeakPolarHBondContact O-CB 3.44Å; I32-L36 VanDerWaalsContact O-CG 3.3Å; I32-L36 WeakPolarHBondContact O-CG 3.37Å; I32-L36 PolarHBondContact O-N 3.01Å
33	M	90.8	Very high	87.9	Confident	107 Å²	107	73.6 Å²	73.6	53%	0.527	39%	0.394	S	S	.	.	H	α-helix	trans	-63.8	-44.9	178.3	-170.5	-174.1	74	0	0	111.8	S29 L30 F31 L36 M37	S29-M33 PolarHBondContact O-N 3.12Å; S29-M33 VanDerWaalsContact O-N 3.11Å; L30-M33 HydrophobicContact CD2-CE 4.29Å; L30-M33 PolarHBondContact O-N 2.7Å; F31-M33 VanDerWaalsContact C-N 3.34Å; F31-M33 PolarHBondContact O-N 3.28Å; M33-L36 PolarHBondContact O-N 3.27Å; M33-M37 WeakPolarHBondContact O-CG 3.48Å; M33-M37 PolarHBondContact O-N 3.39Å
34	A	88.6	Confident	87.4	Confident	29 Å²	29	77.8 Å²	77.8	24%	0.24	42%	0.416	C	S	.	.	H	α-helix	trans	-63.6	-44.6	179.4	0	0	0	0	0	111.5	L30 F31 M37 T38 P50	L30-A34 WeakPolarHBondContact O-CB 3.47Å; L30-A34 PolarHBondContact O-N 2.96Å; F31-A34 PolarHBondContact O-N 2.91Å; A34-M37 PolarHBondContact O-N 3.42Å; A34-T38 WeakPolarHBondContact O-CG2 3.27Å; A34-T38 PolarHBondContact O-N 3.37Å; A34-P50 HydrophobicContact CB-CB 4.44Å; A34-P50 HydrophobicContact CB-CG 4.04Å
35	T	89.1	Confident	87	Confident	29 Å²	29	80 Å²	80	18%	0.178	43%	0.431	C	S	.	.	H	α-helix	trans	-64.9	-38.9	177.5	51.5	0	0	0	0	112.7	F31 I32 M37 T38 L39 P50	F31-T35 HydrophobicContact CD1-CG2 4.3Å; F31-T35 HydrophobicContact CD2-CG2 4.21Å; F31-T35 HydrophobicContact CE1-CG2 3.88Å; F31-T35 HydrophobicContact CE2-CG2 3.79Å; F31-T35 HydrophobicContact CG-CG2 4.45Å; F31-T35 HydrophobicContact CZ-CG2 3.61Å; F31-T35 WeakPolarHBondContact O-CB 3.24Å; F31-T35 VanDerWaalsContact O-CG2 3.32Å; F31-T35 WeakPolarHBondContact O-CG2 3.21Å; F31-T35 PolarHBondContact O-N 2.94Å; F31-T35 PolarHBondContact O-OG1 3.31Å; I32-T35 WeakPolarHBondContact CA-OG1 3.45Å; I32-T35 PolarHBondContact O-OG1 3.01Å; T35-M37 VanDerWaalsContact C-N 3.31Å; T35-M37 PolarHBondContact O-N 2.78Å; T35-T38 WeakPolarHBondContact CA-OG1 3.48Å; T35-T38 PolarHBondContact O-N 3.13Å; T35-T38 PolarHBondContact O-OG1 2.99Å; T35-L39 WeakPolarHBondContact O-CB 3.39Å; T35-L39 WeakPolarHBondContact O-CD1 3.44Å; T35-L39 WeakPolarHBondContact O-CG 3.26Å; T35-L39 PolarHBondContact O-N 3.42Å; T35-P50 HydrophobicContact CG2-CB 3.74Å; T35-P50 HydrophobicContact CG2-CG 3.98Å
36	L	90.2	Very high	86.6	Confident	95 Å²	95	80 Å²	80	50%	0.497	43%	0.427	S	S	.	.	H	α-helix	trans	-63.1	-38.5	173.8	-74.6	169.1	0	0	0	112	I32 M33 N40	I32-L36 HydrophobicContact CG2-CD1 3.88Å; I32-L36 HydrophobicContact CG2-CG 4.46Å; I32-L36 WeakPolarHBondContact O-CB 3.44Å; I32-L36 VanDerWaalsContact O-CG 3.3Å; I32-L36 WeakPolarHBondContact O-CG 3.37Å; I32-L36 PolarHBondContact O-N 3.01Å; M33-L36 PolarHBondContact O-N 3.27Å; L36-N40 WeakPolarHBondContact O-CB 3.41Å; L36-N40 PolarHBondContact O-N 3.33Å; L36-N40 PolarHBondContact O-ND2 3.47Å
37	M	87.4	Confident	86.2	Confident	116 Å²	116	82.5 Å²	82.5	57%	0.571	44%	0.441	S	S	*	.	H	α-helix	trans	-68.7	-39.6	177	-70.1	-62.5	-168	0	0	112.7	M33 A34 T35 N40 T41	M33-M37 WeakPolarHBondContact O-CG 3.48Å; M33-M37 PolarHBondContact O-N 3.39Å; A34-M37 PolarHBondContact O-N 3.42Å; T35-M37 VanDerWaalsContact C-N 3.31Å; T35-M37 PolarHBondContact O-N 2.78Å; M37-N40 PolarHBondContact O-N 3Å; M37-T41 WeakPolarHBondContact O-CG2 3.15Å; M37-T41 PolarHBondContact O-N 3.24Å; M37-T41 VanDerWaalsContact O-N 3.12Å; M37-T41 PolarHBondContact O-OG1 3.46Å
38	T	87.2	Confident	86	Confident	15 Å²	15	85.7 Å²	85.7	9%	0.092	46%	0.457	C	S	.	.	H	α-helix	trans	-66.7	-39.7	176.1	59.5	0	0	0	0	111.4	A34 T35 T41 H42 S43 A46 N47 P50	A34-T38 WeakPolarHBondContact O-CG2 3.27Å; A34-T38 PolarHBondContact O-N 3.37Å; T35-T38 WeakPolarHBondContact CA-OG1 3.48Å; T35-T38 PolarHBondContact O-N 3.13Å; T35-T38 PolarHBondContact O-OG1 2.99Å; T38-T41 PolarHBondContact O-N 3.48Å; T38-T41 PolarHBondContact O-OG1 3.08Å; T38-H42 PolarHBondContact O-N 3.49Å; T38-S43 PolarHBondContact O-N 3.42Å; T38-A46 HydrophobicContact CG2-CB 3.74Å; T38-A46 WeakPolarHBondContact CG2-O 3.46Å; T38-N47 PolarHBondContact OG1-OD1 3.13Å; T38-P50 HydrophobicContact CG2-CG 4.12Å
39	L	86.3	Confident	85.8	Confident	112 Å²	112	84.8 Å²	84.8	59%	0.586	46%	0.456	S	S	*	.	H	α-helix	trans	-63.2	-45.9	175.1	-71.8	168.9	0	0	0	111.9	T35 T41 H42	T35-L39 WeakPolarHBondContact O-CB 3.39Å; T35-L39 WeakPolarHBondContact O-CD1 3.44Å; T35-L39 WeakPolarHBondContact O-CG 3.26Å; T35-L39 PolarHBondContact O-N 3.42Å; L39-T41 VanDerWaalsContact C-N 3.3Å; L39-T41 PolarHBondContact O-N 2.94Å; L39-H42 PolarHBondContact O-N 3.01Å
40	N	86.4	Confident	85.7	Confident	123 Å²	123	83.9 Å²	83.9	66%	0.658	45%	0.45	S	S	*	.	H	α-helix	trans	-63.9	-33.3	179	-81.5	-26.3	0	0	0	113.3	L36 M37 H42	L36-N40 WeakPolarHBondContact O-CB 3.41Å; L36-N40 PolarHBondContact O-N 3.33Å; L36-N40 PolarHBondContact O-ND2 3.47Å; M37-N40 PolarHBondContact O-N 3Å; N40-H42 VanDerWaalsContact C-N 3.31Å
41	T	82.9	Confident	85.7	Confident	92 Å²	92	86.1 Å²	86.1	56%	0.564	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.8	1	-179.7	55	0	0	0	0	113.2	M37 T38 L39 S43	M37-T41 WeakPolarHBondContact O-CG2 3.15Å; M37-T41 PolarHBondContact O-N 3.24Å; M37-T41 VanDerWaalsContact O-N 3.12Å; M37-T41 PolarHBondContact O-OG1 3.46Å; T38-T41 PolarHBondContact O-N 3.48Å; T38-T41 PolarHBondContact O-OG1 3.08Å; L39-T41 VanDerWaalsContact C-N 3.3Å; L39-T41 PolarHBondContact O-N 2.94Å; T41-S43 PolarHBondContact O-N 3.33Å; T41-S43 PolarHBondContact OG1-OG 3.27Å
42	H	78.8	Confident	85.7	Confident	175 Å²	175	84.8 Å²	84.8	81%	0.81	46%	0.463	S	S	*	.	T	Hydrogen-bonded Turn	trans	47.2	29.1	-175.6	-67.6	-69.5	0	0	0	113.9	T38 L39 N40 L44	T38-H42 PolarHBondContact O-N 3.49Å; L39-H42 PolarHBondContact O-N 3.01Å; N40-H42 VanDerWaalsContact C-N 3.31Å; H42-L44 PolarHBondContact O-N 3.45Å
43	S	76	Confident	85.6	Confident	43 Å²	43	85 Å²	85	30%	0.301	46%	0.463	S	S	.	.			trans	-96.3	91.1	-174.2	58.2	0	0	0	0	110.2	T38 T41 L45 A46	T38-S43 PolarHBondContact O-N 3.42Å; T41-S43 PolarHBondContact O-N 3.33Å; T41-S43 PolarHBondContact OG1-OG 3.27Å; S43-L45 PolarHBondContact O-N 3.5Å; S43-A46 WeakPolarHBondContact O-CB 3.45Å; S43-A46 PolarHBondContact O-N 3.02Å; S43-A46 WeakPolarHBondContact OG-CB 3.31Å
44	L	74.8	Confident	85.7	Confident	159 Å²	159	84.2 Å²	84.2	83%	0.832	46%	0.46	S	S	*	.	G	3₁₀ helix	trans	-58.7	-32.9	-178.8	-67.5	172.6	0	0	0	113.1	H42 A46 N47	H42-L44 PolarHBondContact O-N 3.45Å; L44-A46 VanDerWaalsContact C-N 3.33Å; L44-A46 PolarHBondContact O-N 3.34Å; L44-N47 WeakPolarHBondContact O-CB 3.49Å; L44-N47 PolarHBondContact O-N 3.11Å
45	L	79.7	Confident	85.9	Confident	151 Å²	151	86.9 Å²	86.9	79%	0.791	47%	0.473	S	S	*	.	G	3₁₀ helix	trans	-66.6	-32.7	175.5	-83.1	158.9	0	0	0	112.9	S43 N47 I48	S43-L45 PolarHBondContact O-N 3.5Å; L45-N47 PolarHBondContact O-N 3.1Å; L45-I48 PolarHBondContact O-N 3.24Å
46	A	81	Confident	86	Confident	31 Å²	31	92.2 Å²	92.2	26%	0.256	49%	0.494	S	S	.	.	G	3₁₀ helix	trans	-72.5	-13.5	-179.4	0	0	0	0	0	112.4	T38 S43 L44 I48 V49 P50	T38-A46 HydrophobicContact CG2-CB 3.74Å; T38-A46 WeakPolarHBondContact CG2-O 3.46Å; S43-A46 WeakPolarHBondContact O-CB 3.45Å; S43-A46 PolarHBondContact O-N 3.02Å; S43-A46 WeakPolarHBondContact OG-CB 3.31Å; L44-A46 VanDerWaalsContact C-N 3.33Å; L44-A46 PolarHBondContact O-N 3.34Å; A46-I48 PolarHBondContact O-N 3.23Å; A46-V49 WeakPolarHBondContact O-CB 3.42Å; A46-V49 PolarHBondContact O-N 3.44Å; A46-P50 WeakPolarHBondContact O-CD 3.34Å
47	N	80.9	Confident	86.1	Confident	69 Å²	69	88.5 Å²	88.5	37%	0.369	48%	0.478	S	S	.	.	G	3₁₀ helix	trans	-67.8	-14.4	178.2	-134.8	29.9	0	0	0	113.5	T38 L44 L45 V49 P50 I51	T38-N47 PolarHBondContact OG1-OD1 3.13Å; L44-N47 WeakPolarHBondContact O-CB 3.49Å; L44-N47 PolarHBondContact O-N 3.11Å; L45-N47 PolarHBondContact O-N 3.1Å; N47-V49 VanDerWaalsContact C-N 3.27Å; N47-P50 WeakPolarHBondContact O-CD 3.49Å; N47-I51 WeakPolarHBondContact O-CD1 3.42Å; N47-I51 WeakPolarHBondContact O-CG1 3.45Å
48	I	87.6	Confident	86.2	Confident	111 Å²	111	85.7 Å²	85.7	57%	0.569	47%	0.473	S	S	*	.	H	α-helix	trans	-66.7	-31.9	171	-61.5	172.7	0	0	0	110.7	L45 A46 I51 A52	L45-I48 PolarHBondContact O-N 3.24Å; A46-I48 PolarHBondContact O-N 3.23Å; I48-I51 PolarHBondContact O-N 2.96Å; I48-A52 WeakPolarHBondContact O-CB 3.47Å; I48-A52 PolarHBondContact O-N 3.44Å
49	V	87.6	Confident	86.4	Confident	91 Å²	91	88.4 Å²	88.4	55%	0.552	49%	0.492	S	S	*	.	H	α-helix	trans	-65.9	-50.6	-175.2	178.4	0	0	0	0	112.3	A46 N47 I51 A52 M53	A46-V49 WeakPolarHBondContact O-CB 3.42Å; A46-V49 PolarHBondContact O-N 3.44Å; N47-V49 VanDerWaalsContact C-N 3.27Å; V49-I51 VanDerWaalsContact C-N 3.26Å; V49-I51 PolarHBondContact O-N 2.92Å; V49-A52 PolarHBondContact O-N 3.47Å; V49-M53 HydrophobicContact CG1-CG 4.44Å; V49-M53 WeakPolarHBondContact O-CB 3.24Å; V49-M53 VanDerWaalsContact O-CG 3.26Å; V49-M53 WeakPolarHBondContact O-CG 3.39Å; V49-M53 PolarHBondContact O-N 2.92Å
50	P	89.3	Confident	86.6	Confident	2 Å²	2	88.8 Å²	88.8	1%	0.013	49%	0.49	C	S	.	.	H	α-helix	trans	-58.2	-35.9	174.5	-23.9	31.3	0	0	0	113.8	F31 A34 T35 T38 A46 N47 L54	F31-P50 HydrophobicContact CD2-CB 3.77Å; F31-P50 WeakPolarHBondContact CD2-O 3.19Å; F31-P50 HydrophobicContact CE2-CB 3.61Å; A34-P50 HydrophobicContact CB-CB 4.44Å; A34-P50 HydrophobicContact CB-CG 4.04Å; T35-P50 HydrophobicContact CG2-CB 3.74Å; T35-P50 HydrophobicContact CG2-CG 3.98Å; T38-P50 HydrophobicContact CG2-CG 4.12Å; A46-P50 WeakPolarHBondContact O-CD 3.34Å; N47-P50 WeakPolarHBondContact O-CD 3.49Å; P50-L54 PolarHBondContact O-N 3.27Å; P50-L54 VanDerWaalsContact O-N 3.09Å
51	I	90.3	Very high	86.7	Confident	105 Å²	105	84.1 Å²	84.1	54%	0.538	47%	0.469	S	S	.	.	H	α-helix	trans	-69.6	-47.9	179.7	-60.9	168.9	0	0	0	110.3	N47 I48 V49 M53 L54 V55	N47-I51 WeakPolarHBondContact O-CD1 3.42Å; N47-I51 WeakPolarHBondContact O-CG1 3.45Å; I48-I51 PolarHBondContact O-N 2.96Å; V49-I51 VanDerWaalsContact C-N 3.26Å; V49-I51 PolarHBondContact O-N 2.92Å; I51-M53 VanDerWaalsContact C-N 3.31Å; I51-M53 PolarHBondContact O-N 3.34Å; I51-L54 PolarHBondContact O-N 2.96Å; I51-L54 VanDerWaalsContact O-N 3.14Å; I51-V55 WeakPolarHBondContact O-CG2 3.5Å; I51-V55 PolarHBondContact O-N 3.42Å; I51-V55 VanDerWaalsContact O-N 3.1Å
52	A	92.2	Very high	87.1	Confident	41 Å²	41	82.5 Å²	82.5	34%	0.339	47%	0.465	S	S	.	.	H	α-helix	trans	-59.3	-43.3	176.4	0	0	0	0	0	111.5	I48 V49 L54 V55 F56	I48-A52 WeakPolarHBondContact O-CB 3.47Å; I48-A52 PolarHBondContact O-N 3.44Å; V49-A52 PolarHBondContact O-N 3.47Å; A52-L54 VanDerWaalsContact C-N 3.3Å; A52-L54 PolarHBondContact O-N 2.97Å; A52-V55 PolarHBondContact O-N 2.87Å; A52-F56 WeakPolarHBondContact O-CD2 3.34Å; A52-F56 PolarHBondContact O-N 3.04Å; A52-F56 VanDerWaalsContact O-N 3.13Å
53	M	91.4	Very high	87.7	Confident	88 Å²	88	78.5 Å²	78.5	43%	0.433	45%	0.453	S	S	.	.	H	α-helix	trans	-56.9	-41.7	174.5	-75.2	-70.8	-67.4	0	0	112.4	V49 I51 F56 A57	V49-M53 HydrophobicContact CG1-CG 4.44Å; V49-M53 WeakPolarHBondContact O-CB 3.24Å; V49-M53 VanDerWaalsContact O-CG 3.26Å; V49-M53 WeakPolarHBondContact O-CG 3.39Å; V49-M53 PolarHBondContact O-N 2.92Å; I51-M53 VanDerWaalsContact C-N 3.31Å; I51-M53 PolarHBondContact O-N 3.34Å; M53-F56 PolarHBondContact O-N 3.35Å; M53-A57 WeakPolarHBondContact O-CB 3.48Å; M53-A57 PolarHBondContact O-N 3.42Å
54	L	91.3	Very high	88.2	Confident	91 Å²	91	77.1 Å²	77.1	48%	0.476	45%	0.445	S	S	.	.	H	α-helix	trans	-67.8	-38	179.9	-157.5	158.1	0	0	0	111.8	F31 P50 I51 A52 A57 A58	F31-L54 HydrophobicContact CD2-CB 4.44Å; F31-L54 HydrophobicContact CD2-CD1 3.89Å; F31-L54 HydrophobicContact CE2-CD1 3.79Å; F31-L54 HydrophobicContact CG-CD1 4.31Å; F31-L54 HydrophobicContact CZ-CD1 4.13Å; P50-L54 PolarHBondContact O-N 3.27Å; P50-L54 VanDerWaalsContact O-N 3.09Å; I51-L54 PolarHBondContact O-N 2.96Å; I51-L54 VanDerWaalsContact O-N 3.14Å; A52-L54 VanDerWaalsContact C-N 3.3Å; A52-L54 PolarHBondContact O-N 2.97Å; L54-A57 WeakPolarHBondContact O-CB 3.45Å; L54-A57 PolarHBondContact O-N 2.94Å; L54-A58 PolarHBondContact O-N 2.95Å
55	V	94.3	Very high	88.9	Confident	85 Å²	85	73.3 Å²	73.3	52%	0.515	43%	0.425	S	S	.	.	H	α-helix	trans	-62.5	-48.1	175.6	176.4	0	0	0	0	110.9	I51 A52 A57 A58 C59	I51-V55 WeakPolarHBondContact O-CG2 3.5Å; I51-V55 PolarHBondContact O-N 3.42Å; I51-V55 VanDerWaalsContact O-N 3.1Å; A52-V55 PolarHBondContact O-N 2.87Å; V55-A57 VanDerWaalsContact C-N 3.31Å; V55-A57 PolarHBondContact O-N 3.33Å; V55-A58 PolarHBondContact O-N 3.29Å; V55-C59 PolarHBondContact O-N 3.05Å; V55-C59 VanDerWaalsContact O-N 3.08Å; V55-C59 PolarHBondContact O-SG 3.04Å
56	F	91.3	Very high	89.3	Confident	141 Å²	141	69.1 Å²	69.1	62%	0.618	41%	0.413	S	S	*	.	H	α-helix	trans	-62.4	-38.6	176.5	-75.6	-68.1	0	0	0	112.2	A52 M53 A58 C59 E60	A52-F56 WeakPolarHBondContact O-CD2 3.34Å; A52-F56 PolarHBondContact O-N 3.04Å; A52-F56 VanDerWaalsContact O-N 3.13Å; M53-F56 PolarHBondContact O-N 3.35Å; F56-A58 VanDerWaalsContact C-N 3.34Å; F56-A58 PolarHBondContact O-N 3.3Å; F56-C59 WeakPolarHBondContact O-CB 3.36Å; F56-C59 PolarHBondContact O-N 3.09Å; F56-E60 PolarHBondContact O-N 3.14Å
57	A	90.8	Very high	89.5	Confident	18 Å²	18	72.4 Å²	72.4	15%	0.149	43%	0.425	C	S	.	.	H	α-helix	trans	-57.4	-45.6	174.4	0	0	0	0	0	112.5	M27 M53 L54 V55 C59 E60 A61	M27-A57 HydrophobicContact CB-CB 4.02Å; M27-A57 HydrophobicContact CE-CB 3.29Å; M27-A57 HydrophobicContact CG-CB 3.96Å; M27-A57 HydrophobicContact SD-CB 4.47Å; M53-A57 WeakPolarHBondContact O-CB 3.48Å; M53-A57 PolarHBondContact O-N 3.42Å; L54-A57 WeakPolarHBondContact O-CB 3.45Å; L54-A57 PolarHBondContact O-N 2.94Å; V55-A57 VanDerWaalsContact C-N 3.31Å; V55-A57 PolarHBondContact O-N 3.33Å; A57-C59 VanDerWaalsContact C-N 3.32Å; A57-C59 PolarHBondContact O-N 3.48Å; A57-E60 PolarHBondContact O-N 3.18Å; A57-A61 WeakPolarHBondContact O-CB 3.43Å; A57-A61 PolarHBondContact O-N 3Å
58	A	90.9	Very high	89.7	Confident	57 Å²	57	69.8 Å²	69.8	47%	0.471	41%	0.411	S	S	.	.	H	α-helix	trans	-65.7	-36.7	178.8	0	0	0	0	0	111.8	L54 V55 F56 A61 A62	L54-A58 PolarHBondContact O-N 2.95Å; V55-A58 PolarHBondContact O-N 3.29Å; F56-A58 VanDerWaalsContact C-N 3.34Å; F56-A58 PolarHBondContact O-N 3.3Å; A58-A61 PolarHBondContact O-N 3.38Å; A58-A62 WeakPolarHBondContact O-CB 3.44Å; A58-A62 PolarHBondContact O-N 2.88Å
59	C	91.6	Very high	89.7	Confident	71 Å²	71	68.2 Å²	68.2	48%	0.48	41%	0.407	S	S	.	.	H	α-helix	trans	-63.5	-47	174.3	-65.3	0	0	0	0	111.8	V55 F56 A57 A61 A62 V63	V55-C59 PolarHBondContact O-N 3.05Å; V55-C59 VanDerWaalsContact O-N 3.08Å; V55-C59 PolarHBondContact O-SG 3.04Å; F56-C59 WeakPolarHBondContact O-CB 3.36Å; F56-C59 PolarHBondContact O-N 3.09Å; A57-C59 VanDerWaalsContact C-N 3.32Å; A57-C59 PolarHBondContact O-N 3.48Å; C59-A61 VanDerWaalsContact C-N 3.34Å; C59-A61 PolarHBondContact O-N 3.34Å; C59-A62 PolarHBondContact O-N 3.34Å; C59-V63 WeakPolarHBondContact O-CG2 3.45Å; C59-V63 PolarHBondContact O-N 2.92Å
60	E	89.1	Confident	89.5	Confident	120 Å²	120	66.5 Å²	66.5	56%	0.561	40%	0.398	S	S	*	.	H	α-helix	trans	-61.1	-42.8	176.8	-71.4	-176.1	169.4	0	0	111.9	F56 A57 A62 V63 G64	F56-E60 PolarHBondContact O-N 3.14Å; A57-E60 PolarHBondContact O-N 3.18Å; E60-A62 PolarHBondContact O-N 3.44Å; E60-V63 PolarHBondContact O-N 3.13Å; E60-G64 PolarHBondContact O-N 3.43Å
61	A	89.7	Confident	89	Confident	25 Å²	25	67.7 Å²	67.7	21%	0.207	40%	0.404	C	S	.	.	H	α-helix	trans	-62.2	-41.6	176	0	0	0	0	0	112.2	A57 A58 C59 G64 L65	A57-A61 WeakPolarHBondContact O-CB 3.43Å; A57-A61 PolarHBondContact O-N 3Å; A58-A61 PolarHBondContact O-N 3.38Å; C59-A61 VanDerWaalsContact C-N 3.34Å; C59-A61 PolarHBondContact O-N 3.34Å; A61-G64 PolarHBondContact O-N 3.32Å; A61-L65 WeakPolarHBondContact O-CG 3.43Å; A61-L65 PolarHBondContact O-N 3.01Å
62	A	90.6	Very high	88.6	Confident	59 Å²	59	64.2 Å²	64.2	49%	0.488	39%	0.39	S	S	.	.	H	α-helix	trans	-62.6	-43	176.5	0	0	0	0	0	112.3	A58 C59 E60 L65 A66	A58-A62 WeakPolarHBondContact O-CB 3.44Å; A58-A62 PolarHBondContact O-N 2.88Å; C59-A62 PolarHBondContact O-N 3.34Å; E60-A62 PolarHBondContact O-N 3.44Å; A62-L65 PolarHBondContact O-N 3.34Å; A62-A66 WeakPolarHBondContact O-CB 3.48Å; A62-A66 PolarHBondContact O-N 2.76Å
63	V	90.4	Very high	88.1	Confident	90 Å²	90	68.5 Å²	68.5	55%	0.545	41%	0.407	S	S	.	.	H	α-helix	trans	-66.4	-41.2	174.9	179.7	0	0	0	0	111	C59 E60 L65 A66 L67	C59-V63 WeakPolarHBondContact O-CG2 3.45Å; C59-V63 PolarHBondContact O-N 2.92Å; E60-V63 PolarHBondContact O-N 3.13Å; V63-L65 PolarHBondContact O-N 2.86Å; V63-A66 PolarHBondContact O-N 3.03Å; V63-L67 HydrophobicContact CG1-CD1 4.38Å; V63-L67 WeakPolarHBondContact O-CG 3.42Å; V63-L67 PolarHBondContact O-N 3.27Å
64	G	88.6	Confident	87.5	Confident	14 Å²	14	69 Å²	69	14%	0.144	42%	0.415	C	S	.	.	H	α-helix	trans	-59.8	-42.6	176.6	0	0	0	0	0	113	E60 A61 L67 L68	E60-G64 PolarHBondContact O-N 3.43Å; A61-G64 PolarHBondContact O-N 3.32Å; G64-L67 PolarHBondContact O-N 3.22Å; G64-L68 PolarHBondContact O-N 3.2Å
65	L	87.4	Confident	86.6	Confident	80 Å²	80	68.4 Å²	68.4	42%	0.419	41%	0.407	S	S	.	.	H	α-helix	trans	-67.4	-41.3	174.7	-74.1	165.6	0	0	0	112.2	M17 L20 A61 A62 V63 L67 L68 V69	M17-L65 HydrophobicContact SD-CD2 4.49Å; L20-L65 HydrophobicContact CD1-CD2 4.03Å; L20-L65 HydrophobicContact CD1-CG 4.4Å; A61-L65 WeakPolarHBondContact O-CG 3.43Å; A61-L65 PolarHBondContact O-N 3.01Å; A62-L65 PolarHBondContact O-N 3.34Å; V63-L65 PolarHBondContact O-N 2.86Å; L65-L67 VanDerWaalsContact C-N 3.3Å; L65-L67 PolarHBondContact O-N 3.35Å; L65-L68 WeakPolarHBondContact O-CB 3.14Å; L65-L68 PolarHBondContact O-N 3.25Å; L65-L68 VanDerWaalsContact O-N 3.16Å; L65-V69 WeakPolarHBondContact O-CG2 3.32Å; L65-V69 PolarHBondContact O-N 3.34Å
66	A	89.3	Confident	85.3	Confident	63 Å²	63	67.3 Å²	67.3	52%	0.521	41%	0.413	S	S	.	.	H	α-helix	trans	-60.3	-41	175.8	0	0	0	0	0	111.9	A62 V63 V69 S70	A62-A66 WeakPolarHBondContact O-CB 3.48Å; A62-A66 PolarHBondContact O-N 2.76Å; V63-A66 PolarHBondContact O-N 3.03Å; A66-V69 PolarHBondContact O-N 3.26Å; A66-S70 PolarHBondContact O-N 3.45Å
67	L	85.4	Confident	84.1	Confident	100 Å²	100	65.1 Å²	65.1	52%	0.524	41%	0.407	S	S	.	.	H	α-helix	trans	-63.7	-42.9	173.2	-75.1	171.6	0	0	0	111.8	V63 G64 L65 V69 S70 I71	V63-L67 HydrophobicContact CG1-CD1 4.38Å; V63-L67 WeakPolarHBondContact O-CG 3.42Å; V63-L67 PolarHBondContact O-N 3.27Å; G64-L67 PolarHBondContact O-N 3.22Å; L65-L67 VanDerWaalsContact C-N 3.3Å; L65-L67 PolarHBondContact O-N 3.35Å; L67-V69 VanDerWaalsContact C-N 3.31Å; L67-V69 PolarHBondContact O-N 3.5Å; L67-S70 PolarHBondContact O-N 3.45Å; L67-S70 VanDerWaalsContact O-N 3.07Å; L67-S70 PolarHBondContact O-OG 3.32Å; L67-I71 WeakPolarHBondContact O-CG1 3.48Å; L67-I71 PolarHBondContact O-N 3.11Å
68	L	85.1	Confident	82.7	Confident	13 Å²	13	66.9 Å²	66.9	7%	0.068	41%	0.414	C	S	.	.	H	α-helix	trans	-59.3	-44	177.2	-165	156.8	0	0	0	111.6	L16 M17 L20 G64 L65 S70 I71 S72	L16-L68 HydrophobicContact CB-CD1 4.13Å; L16-L68 HydrophobicContact CD2-CB 4.14Å; L16-L68 HydrophobicContact CD2-CD1 3.69Å; L16-L68 HydrophobicContact CD2-CG 4.06Å; M17-L68 HydrophobicContact CB-CD1 4.48Å; M17-L68 HydrophobicContact CG-CD1 3.71Å; M17-L68 HydrophobicContact SD-CD1 3.24Å; M17-L68 WeakPolarHBondContact SD-CD1 3.41Å; M17-L68 HydrophobicContact SD-CD2 4.1Å; M17-L68 HydrophobicContact SD-CG 4.33Å; L20-L68 HydrophobicContact CD1-CB 4.5Å; L20-L68 HydrophobicContact CD1-CD1 3.57Å; G64-L68 PolarHBondContact O-N 3.2Å; L65-L68 WeakPolarHBondContact O-CB 3.14Å; L65-L68 PolarHBondContact O-N 3.25Å; L65-L68 VanDerWaalsContact O-N 3.16Å; L68-S70 VanDerWaalsContact C-N 3.29Å; L68-S70 PolarHBondContact O-N 2.9Å; L68-I71 PolarHBondContact O-N 3.13Å; L68-S72 PolarHBondContact O-N 2.84Å; L68-S72 PolarHBondContact O-OG 3.01Å
69	V	86.2	Confident	81.4	Confident	79 Å²	79	68.7 Å²	68.7	48%	0.479	41%	0.409	S	S	.	.	H	α-helix	trans	-61.7	-37.4	174.8	174.5	0	0	0	0	111.7	L65 A66 L67 S72 N73	L65-V69 WeakPolarHBondContact O-CG2 3.32Å; L65-V69 PolarHBondContact O-N 3.34Å; A66-V69 PolarHBondContact O-N 3.26Å; L67-V69 VanDerWaalsContact C-N 3.31Å; L67-V69 PolarHBondContact O-N 3.5Å; V69-S72 WeakPolarHBondContact CA-OG 3.32Å; V69-S72 PolarHBondContact O-OG 3.03Å; V69-N73 WeakPolarHBondContact O-CB 3.19Å; V69-N73 VanDerWaalsContact O-CG 3.25Å; V69-N73 PolarHBondContact O-N 2.99Å; V69-N73 PolarHBondContact O-ND2 2.91Å
70	S	83.9	Confident	79.9	Confident	54 Å²	54	67.8 Å²	67.8	38%	0.378	40%	0.402	S	S	.	.	H	α-helix	trans	-66.1	-40.8	175.6	74.7	0	0	0	0	112.5	A66 L67 L68 N73 T74	A66-S70 PolarHBondContact O-N 3.45Å; L67-S70 PolarHBondContact O-N 3.45Å; L67-S70 VanDerWaalsContact O-N 3.07Å; L67-S70 PolarHBondContact O-OG 3.32Å; L68-S70 VanDerWaalsContact C-N 3.29Å; L68-S70 PolarHBondContact O-N 2.9Å; S70-N73 PolarHBondContact O-N 3.4Å; S70-T74 WeakPolarHBondContact O-CG2 3.48Å; S70-T74 PolarHBondContact O-N 2.87Å; S70-T74 VanDerWaalsContact O-N 3.09Å; S70-T74 PolarHBondContact O-OG1 3.39Å
71	I	80	Confident	78.5	Confident	27 Å²	27	69.6 Å²	69.6	14%	0.138	41%	0.409	C	S	.	.	H	α-helix	trans	-67.8	-42	178.6	-65.8	164.8	0	0	0	110.6	L16 L67 L68 N73 T74 Y75 L83	L16-I71 HydrophobicContact CD1-CD1 4.04Å; L67-I71 WeakPolarHBondContact O-CG1 3.48Å; L67-I71 PolarHBondContact O-N 3.11Å; L68-I71 PolarHBondContact O-N 3.13Å; I71-N73 VanDerWaalsContact C-N 3.32Å; I71-N73 PolarHBondContact O-N 3.22Å; I71-T74 PolarHBondContact O-N 2.96Å; I71-T74 PolarHBondContact O-OG1 3.47Å; I71-T74 VanDerWaalsContact O-OG1 3.1Å; I71-Y75 HydrophobicContact CG2-CD2 4.09Å; I71-Y75 PolarHBondContact O-N 3.12Å; I71-L83 HydrophobicContact CD1-CD1 4.37Å
72	S	81.4	Confident	77	Confident	33 Å²	33	71.8 Å²	71.8	23%	0.231	42%	0.418	C	S	.	.	H	α-helix	trans	-66.3	-35.2	177.5	71	0	0	0	0	111.7	L68 V69 G76 D78	L68-S72 PolarHBondContact O-N 2.84Å; L68-S72 PolarHBondContact O-OG 3.01Å; V69-S72 WeakPolarHBondContact CA-OG 3.32Å; V69-S72 PolarHBondContact O-OG 3.03Å; S72-G76 WeakPolarHBondContact O-CA 3.39Å; S72-G76 PolarHBondContact O-N 3.22Å; S72-D78 WeakPolarHBondContact CB-OD1 3.3Å
73	N	81.9	Confident	75.6	Confident	130 Å²	130	72.1 Å²	72.1	70%	0.695	41%	0.411	S	S	*	.	H	α-helix	trans	-68.7	-33.6	173.5	-76.7	-35	0	0	0	113.5	V69 S70 I71	V69-N73 WeakPolarHBondContact O-CB 3.19Å; V69-N73 VanDerWaalsContact O-CG 3.25Å; V69-N73 PolarHBondContact O-N 2.99Å; V69-N73 PolarHBondContact O-ND2 2.91Å; S70-N73 PolarHBondContact O-N 3.4Å; I71-N73 VanDerWaalsContact C-N 3.32Å; I71-N73 PolarHBondContact O-N 3.22Å
74	T	78.4	Confident	74.4	Confident	100 Å²	100	72.3 Å²	72.3	61%	0.613	41%	0.409	S	S	*	.	H	α-helix	trans	-84.1	-35	-179.7	53.7	0	0	0	0	113.7	S70 I71	S70-T74 WeakPolarHBondContact O-CG2 3.48Å; S70-T74 PolarHBondContact O-N 2.87Å; S70-T74 VanDerWaalsContact O-N 3.09Å; S70-T74 PolarHBondContact O-OG1 3.39Å; I71-T74 PolarHBondContact O-N 2.96Å; I71-T74 PolarHBondContact O-OG1 3.47Å; I71-T74 VanDerWaalsContact O-OG1 3.1Å
75	Y	72.6	Confident	73.2	Confident	78 Å²	78	77.5 Å²	77.5	31%	0.306	43%	0.433	S	S	.	.	H	α-helix	trans	-113.5	-5.5	-173.8	-64.2	-77.5	0	0	0	114.3	I71 L77 N82 L83 L85	I71-Y75 HydrophobicContact CG2-CD2 4.09Å; I71-Y75 PolarHBondContact O-N 3.12Å; Y75-L77 PolarHBondContact O-N 3.44Å; Y75-N82 HydrophobicContact CD1-CB 3.82Å; Y75-N82 HydrophobicContact CE1-CB 4.34Å; Y75-N82 HydrophobicContact CG-CB 4.01Å; Y75-L83 HydrophobicContact CE2-CD2 3.84Å; Y75-L85 HydrophobicContact CE1-CD1 4.14Å; Y75-L85 WeakPolarHBondContact OH-CD1 3.41Å
76	G	67.7	Low	72.2	Confident	61 Å²	61	81.3 Å²	81.3	63%	0.629	45%	0.453	S	S	*	.	S	Bend	trans	69.4	-9.1	-179.6	0	0	0	0	0	115.3	S72	S72-G76 WeakPolarHBondContact O-CA 3.39Å; S72-G76 PolarHBondContact O-N 3.22Å
77	L	65	Low	71	Confident	96 Å²	96	85.5 Å²	85.5	50%	0.503	46%	0.461	S	S	.	.	S	Bend	trans	-143.5	139.9	-175.1	-64.5	170.7	0	0	0	110.7	Y75 Y79	Y75-L77 PolarHBondContact O-N 3.44Å; L77-Y79 HydrophobicContact CB-CD2 3.69Å; L77-Y79 HydrophobicContact CB-CE2 4.23Å; L77-Y79 HydrophobicContact CD1-CD2 4.04Å; L77-Y79 HydrophobicContact CD1-CE2 4.15Å; L77-Y79 HydrophobicContact CD2-CE2 4.47Å; L77-Y79 HydrophobicContact CG-CD2 4.37Å; L77-Y79 PolarHBondContact O-N 3.07Å
78	D	62.4	Low	69.6	Low	55 Å²	55	89.1 Å²	89.1	29%	0.294	49%	0.493	S	S	.	.			trans	-75.3	23.6	-176.9	-58.4	-28.5	0	0	0	114.6	S72	S72-D78 WeakPolarHBondContact CB-OD1 3.3Å
79	Y	62.6	Low	68.9	Low	94 Å²	94	92.9 Å²	92.9	37%	0.369	51%	0.514	S	S	.	.	B	Isolated β-bridge	trans	-84.8	120.7	-175.3	-71	-60.6	0	0	0	111.8	S14 H15 L77 H81 N82	S14-Y79 WeakPolarHBondContact O-CA 3.45Å; H15-Y79 AromaticContact CE1-CE1 3.47Å; H15-Y79 VanDerWaalsContact CE1-CE1 3.47Å; H15-Y79 WeakPolarHBondContact CE1-CE1 3.42Å; H15-Y79 AromaticContact CE1-CZ 3.83Å; H15-Y79 AromaticContact NE2-CE1 3.83Å; L77-Y79 HydrophobicContact CB-CD2 3.69Å; L77-Y79 HydrophobicContact CB-CE2 4.23Å; L77-Y79 HydrophobicContact CD1-CD2 4.04Å; L77-Y79 HydrophobicContact CD1-CE2 4.15Å; L77-Y79 HydrophobicContact CD2-CE2 4.47Å; L77-Y79 HydrophobicContact CG-CD2 4.37Å; L77-Y79 PolarHBondContact O-N 3.07Å; Y79-H81 PolarHBondContact O-N 3.42Å; Y79-H81 VanDerWaalsContact O-N 3.15Å; Y79-N82 PolarHBondContact O-N 3.38Å
80	V	60.8	Low	68	Low	53 Å²	53	93.6 Å²	93.6	32%	0.321	52%	0.516	S	S	.	.	G	3₁₀ helix	trans	-59.5	-27.3	176.5	-173.5	0	0	0	0	112	S14 L16 N82 L83	S14-V80 PolarHBondContact O-N 2.99Å; L16-V80 HydrophobicContact CB-CG2 4.26Å; L16-V80 HydrophobicContact CD1-CG2 4.22Å; V80-N82 PolarHBondContact O-N 2.92Å; V80-L83 PolarHBondContact O-N 3Å
81	H	59.3	Low	67.1	Low	157 Å²	157	95.8 Å²	95.8	73%	0.727	52%	0.524	S	S	*	.	G	3₁₀ helix	trans	-64.6	-23.8	-179.7	-163.2	-17.9	0	0	0	113.6	Y79 L83	Y79-H81 PolarHBondContact O-N 3.42Å; Y79-H81 VanDerWaalsContact O-N 3.15Å; H81-L83 PolarHBondContact O-N 2.95Å
82	N	58.9	Low	66.3	Low	71 Å²	71	99.9 Å²	99.9	38%	0.38	55%	0.547	S	S	.	.	G	3₁₀ helix	trans	-73.1	-11.6	179.3	-87.6	7.3	0	0	0	113.7	Y75 Y79 V80 N84	Y75-N82 HydrophobicContact CD1-CB 3.82Å; Y75-N82 HydrophobicContact CE1-CB 4.34Å; Y75-N82 HydrophobicContact CG-CB 4.01Å; Y79-N82 PolarHBondContact O-N 3.38Å; V80-N82 PolarHBondContact O-N 2.92Å; N82-N84 PolarHBondContact O-N 3.22Å; N82-N84 VanDerWaalsContact O-N 3.11Å
83	L	61	Low	65.4	Low	66 Å²	66	104.1 Å²	104.1	35%	0.346	57%	0.566	S	S	.	*	G	3₁₀ helix	trans	-80.8	23.1	-179.6	-64	169.4	0	0	0	113.9	I71 Y75 V80 H81 L85	I71-L83 HydrophobicContact CD1-CD1 4.37Å; Y75-L83 HydrophobicContact CE2-CD2 3.84Å; V80-L83 PolarHBondContact O-N 3Å; H81-L83 PolarHBondContact O-N 2.95Å; L83-L85 PolarHBondContact O-N 3.26Å
84	N	65.1	Low	64.3	Low	95 Å²	95	102.3 Å²	102.3	51%	0.508	56%	0.558	S	S	.	*	G	3₁₀ helix	trans	-82.1	5.2	-174.8	-138.7	32.6	0	0	0	114.7	N82 L86 Q87	N82-N84 PolarHBondContact O-N 3.22Å; N82-N84 VanDerWaalsContact O-N 3.11Å; N84-L86 VanDerWaalsContact C-N 3.26Å; N84-L86 PolarHBondContact O-N 3.38Å; N84-Q87 PolarHBondContact ND2-OE1 3.33Å; N84-Q87 PolarHBondContact O-N 3.44Å; N84-Q87 PolarHBondContact OD1-OE1 2.98Å
85	L	62.8	Low	63.2	Low	122 Å²	122	102.5 Å²	102.5	64%	0.639	55%	0.554	S	S	*	*	G	3₁₀ helix	trans	-69.3	-19.9	178.8	-81.8	160.7	0	0	0	113.8	Y75 L83 Q87	Y75-L85 HydrophobicContact CE1-CD1 4.14Å; Y75-L85 WeakPolarHBondContact OH-CD1 3.41Å; L83-L85 PolarHBondContact O-N 3.26Å; L85-Q87 VanDerWaalsContact C-N 3.3Å
86	L	65.8	Low	62.5	Low	160 Å²	160	104.4 Å²	104.4	84%	0.838	57%	0.573	S	S	*	*	G	3₁₀ helix	trans	-84.4	0.8	177.4	-78.8	154.1	0	0	0	113.6	N84 C88	N84-L86 VanDerWaalsContact C-N 3.26Å; N84-L86 PolarHBondContact O-N 3.38Å; L86-C88 VanDerWaalsContact C-N 3.26Å
87	Q	64	Low	62.1	Low	151 Å²	151	108 Å²	108	71%	0.706	57%	0.568	S	S	*	*	G	3₁₀ helix	trans	-83.1	-2.3	175	-156.2	-174.9	-26.3	0	0	112.7	N84 L85	N84-Q87 PolarHBondContact ND2-OE1 3.33Å; N84-Q87 PolarHBondContact O-N 3.44Å; N84-Q87 PolarHBondContact OD1-OE1 2.98Å; L85-Q87 VanDerWaalsContact C-N 3.3Å
88	C	57.6	Low	61.8	Low	176 Å²	176	109.1 Å²	109.1	100%	1.189	57%	0.574	S	S	*	*			trans	-86.4	0	171.4	-67.3	0	0	0	0	110.9	L86	L86-C88 VanDerWaalsContact C-N 3.26Å

Retrieved 88 of 88 residues in 82.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).