A0A059T9N9_HUMAN Loading...

Atypical chemokine receptor 1

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1 and TARC. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.

AlphaFold DB , UniProt , Accession A0A059T9N9, Species HUMAN (Homo sapiens, Human), Gene DARC, Length 116 aa.

						>A0A059T9N9_HUMAN|A0A059T9N9|DARC
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGTAGCGQCPLQHCGARLGPRAR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.7	Very low	42	Very low	253 Å²	253	149.4 Å²	149.4	100%	1.246	82%	0.815	S	S	*	*				0	96	0	-68.2	-164	175.9	0	0	107.6
2	G	43.2	Very low	42.7	Very low	75 Å²	75	146.3 Å²	146.3	77%	0.773	81%	0.808	S	S	*	*			trans	-101.8	129.5	175.2	0	0	0	0	0	108.6
3	N	41.6	Very low	42	Very low	131 Å²	131	143.3 Å²	143.3	70%	0.701	80%	0.804	S	S	*	*			trans	-85.2	113.5	-174.7	-171.9	21.2	0	0	0	109.3	L5	N3-L5 VanDerWaalsContact ND2-CD1 3.29Å; N3-L5 WeakPolarHBondContact ND2-CD1 3.47Å; N3-L5 VanDerWaalsContact ND2-CG 3.27Å; N3-L5 WeakPolarHBondContact ND2-CG 3.5Å; N3-L5 PolarHBondContact O-N 2.74Å
4	C	44.7	Very low	42	Very low	130 Å²	130	142.3 Å²	142.3	88%	0.878	80%	0.803	S	S	*	*			trans	-78.6	70.7	172.6	-52.5	0	0	0	0	109.5	H6	C4-H6 PolarHBondContact O-N 3.26Å
5	L	47.6	Very low	41.6	Very low	136 Å²	136	143 Å²	143	71%	0.712	80%	0.797	S	S	*	*			trans	-74.1	112.7	169.8	-79.1	175.7	0	0	0	109.8	N3	N3-L5 VanDerWaalsContact ND2-CD1 3.29Å; N3-L5 WeakPolarHBondContact ND2-CD1 3.47Å; N3-L5 VanDerWaalsContact ND2-CG 3.27Å; N3-L5 WeakPolarHBondContact ND2-CG 3.5Å; N3-L5 PolarHBondContact O-N 2.74Å
6	H	39.4	Very low	41	Very low	157 Å²	157	142.9 Å²	142.9	73%	0.727	79%	0.794	S	S	*	*			trans	61.7	92.9	145.9	-123.9	53.9	0	0	0	116.5	C4	C4-H6 PolarHBondContact O-N 3.26Å
7	R	41	Very low	41.3	Very low	248 Å²	248	141.6 Å²	141.6	94%	0.936	80%	0.797	S	S	*	*			trans	-84.1	112.5	143.6	-170.7	153.5	-174.9	86.7	-0.9	107	E9	R7-E9 PolarHBondContact O-N 3.41Å
8	A	43.7	Very low	41.4	Very low	68 Å²	68	139.3 Å²	139.3	56%	0.562	79%	0.792	S	S	*	*			trans	-44.8	131.1	177.5	0	0	0	0	0	111.7
9	E	35.1	Very low	41.7	Very low	162 Å²	162	141.7 Å²	141.7	76%	0.757	80%	0.796	S	S	*	*			trans	44	102.5	136.2	-58.7	-86.3	131.7	0	0	115.4	R7 S11	R7-E9 PolarHBondContact O-N 3.41Å; E9-S11 PolarHBondContact O-N 3.23Å
10	L	46.2	Very low	42.1	Very low	173 Å²	173	142.3 Å²	142.3	91%	0.906	80%	0.796	S	S	*	*			trans	-58.5	122.2	150.2	-73.1	94.9	0	0	0	108.2
11	S	34.2	Very low	42.3	Very low	110 Å²	110	139.7 Å²	139.7	77%	0.769	78%	0.781	S	S	*	*			trans	-152.1	135.8	138.4	-85.2	0	0	0	0	111.5	E9	E9-S11 PolarHBondContact O-N 3.23Å
12	P	50.6	Low	42.5	Very low	112 Å²	112	136.4 Å²	136.4	73%	0.727	76%	0.76	S	S	*	*			trans	-82.6	124.8	-176.4	33.4	-30.8	0	0	0	109.8	T14	P12-T14 PolarHBondContact O-N 2.93Å; P12-T14 VanDerWaalsContact O-N 3.1Å
13	S	33.6	Very low	42.9	Very low	108 Å²	108	138.7 Å²	138.7	76%	0.755	75%	0.75	S	S	*	*			trans	-73.8	102.9	163	54.1	0	0	0	0	107.9	E15	S13-E15 PolarHBondContact O-N 3.29Å
14	T	42.1	Very low	43.4	Very low	129 Å²	129	137.7 Å²	137.7	79%	0.791	75%	0.745	S	S	*	*			trans	-67.7	116.7	172.4	-67.5	0	0	0	0	110	P12	P12-T14 PolarHBondContact O-N 2.93Å; P12-T14 VanDerWaalsContact O-N 3.1Å
15	E	34.9	Very low	43.9	Very low	153 Å²	153	136.1 Å²	136.1	72%	0.715	73%	0.731	S	S	*	*			trans	-144.2	106.6	148.2	50.2	-141.7	127.8	0	0	109.8	S13	S13-E15 PolarHBondContact O-N 3.29Å
16	N	33.3	Very low	44.1	Very low	141 Å²	141	137.8 Å²	137.8	75%	0.754	73%	0.728	S	S	*	*			trans	33.3	121	154.8	69.4	-46.3	0	0	0	122.3
17	S	45	Very low	44.4	Very low	121 Å²	121	134.3 Å²	134.3	85%	0.846	72%	0.715	S	S	*	*			trans	-22.2	122.4	155.8	-55.9	0	0	0	0	118.4
18	S	42.6	Very low	44.9	Very low	101 Å²	101	126.6 Å²	126.6	71%	0.706	70%	0.699	S	S	*	*				-168.2	112.5	115.3	55.5	0	0	0	0	110.3	L20	S18-L20 PolarHBondContact O-N 2.96Å
19	Q	47.7	Very low	45.4	Very low	185 Å²	185	128 Å²	128	86%	0.864	71%	0.705	S	S	*	*			trans	31.2	76.9	147.6	-166.7	174.8	-4.9	0	0	115.7	D21	Q19-D21 PolarHBondContact O-N 3.38Å
20	L	49.8	Very low	46	Very low	152 Å²	152	126.4 Å²	126.4	80%	0.796	69%	0.693	S	S	*	*			trans	-82.6	102.3	160.4	-63.1	-177.8	0	0	0	106.7	S18 F22	S18-L20 PolarHBondContact O-N 2.96Å; L20-F22 PolarHBondContact O-N 3.15Å
21	D	46.5	Very low	45.9	Very low	88 Å²	88	120.8 Å²	120.8	47%	0.471	68%	0.677	S	S	.	*			trans	-63.9	117.9	172.8	-166.6	30.2	0	0	0	107.9	Q19 E23 D24	Q19-D21 PolarHBondContact O-N 3.38Å; D21-E23 PolarHBondContact O-N 3.23Å; D21-D24 PolarHBondContact O-N 2.81Å; D21-D24 VanDerWaalsContact O-N 3.1Å
22	F	50.7	Low	46.4	Very low	184 Å²	184	120 Å²	120	81%	0.807	67%	0.667	S	S	*	*	H	α-helix	trans	-61.5	-22.6	-170	-138.7	-96.2	0	0	0	111.8	L20 W26	L20-F22 PolarHBondContact O-N 3.15Å; F22-W26 PolarHBondContact O-N 2.98Å
23	E	51.6	Low	46.5	Very low	123 Å²	123	121.8 Å²	121.8	58%	0.575	67%	0.671	S	S	*	*	H	α-helix	trans	-69.6	-34.5	177.6	-71.9	-71.9	114.6	0	0	113.5	D21 W26 N27	D21-E23 PolarHBondContact O-N 3.23Å; E23-W26 PolarHBondContact O-N 3.48Å; E23-N27 VanDerWaalsContact O-CB 3.28Å; E23-N27 WeakPolarHBondContact O-CB 3.48Å; E23-N27 PolarHBondContact O-N 3.22Å
24	D	51.9	Low	46.8	Very low	110 Å²	110	121.7 Å²	121.7	59%	0.588	66%	0.662	S	S	*	*	H	α-helix	trans	-74.6	-36.1	-177.3	-82	-36.2	0	0	0	112.5	D21 N27 S28	D21-D24 PolarHBondContact O-N 2.81Å; D21-D24 VanDerWaalsContact O-N 3.1Å; D24-N27 PolarHBondContact O-N 3.43Å; D24-S28 PolarHBondContact O-N 2.81Å
25	V	54.7	Low	47.3	Very low	98 Å²	98	121 Å²	121	59%	0.594	66%	0.662	S	S	*	*	H	α-helix	trans	-68.9	-39.5	175	171	0	0	0	0	110.7	S29	V25-S29 PolarHBondContact O-N 2.85Å
26	W	51.3	Low	47.6	Very low	170 Å²	170	122 Å²	122	64%	0.644	66%	0.664	S	S	*	*	H	α-helix	trans	-62.4	-49.9	174.3	-171.5	-120.1	0	0	0	109.6	F22 E23 S28 S29 Y30	F22-W26 PolarHBondContact O-N 2.98Å; E23-W26 PolarHBondContact O-N 3.48Å; W26-S28 VanDerWaalsContact C-N 3.32Å; W26-S28 PolarHBondContact O-N 3.4Å; W26-S29 WeakPolarHBondContact O-CB 3.29Å; W26-S29 PolarHBondContact O-N 2.92Å; W26-Y30 VanDerWaalsContact C-CD1 3.47Å; W26-Y30 HydrophobicContact CB-CE1 4.22Å; W26-Y30 AromaticContact CD1-CD1 3.98Å; W26-Y30 AromaticContact CD1-CE1 3.26Å; W26-Y30 HydrophobicContact CD2-CD1 4.32Å; W26-Y30 HydrophobicContact CD2-CE1 4.31Å; W26-Y30 HydrophobicContact CG-CD1 4.11Å; W26-Y30 AromaticContact CG-CE1 3.67Å; W26-Y30 HydrophobicContact CG-CE1 3.67Å; W26-Y30 AromaticContact NE1-CD1 3.91Å; W26-Y30 AromaticContact NE1-CE1 3.52Å; W26-Y30 WeakPolarHBondContact O-CD1 3.36Å; W26-Y30 WeakPolarHBondContact O-CE1 3.2Å; W26-Y30 PolarHBondContact O-N 3.19Å
27	N	46.8	Very low	48.1	Very low	84 Å²	84	120.4 Å²	120.4	45%	0.449	66%	0.661	S	S	.	*	H	α-helix	trans	-61.8	-32.4	179.9	-161.7	48.1	0	0	0	115.2	E23 D24 S29 Y30 G31	E23-N27 VanDerWaalsContact O-CB 3.28Å; E23-N27 WeakPolarHBondContact O-CB 3.48Å; E23-N27 PolarHBondContact O-N 3.22Å; D24-N27 PolarHBondContact O-N 3.43Å; N27-S29 VanDerWaalsContact C-N 3.34Å; N27-Y30 WeakPolarHBondContact CA-OH 3.26Å; N27-Y30 HydrophobicContact CB-CE1 4.2Å; N27-Y30 HydrophobicContact CB-CE2 4.32Å; N27-Y30 VanDerWaalsContact CB-OH 3.25Å; N27-Y30 WeakPolarHBondContact CB-OH 3.32Å; N27-Y30 VanDerWaalsContact CG-OH 3.24Å; N27-Y30 VanDerWaalsContact N-CE1 3.35Å; N27-Y30 WeakPolarHBondContact OD1-CE2 3.34Å; N27-Y30 PolarHBondContact OD1-OH 3.32Å; N27-G31 PolarHBondContact O-N 3.45Å
28	S	50.3	Low	48.2	Very low	86 Å²	86	123 Å²	123	60%	0.601	67%	0.666	S	S	*	*	H	α-helix	trans	-73.3	-25.5	172.4	-170.3	0	0	0	0	113.2	D24 W26	D24-S28 PolarHBondContact O-N 2.81Å; W26-S28 VanDerWaalsContact C-N 3.32Å; W26-S28 PolarHBondContact O-N 3.4Å
29	S	54.8	Low	48.4	Very low	98 Å²	98	120 Å²	120	69%	0.685	65%	0.65	S	S	*	*	H	α-helix	trans	-81.6	-26.3	-176.5	-173.5	0	0	0	0	113.3	V25 W26 N27	V25-S29 PolarHBondContact O-N 2.85Å; W26-S29 WeakPolarHBondContact O-CB 3.29Å; W26-S29 PolarHBondContact O-N 2.92Å; N27-S29 VanDerWaalsContact C-N 3.34Å
30	Y	46.8	Very low	48.4	Very low	129 Å²	129	118.2 Å²	118.2	51%	0.506	65%	0.647	S	S	.	*	H	α-helix	trans	-106.9	-2.8	177.8	59.7	-105.7	0	0	0	113.8	W26 N27	W26-Y30 VanDerWaalsContact C-CD1 3.47Å; W26-Y30 HydrophobicContact CB-CE1 4.22Å; W26-Y30 AromaticContact CD1-CD1 3.98Å; W26-Y30 AromaticContact CD1-CE1 3.26Å; W26-Y30 HydrophobicContact CD2-CD1 4.32Å; W26-Y30 HydrophobicContact CD2-CE1 4.31Å; W26-Y30 HydrophobicContact CG-CD1 4.11Å; W26-Y30 AromaticContact CG-CE1 3.67Å; W26-Y30 HydrophobicContact CG-CE1 3.67Å; W26-Y30 AromaticContact NE1-CD1 3.91Å; W26-Y30 AromaticContact NE1-CE1 3.52Å; W26-Y30 WeakPolarHBondContact O-CD1 3.36Å; W26-Y30 WeakPolarHBondContact O-CE1 3.2Å; W26-Y30 PolarHBondContact O-N 3.19Å; N27-Y30 WeakPolarHBondContact CA-OH 3.26Å; N27-Y30 HydrophobicContact CB-CE1 4.2Å; N27-Y30 HydrophobicContact CB-CE2 4.32Å; N27-Y30 VanDerWaalsContact CB-OH 3.25Å; N27-Y30 WeakPolarHBondContact CB-OH 3.32Å; N27-Y30 VanDerWaalsContact CG-OH 3.24Å; N27-Y30 VanDerWaalsContact N-CE1 3.35Å; N27-Y30 WeakPolarHBondContact OD1-CE2 3.34Å; N27-Y30 PolarHBondContact OD1-OH 3.32Å
31	G	45.6	Very low	48.2	Very low	55 Å²	55	120.2 Å²	120.2	57%	0.567	65%	0.645	S	S	*	*			trans	-96.6	17.8	-175.5	0	0	0	0	0	115.7	N27	N27-G31 PolarHBondContact O-N 3.45Å
32	V	43.9	Very low	48.3	Very low	93 Å²	93	118.4 Å²	118.4	56%	0.564	65%	0.648	S	S	*	*			trans	-105.6	102.5	176.4	-164.4	0	0	0	0	109.8	D34	V32-D34 VanDerWaalsContact C-N 3.33Å; V32-D34 VanDerWaalsContact CG1-CG 3.47Å; V32-D34 WeakPolarHBondContact CG1-OD1 3.31Å; V32-D34 WeakPolarHBondContact CG1-OD2 3.38Å; V32-D34 PolarHBondContact O-N 3.1Å
33	N	53.6	Low	48.2	Very low	150 Å²	150	112.2 Å²	112.2	80%	0.802	63%	0.63	S	S	*	*			trans	-64.7	86.6	171.1	175.8	37.6	0	0	0	110
34	D	38.1	Very low	48	Very low	106 Å²	106	113.1 Å²	113.1	57%	0.567	64%	0.639	S	S	*	*			trans	-111.6	91.2	179.2	-72.2	-32.1	0	0	0	110.3	V32 F36	V32-D34 VanDerWaalsContact C-N 3.33Å; V32-D34 VanDerWaalsContact CG1-CG 3.47Å; V32-D34 WeakPolarHBondContact CG1-OD1 3.31Å; V32-D34 WeakPolarHBondContact CG1-OD2 3.38Å; V32-D34 PolarHBondContact O-N 3.1Å; D34-F36 VanDerWaalsContact C-N 3.33Å; D34-F36 HydrophobicContact CB-CD2 3.94Å; D34-F36 PolarHBondContact O-N 2.73Å
35	S	52.6	Low	47.9	Very low	113 Å²	113	114 Å²	114	79%	0.79	64%	0.643	S	S	*	*			trans	-60	100	150.1	-67	0	0	0	0	107.6
36	F	42.1	Very low	47.4	Very low	174 Å²	174	116.6 Å²	116.6	76%	0.763	65%	0.649	S	S	*	*			trans	-123.7	138	173.2	-106.1	-100.7	0	0	0	111.4	D34	D34-F36 VanDerWaalsContact C-N 3.33Å; D34-F36 HydrophobicContact CB-CD2 3.94Å; D34-F36 PolarHBondContact O-N 2.73Å
37	P	44.3	Very low	47.4	Very low	108 Å²	108	113 Å²	113	70%	0.701	66%	0.655	S	S	*	*			trans	-73.9	148.6	-168.7	30.3	-34.1	0	0	0	112.3	G39	P37-G39 PolarHBondContact O-N 3.44Å; P37-G39 VanDerWaalsContact O-N 3.13Å
38	D	47.5	Very low	47.6	Very low	176 Å²	176	112.1 Å²	112.1	94%	0.941	66%	0.659	S	S	*	*			trans	-42.7	109.5	167.2	-167.6	58.8	0	0	0	110.8
39	G	45	Very low	47.3	Very low	37 Å²	37	111.9 Å²	111.9	38%	0.381	66%	0.663	S	S	.	*			trans	-156.1	63.5	-171.9	0	0	0	0	0	111.4	P37 Y41	P37-G39 PolarHBondContact O-N 3.44Å; P37-G39 VanDerWaalsContact O-N 3.13Å; G39-Y41 VanDerWaalsContact C-N 3.29Å; G39-Y41 WeakPolarHBondContact O-CD2 3.39Å; G39-Y41 WeakPolarHBondContact O-CE2 3.25Å; G39-Y41 PolarHBondContact O-N 2.89Å
40	D	47.9	Very low	46.9	Very low	148 Å²	148	112.7 Å²	112.7	79%	0.791	67%	0.666	S	S	*	*			trans	34.7	46.4	152.5	-145.7	0.7	0	0	0	118.3
41	Y	46.7	Very low	47.2	Very low	195 Å²	195	112.7 Å²	112.7	77%	0.765	68%	0.683	S	S	*	*			trans	-87.7	11.3	170.2	-66.9	-76.5	0	0	0	112.2	G39 L45	G39-Y41 VanDerWaalsContact C-N 3.29Å; G39-Y41 WeakPolarHBondContact O-CD2 3.39Å; G39-Y41 WeakPolarHBondContact O-CE2 3.25Å; G39-Y41 PolarHBondContact O-N 2.89Å; Y41-L45 VanDerWaalsContact O-CD1 3.3Å; Y41-L45 WeakPolarHBondContact O-CD1 3.36Å; Y41-L45 WeakPolarHBondContact O-CG 3.41Å
42	G	47.9	Very low	47.3	Very low	50 Å²	50	117.7 Å²	117.7	52%	0.515	69%	0.691	S	S	.	*	S	Bend	trans	-78.8	-37.9	-177.2	0	0	0	0	0	113.9	N44	G42-N44 PolarHBondContact O-N 3.42Å
43	A	49.8	Very low	47.9	Very low	53 Å²	53	118.2 Å²	118.2	44%	0.438	70%	0.699	S	S	.	*	T	Hydrogen-bonded Turn	trans	-78.2	-18.7	-169.3	0	0	0	0	0	115	E46	A43-E46 WeakPolarHBondContact O-CG 3.12Å
44	N	47.4	Very low	47.8	Very low	143 Å²	143	116.1 Å²	116.1	77%	0.765	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.6	-6.7	-179	-76	-8.4	0	0	0	113.9	G42	G42-N44 PolarHBondContact O-N 3.42Å
45	L	48.1	Very low	48.6	Very low	128 Å²	128	116.8 Å²	116.8	67%	0.67	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95	-11.3	177.2	-66.5	175.6	0	0	0	112.8	Y41	Y41-L45 VanDerWaalsContact O-CD1 3.3Å; Y41-L45 WeakPolarHBondContact O-CD1 3.36Å; Y41-L45 WeakPolarHBondContact O-CG 3.41Å
46	E	45.7	Very low	48.7	Very low	153 Å²	153	118.5 Å²	118.5	72%	0.715	70%	0.698	S	S	*	*	S	Bend	trans	-79.2	-15.6	173.6	47.1	168	104	0	0	113.6	A43	A43-E46 WeakPolarHBondContact O-CG 3.12Å
47	A	50.6	Low	49.3	Very low	93 Å²	93	112.9 Å²	112.9	77%	0.769	68%	0.676	S	S	*	*	S	Bend	trans	-97.9	-10.8	-178.6	0	0	0	0	0	114.8
48	A	49.9	Very low	49.9	Very low	66 Å²	66	113.7 Å²	113.7	55%	0.545	67%	0.674	S	S	.	*	S	Bend	trans	-105.5	118.7	167.8	0	0	0	0	0	107.5
49	A	45.8	Very low	50.5	Low	82 Å²	82	111.4 Å²	111.4	68%	0.678	66%	0.662	S	S	*	*			trans	-33.8	125.4	-175.2	0	0	0	0	0	112.4	C51	A49-C51 PolarHBondContact O-N 3.13Å
50	P	46.1	Very low	51.2	Low	115 Å²	115	114 Å²	114	75%	0.747	67%	0.674	S	S	*	*			trans	-52.1	100.7	176.4	-27	33	0	0	0	110.5	H52	P50-H52 PolarHBondContact O-N 3.46Å
51	C	52.3	Low	52.2	Low	128 Å²	128	109 Å²	109	87%	0.865	65%	0.653	S	S	*	*			trans	-78.3	58.6	164.7	-69.8	0	0	0	0	107.8	A49 S53	A49-C51 PolarHBondContact O-N 3.13Å; C51-S53 PolarHBondContact O-N 3.22Å; C51-S53 VanDerWaalsContact O-N 3.17Å
52	H	48.3	Very low	53.4	Low	161 Å²	161	102.9 Å²	102.9	75%	0.745	63%	0.633	S	S	*	*			trans	-66.5	113.2	160.3	-159.2	-56.9	0	0	0	104.7	P50 C54	P50-H52 PolarHBondContact O-N 3.46Å; H52-C54 PolarHBondContact O-N 3.41Å
53	S	55.6	Low	54.9	Low	103 Å²	103	103.5 Å²	103.5	72%	0.72	63%	0.628	S	S	*	*			trans	-38.1	107.6	170.5	-176.8	0	0	0	0	108.6	C51 N55	C51-S53 PolarHBondContact O-N 3.22Å; C51-S53 VanDerWaalsContact O-N 3.17Å; S53-N55 PolarHBondContact O-N 3.12Å
54	C	51.7	Low	56.6	Low	106 Å²	106	107.8 Å²	107.8	72%	0.716	64%	0.637	S	S	*	*			trans	-70.1	94.5	171.7	-72.6	0	0	0	0	105.4	H52 L56	H52-C54 PolarHBondContact O-N 3.41Å; C54-L56 HydrophobicContact CB-CB 4.41Å; C54-L56 PolarHBondContact O-N 2.84Å
55	N	55.7	Low	58.3	Low	121 Å²	121	106.7 Å²	106.7	65%	0.647	63%	0.626	S	S	*	*			trans	-64.9	80.5	154.2	-163.5	15.1	0	0	0	106.4	S53 L57	S53-N55 PolarHBondContact O-N 3.12Å; N55-L57 CarbonylContact O-C 3.59Å; N55-L57 PolarHBondContact O-N 2.88Å; N55-L57 VanDerWaalsContact O-N 3.13Å
56	L	53.7	Low	60.2	Low	148 Å²	148	105 Å²	105	78%	0.775	62%	0.617	S	S	*	*			trans	-75.3	4.8	-173.2	-145.7	156.4	0	0	0	111.5	C54	C54-L56 HydrophobicContact CB-CB 4.41Å; C54-L56 PolarHBondContact O-N 2.84Å
57	L	54.9	Low	62.3	Low	57 Å²	57	102.8 Å²	102.8	30%	0.298	61%	0.609	S	S	.	*	S	Bend	trans	-105.2	87.6	158.7	-82.9	71.5	0	0	0	106.6	N55 D59 L62 F65	N55-L57 CarbonylContact O-C 3.59Å; N55-L57 PolarHBondContact O-N 2.88Å; N55-L57 VanDerWaalsContact O-N 3.13Å; L57-D59 PolarHBondContact O-N 3.49Å; L57-L62 HydrophobicContact CB-CG 4.25Å; L57-L62 HydrophobicContact CD2-CD2 4.38Å; L57-L62 HydrophobicContact CD2-CG 4Å; L57-F65 HydrophobicContact CD2-CB 4.11Å; L57-F65 HydrophobicContact CD2-CD1 3.95Å; L57-F65 HydrophobicContact CD2-CG 4.01Å
58	D	56.4	Low	64.3	Low	124 Å²	124	102.4 Å²	102.4	66%	0.663	60%	0.597	S	S	*	*			trans	-43	141.2	158.1	-116.9	-38.5	0	0	0	108.3	S60 A61 L62	D58-S60 PolarHBondContact O-N 2.89Å; D58-A61 HydrophobicContact CB-CB 4.48Å; D58-A61 PolarHBondContact O-N 2.85Å; D58-L62 PolarHBondContact O-N 2.89Å
59	D	60.1	Low	66.3	Low	129 Å²	129	102 Å²	102	69%	0.69	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.7	-21.9	-177.4	-71.8	-50	0	0	0	112.8	L57 P63	L57-D59 PolarHBondContact O-N 3.49Å; D59-P63 WeakPolarHBondContact O-CD 3.41Å
60	S	61.5	Low	68.7	Low	92 Å²	92	101.6 Å²	101.6	64%	0.643	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.7	-27	175.7	-55.8	0	0	0	0	114.4	D58 P63 F64	D58-S60 PolarHBondContact O-N 2.89Å; S60-P63 WeakPolarHBondContact O-CD 3.42Å; S60-P63 WeakPolarHBondContact O-CG 3.42Å; S60-F64 WeakPolarHBondContact O-CD2 3.19Å; S60-F64 WeakPolarHBondContact O-CE2 3.29Å
61	A	68.2	Low	71	Confident	42 Å²	42	101.5 Å²	101.5	35%	0.347	57%	0.572	S	S	.	*	T	Hydrogen-bonded Turn	trans	-89.4	-25.2	-178.5	0	0	0	0	0	113	D58 F64 F65	D58-A61 HydrophobicContact CB-CB 4.48Å; D58-A61 PolarHBondContact O-N 2.85Å; A61-F64 PolarHBondContact O-N 3.41Å; A61-F65 WeakPolarHBondContact O-CB 3.27Å; A61-F65 PolarHBondContact O-N 3.07Å
62	L	72.4	Confident	73.1	Confident	66 Å²	66	97 Å²	97	35%	0.346	55%	0.547	S	S	.	.	H	α-helix	trans	-48.2	-51.6	173.6	-119.9	159.5	0	0	0	114.2	L57 D58 F64 F65 I66	L57-L62 HydrophobicContact CB-CG 4.25Å; L57-L62 HydrophobicContact CD2-CD2 4.38Å; L57-L62 HydrophobicContact CD2-CG 4Å; D58-L62 PolarHBondContact O-N 2.89Å; L62-F64 PolarHBondContact O-N 3.05Å; L62-F65 PolarHBondContact O-N 2.98Å; L62-I66 HydrophobicContact CD2-CD1 4Å; L62-I66 WeakPolarHBondContact O-CG1 3.26Å; L62-I66 PolarHBondContact O-N 3.43Å
63	P	79.3	Confident	75.4	Confident	63 Å²	63	94.6 Å²	94.6	41%	0.409	54%	0.538	S	S	.	.	H	α-helix	trans	-65.2	-38.5	179.6	23.9	-34.1	0	0	0	112.8	D59 S60 I66 L67	D59-P63 WeakPolarHBondContact O-CD 3.41Å; S60-P63 WeakPolarHBondContact O-CD 3.42Å; S60-P63 WeakPolarHBondContact O-CG 3.42Å; P63-I66 PolarHBondContact O-N 3.23Å; P63-L67 VanDerWaalsContact O-CG 3.3Å; P63-L67 WeakPolarHBondContact O-CG 3.45Å; P63-L67 PolarHBondContact O-N 3.02Å
64	F	84.4	Confident	77.4	Confident	143 Å²	143	94.4 Å²	94.4	63%	0.627	53%	0.529	S	S	*	.	H	α-helix	trans	-68.3	-36.9	177.7	-66.8	-78.7	0	0	0	112	S60 A61 L62 L67 T68	S60-F64 WeakPolarHBondContact O-CD2 3.19Å; S60-F64 WeakPolarHBondContact O-CE2 3.29Å; A61-F64 PolarHBondContact O-N 3.41Å; L62-F64 PolarHBondContact O-N 3.05Å; F64-L67 PolarHBondContact O-N 2.99Å; F64-T68 WeakPolarHBondContact O-CB 3.19Å; F64-T68 VanDerWaalsContact O-CG2 3.31Å; F64-T68 WeakPolarHBondContact O-CG2 3.2Å; F64-T68 PolarHBondContact O-N 3.35Å; F64-T68 PolarHBondContact O-OG1 2.8Å
65	F	83.3	Confident	79.5	Confident	121 Å²	121	91.9 Å²	91.9	53%	0.531	52%	0.515	S	S	.	.	H	α-helix	trans	-62.8	-43.2	174.2	-179.2	-100.6	0	0	0	111.6	L57 A61 L62 T68 S69	L57-F65 HydrophobicContact CD2-CB 4.11Å; L57-F65 HydrophobicContact CD2-CD1 3.95Å; L57-F65 HydrophobicContact CD2-CG 4.01Å; A61-F65 WeakPolarHBondContact O-CB 3.27Å; A61-F65 PolarHBondContact O-N 3.07Å; L62-F65 PolarHBondContact O-N 2.98Å; F65-T68 WeakPolarHBondContact CA-OG1 3.26Å; F65-T68 PolarHBondContact O-N 3.41Å; F65-T68 PolarHBondContact O-OG1 3.32Å; F65-S69 WeakPolarHBondContact O-CB 3.49Å; F65-S69 PolarHBondContact O-N 2.9Å
66	I	87.7	Confident	81.3	Confident	92 Å²	92	89.6 Å²	89.6	47%	0.472	51%	0.509	S	S	.	.	H	α-helix	trans	-63.3	-47.3	176.3	-65.5	165.8	0	0	0	110.6	L62 P63 T68 S69 V70	L62-I66 HydrophobicContact CD2-CD1 4Å; L62-I66 WeakPolarHBondContact O-CG1 3.26Å; L62-I66 PolarHBondContact O-N 3.43Å; P63-I66 PolarHBondContact O-N 3.23Å; I66-T68 PolarHBondContact O-N 2.79Å; I66-S69 PolarHBondContact O-N 3Å; I66-V70 HydrophobicContact CG2-CG2 4.37Å; I66-V70 WeakPolarHBondContact O-CB 3.31Å; I66-V70 VanDerWaalsContact O-CG2 3.31Å; I66-V70 WeakPolarHBondContact O-CG2 3.41Å; I66-V70 PolarHBondContact O-N 2.85Å
67	L	90.9	Very high	83.3	Confident	106 Å²	106	85.4 Å²	85.4	56%	0.555	49%	0.492	S	S	*	.	H	α-helix	trans	-60.6	-45.8	179.3	-71.8	173.7	0	0	0	112	P63 F64 V70 L71	P63-L67 VanDerWaalsContact O-CG 3.3Å; P63-L67 WeakPolarHBondContact O-CG 3.45Å; P63-L67 PolarHBondContact O-N 3.02Å; F64-L67 PolarHBondContact O-N 2.99Å; L67-V70 PolarHBondContact O-N 3.46Å; L67-L71 WeakPolarHBondContact O-CB 3.41Å; L67-L71 VanDerWaalsContact O-CG 3.25Å; L67-L71 WeakPolarHBondContact O-CG 3.37Å; L67-L71 PolarHBondContact O-N 3.3Å
68	T	91.3	Very high	85.1	Confident	86 Å²	86	86.2 Å²	86.2	53%	0.528	50%	0.499	S	S	.	.	H	α-helix	trans	-67.1	-37.6	179	50.6	0	0	0	0	112.1	F64 F65 I66 G72	F64-T68 WeakPolarHBondContact O-CB 3.19Å; F64-T68 VanDerWaalsContact O-CG2 3.31Å; F64-T68 WeakPolarHBondContact O-CG2 3.2Å; F64-T68 PolarHBondContact O-N 3.35Å; F64-T68 PolarHBondContact O-OG1 2.8Å; F65-T68 WeakPolarHBondContact CA-OG1 3.26Å; F65-T68 PolarHBondContact O-N 3.41Å; F65-T68 PolarHBondContact O-OG1 3.32Å; I66-T68 PolarHBondContact O-N 2.79Å; T68-G72 PolarHBondContact O-N 2.91Å
69	S	92.8	Very high	86.9	Confident	56 Å²	56	84.9 Å²	84.9	39%	0.392	50%	0.496	S	S	.	.	H	α-helix	trans	-62.1	-49.7	173.4	-177.6	0	0	0	0	111.9	F65 I66 L71 G72 I73	F65-S69 WeakPolarHBondContact O-CB 3.49Å; F65-S69 PolarHBondContact O-N 2.9Å; I66-S69 PolarHBondContact O-N 3Å; S69-L71 PolarHBondContact O-N 2.97Å; S69-G72 PolarHBondContact O-N 3.46Å; S69-I73 WeakPolarHBondContact O-CG1 3.3Å; S69-I73 PolarHBondContact O-N 2.97Å
70	V	96.1	Very high	88.4	Confident	74 Å²	74	83.4 Å²	83.4	45%	0.448	49%	0.487	S	S	.	.	H	α-helix	trans	-61.6	-45.6	178.2	170.9	0	0	0	0	111.2	I66 L67 G72 I73 L74	I66-V70 HydrophobicContact CG2-CG2 4.37Å; I66-V70 WeakPolarHBondContact O-CB 3.31Å; I66-V70 VanDerWaalsContact O-CG2 3.31Å; I66-V70 WeakPolarHBondContact O-CG2 3.41Å; I66-V70 PolarHBondContact O-N 2.85Å; L67-V70 PolarHBondContact O-N 3.46Å; V70-G72 VanDerWaalsContact C-N 3.31Å; V70-G72 PolarHBondContact O-N 2.92Å; V70-I73 PolarHBondContact O-N 2.91Å; V70-L74 HydrophobicContact CG1-CD1 3.92Å; V70-L74 PolarHBondContact O-N 3.48Å
71	L	95.6	Very high	89.7	Confident	114 Å²	114	84.2 Å²	84.2	60%	0.597	48%	0.479	S	S	*	.	H	α-helix	trans	-62.1	-39.4	175.9	-75	168.8	0	0	0	111.8	L67 S69 L74 A75	L67-L71 WeakPolarHBondContact O-CB 3.41Å; L67-L71 VanDerWaalsContact O-CG 3.25Å; L67-L71 WeakPolarHBondContact O-CG 3.37Å; L67-L71 PolarHBondContact O-N 3.3Å; S69-L71 PolarHBondContact O-N 2.97Å; L71-L74 PolarHBondContact O-N 3.45Å; L71-A75 VanDerWaalsContact O-CB 3.26Å; L71-A75 WeakPolarHBondContact O-CB 3.48Å; L71-A75 PolarHBondContact O-N 3.18Å
72	G	95.6	Very high	90.6	Very high	32 Å²	32	87.7 Å²	87.7	33%	0.33	49%	0.49	S	S	.	.	H	α-helix	trans	-62.1	-42.5	176.1	0	0	0	0	0	112.6	T68 S69 V70 S76	T68-G72 PolarHBondContact O-N 2.91Å; S69-G72 PolarHBondContact O-N 3.46Å; V70-G72 VanDerWaalsContact C-N 3.31Å; V70-G72 PolarHBondContact O-N 2.92Å; G72-S76 VanDerWaalsContact O-CB 3.25Å; G72-S76 WeakPolarHBondContact O-CB 3.32Å; G72-S76 PolarHBondContact O-N 3.33Å; G72-S76 PolarHBondContact O-OG 3.31Å
73	I	96.6	Very high	91.4	Very high	112 Å²	112	90.1 Å²	90.1	57%	0.574	50%	0.503	S	S	*	.	H	α-helix	trans	-67.3	-44.3	176.8	-64.8	165.5	0	0	0	110.8	S69 V70 S76 S77	S69-I73 WeakPolarHBondContact O-CG1 3.3Å; S69-I73 PolarHBondContact O-N 2.97Å; V70-I73 PolarHBondContact O-N 2.91Å; I73-S76 PolarHBondContact O-N 2.93Å; I73-S77 VanDerWaalsContact O-CB 3.26Å; I73-S77 WeakPolarHBondContact O-CB 3.25Å; I73-S77 PolarHBondContact O-N 3.23Å; I73-S77 PolarHBondContact O-OG 2.98Å
74	L	96.5	Very high	91.5	Very high	98 Å²	98	91 Å²	91	51%	0.513	50%	0.5	S	S	.	.	H	α-helix	trans	-62	-45.3	176.2	-96.3	148.8	0	0	0	112	V70 L71 S77 T78	V70-L74 HydrophobicContact CG1-CD1 3.92Å; V70-L74 PolarHBondContact O-N 3.48Å; L71-L74 PolarHBondContact O-N 3.45Å; L74-S77 WeakPolarHBondContact CA-OG 3.31Å; L74-S77 PolarHBondContact O-OG 3.44Å; L74-T78 WeakPolarHBondContact O-CB 3.5Å; L74-T78 WeakPolarHBondContact O-CG2 3.33Å; L74-T78 PolarHBondContact O-N 2.8Å; L74-T78 PolarHBondContact O-OG1 3.3Å
75	A	96.1	Very high	91.1	Very high	53 Å²	53	88.9 Å²	88.9	44%	0.438	49%	0.488	S	S	.	.	H	α-helix	trans	-63.3	-46.9	176.4	0	0	0	0	0	111.2	L71 S77 T78 V79	L71-A75 VanDerWaalsContact O-CB 3.26Å; L71-A75 WeakPolarHBondContact O-CB 3.48Å; L71-A75 PolarHBondContact O-N 3.18Å; A75-S77 PolarHBondContact O-N 3.36Å; A75-T78 PolarHBondContact O-N 3.46Å; A75-T78 PolarHBondContact O-OG1 2.8Å; A75-V79 VanDerWaalsContact O-CG2 3.29Å; A75-V79 WeakPolarHBondContact O-CG2 3.2Å; A75-V79 PolarHBondContact O-N 2.75Å
76	S	94.9	Very high	90.6	Very high	74 Å²	74	86.8 Å²	86.8	52%	0.517	49%	0.487	S	S	.	.	H	α-helix	trans	-64.1	-45	-179.2	-58.7	0	0	0	0	111.6	G72 I73 V79 L80	G72-S76 VanDerWaalsContact O-CB 3.25Å; G72-S76 WeakPolarHBondContact O-CB 3.32Å; G72-S76 PolarHBondContact O-N 3.33Å; G72-S76 PolarHBondContact O-OG 3.31Å; I73-S76 PolarHBondContact O-N 2.93Å; S76-V79 PolarHBondContact O-N 3.45Å; S76-L80 WeakPolarHBondContact O-CB 3.22Å; S76-L80 PolarHBondContact O-N 3.04Å
77	S	94	Very high	89.6	Confident	60 Å²	60	87.6 Å²	87.6	42%	0.42	49%	0.491	S	S	.	.	H	α-helix	trans	-66.2	-38.7	179.1	58.9	0	0	0	0	112.8	I73 L74 A75 L80 F81	I73-S77 VanDerWaalsContact O-CB 3.26Å; I73-S77 WeakPolarHBondContact O-CB 3.25Å; I73-S77 PolarHBondContact O-N 3.23Å; I73-S77 PolarHBondContact O-OG 2.98Å; L74-S77 WeakPolarHBondContact CA-OG 3.31Å; L74-S77 PolarHBondContact O-OG 3.44Å; A75-S77 PolarHBondContact O-N 3.36Å; S77-L80 PolarHBondContact O-N 2.84Å; S77-F81 WeakPolarHBondContact O-CB 3.35Å; S77-F81 PolarHBondContact O-N 2.78Å
78	T	94.2	Very high	88	Confident	73 Å²	73	88 Å²	88	45%	0.448	49%	0.489	S	S	.	.	H	α-helix	trans	-67.3	-41.3	176.5	53	0	0	0	0	112	L74 A75 F81 M82	L74-T78 WeakPolarHBondContact O-CB 3.5Å; L74-T78 WeakPolarHBondContact O-CG2 3.33Å; L74-T78 PolarHBondContact O-N 2.8Å; L74-T78 PolarHBondContact O-OG1 3.3Å; A75-T78 PolarHBondContact O-N 3.46Å; A75-T78 PolarHBondContact O-OG1 2.8Å; T78-F81 PolarHBondContact O-N 2.9Å; T78-M82 WeakPolarHBondContact O-CG 3.16Å; T78-M82 PolarHBondContact O-N 2.84Å
79	V	93.6	Very high	86.5	Confident	97 Å²	97	92.4 Å²	92.4	59%	0.588	50%	0.496	S	S	*	.	H	α-helix	trans	-62.9	-48	173.6	172.4	0	0	0	0	110.5	A75 S76 F81 M82 L83	A75-V79 VanDerWaalsContact O-CG2 3.29Å; A75-V79 WeakPolarHBondContact O-CG2 3.2Å; A75-V79 PolarHBondContact O-N 2.75Å; S76-V79 PolarHBondContact O-N 3.45Å; V79-F81 VanDerWaalsContact C-N 3.3Å; V79-F81 PolarHBondContact O-N 3.13Å; V79-M82 PolarHBondContact O-N 3.48Å; V79-L83 WeakPolarHBondContact O-CB 3.3Å; V79-L83 PolarHBondContact O-N 2.92Å
80	L	92.5	Very high	84.7	Confident	97 Å²	97	97.6 Å²	97.6	51%	0.508	51%	0.507	S	S	.	.	H	α-helix	trans	-56.5	-46.8	175	-120	78.9	0	0	0	110.9	S76 S77 M82 L83 F84	S76-L80 WeakPolarHBondContact O-CB 3.22Å; S76-L80 PolarHBondContact O-N 3.04Å; S77-L80 PolarHBondContact O-N 2.84Å; L80-M82 VanDerWaalsContact C-N 3.34Å; L80-M82 PolarHBondContact O-N 3.1Å; L80-L83 WeakPolarHBondContact O-CB 3.45Å; L80-L83 PolarHBondContact O-N 3.17Å; L80-L83 VanDerWaalsContact O-N 3.15Å; L80-F84 HydrophobicContact CB-CD2 4.22Å; L80-F84 HydrophobicContact CB-CE2 4.42Å; L80-F84 HydrophobicContact CD2-CD2 4.19Å; L80-F84 HydrophobicContact CD2-CE2 3.7Å; L80-F84 HydrophobicContact CG-CD2 3.94Å; L80-F84 HydrophobicContact CG-CE2 3.65Å; L80-F84 WeakPolarHBondContact O-CB 3.46Å; L80-F84 WeakPolarHBondContact O-CD2 3.42Å; L80-F84 PolarHBondContact O-N 3.41Å
81	F	87.3	Confident	82.9	Confident	110 Å²	110	100.9 Å²	100.9	48%	0.482	52%	0.517	S	S	.	.	H	α-helix	trans	-62.9	-40	-179.6	179.5	-116.2	0	0	0	111.9	S77 T78 V79 L83 F84 R85	S77-F81 WeakPolarHBondContact O-CB 3.35Å; S77-F81 PolarHBondContact O-N 2.78Å; T78-F81 PolarHBondContact O-N 2.9Å; V79-F81 VanDerWaalsContact C-N 3.3Å; V79-F81 PolarHBondContact O-N 3.13Å; F81-L83 VanDerWaalsContact C-N 3.34Å; F81-F84 PolarHBondContact O-N 3.45Å; F81-R85 HydrophobicContact CD1-CG 4.41Å; F81-R85 HydrophobicContact CE1-CG 4.25Å; F81-R85 VanDerWaalsContact CE1-NH2 3.31Å; F81-R85 HydrophobicContact CE2-CG 4.37Å; F81-R85 HydrophobicContact CZ-CG 4.2Å; F81-R85 VanDerWaalsContact O-CB 3.31Å; F81-R85 WeakPolarHBondContact O-CB 3.13Å; F81-R85 WeakPolarHBondContact O-CG 2.81Å; F81-R85 PolarHBondContact O-N 3.22Å
82	M	87.9	Confident	81.1	Confident	115 Å²	115	102.4 Å²	102.4	57%	0.567	53%	0.525	S	S	*	.	H	α-helix	trans	-65.2	-37.6	173.9	-71.8	-63.9	-172.6	0	0	112.5	T78 V79 L80 P86	T78-M82 WeakPolarHBondContact O-CG 3.16Å; T78-M82 PolarHBondContact O-N 2.84Å; V79-M82 PolarHBondContact O-N 3.48Å; L80-M82 VanDerWaalsContact C-N 3.34Å; L80-M82 PolarHBondContact O-N 3.1Å; M82-P86 WeakPolarHBondContact O-CD 3.04Å
83	L	88.3	Confident	79.2	Confident	117 Å²	117	105.1 Å²	105.1	61%	0.613	54%	0.538	S	S	*	.	H	α-helix	trans	-69.4	-38.7	176.4	-166.9	112.1	0	0	0	112.3	V79 L80 F81 P86	V79-L83 WeakPolarHBondContact O-CB 3.3Å; V79-L83 PolarHBondContact O-N 2.92Å; L80-L83 WeakPolarHBondContact O-CB 3.45Å; L80-L83 PolarHBondContact O-N 3.17Å; L80-L83 VanDerWaalsContact O-N 3.15Å; F81-L83 VanDerWaalsContact C-N 3.34Å; L83-P86 VanDerWaalsContact O-CD 3.26Å; L83-P86 WeakPolarHBondContact O-CD 2.82Å; L83-P86 VanDerWaalsContact O-CG 3.32Å; L83-P86 WeakPolarHBondContact O-CG 3.43Å
84	F	83	Confident	77.1	Confident	81 Å²	81	105.4 Å²	105.4	36%	0.355	55%	0.547	S	S	.	.	H	α-helix	trans	-84.8	-17.3	179.6	-75.4	-65.8	0	0	0	113.9	L80 F81 L87 F88	L80-F84 HydrophobicContact CB-CD2 4.22Å; L80-F84 HydrophobicContact CB-CE2 4.42Å; L80-F84 HydrophobicContact CD2-CD2 4.19Å; L80-F84 HydrophobicContact CD2-CE2 3.7Å; L80-F84 HydrophobicContact CG-CD2 3.94Å; L80-F84 HydrophobicContact CG-CE2 3.65Å; L80-F84 WeakPolarHBondContact O-CB 3.46Å; L80-F84 WeakPolarHBondContact O-CD2 3.42Å; L80-F84 PolarHBondContact O-N 3.41Å; F81-F84 PolarHBondContact O-N 3.45Å; F84-L87 HydrophobicContact CD1-CD1 3.6Å; F84-L87 HydrophobicContact CE1-CD1 4.02Å; F84-L87 WeakPolarHBondContact O-CB 3.32Å; F84-L87 PolarHBondContact O-N 3.06Å; F84-F88 HydrophobicContact CB-CD2 4.07Å; F84-F88 HydrophobicContact CB-CE2 3.89Å; F84-F88 WeakPolarHBondContact O-CD2 3.28Å; F84-F88 PolarHBondContact O-N 3.26Å; F84-F88 VanDerWaalsContact O-N 3.13Å
85	R	74.3	Confident	75.2	Confident	98 Å²	98	103.8 Å²	103.8	37%	0.37	56%	0.555	S	S	.	*	H	α-helix	trans	-48.1	-45.7	175	-99.9	177.7	174.1	-155.2	-3.7	115.1	F81 L87 R89	F81-R85 HydrophobicContact CD1-CG 4.41Å; F81-R85 HydrophobicContact CE1-CG 4.25Å; F81-R85 VanDerWaalsContact CE1-NH2 3.31Å; F81-R85 HydrophobicContact CE2-CG 4.37Å; F81-R85 HydrophobicContact CZ-CG 4.2Å; F81-R85 VanDerWaalsContact O-CB 3.31Å; F81-R85 WeakPolarHBondContact O-CB 3.13Å; F81-R85 WeakPolarHBondContact O-CG 2.81Å; F81-R85 PolarHBondContact O-N 3.22Å; R85-L87 VanDerWaalsContact C-N 3.31Å; R85-L87 PolarHBondContact O-N 3.32Å; R85-R89 WeakPolarHBondContact O-CG 3.25Å; R85-R89 PolarHBondContact O-N 3.5Å
86	P	73.8	Confident	73.3	Confident	78 Å²	78	105.7 Å²	105.7	51%	0.506	56%	0.561	S	S	.	*	H	α-helix	trans	-65.3	-32.8	176.2	24.1	-34.7	0	0	0	113.1	M82 L83 W90	M82-P86 WeakPolarHBondContact O-CD 3.04Å; L83-P86 VanDerWaalsContact O-CD 3.26Å; L83-P86 WeakPolarHBondContact O-CD 2.82Å; L83-P86 VanDerWaalsContact O-CG 3.32Å; L83-P86 WeakPolarHBondContact O-CG 3.43Å; P86-W90 PolarHBondContact O-N 3.1Å
87	L	65.6	Low	71.1	Confident	109 Å²	109	106.3 Å²	106.3	57%	0.571	57%	0.571	S	S	*	*	H	α-helix	trans	-70.3	-42.3	-179.2	-67.6	168.4	0	0	0	111.8	F84 R85 W90 Q91	F84-L87 HydrophobicContact CD1-CD1 3.6Å; F84-L87 HydrophobicContact CE1-CD1 4.02Å; F84-L87 WeakPolarHBondContact O-CB 3.32Å; F84-L87 PolarHBondContact O-N 3.06Å; R85-L87 VanDerWaalsContact C-N 3.31Å; R85-L87 PolarHBondContact O-N 3.32Å; L87-W90 WeakPolarHBondContact O-CB 3.08Å; L87-W90 PolarHBondContact O-N 2.83Å; L87-Q91 PolarHBondContact O-N 3.02Å
88	F	58.3	Low	69.2	Low	114 Å²	114	106.6 Å²	106.6	50%	0.5	58%	0.583	S	S	.	*	H	α-helix	trans	-73	-32.3	177.2	-72.7	-69.5	0	0	0	113.5	F84 W90 Q91 L92	F84-F88 HydrophobicContact CB-CD2 4.07Å; F84-F88 HydrophobicContact CB-CE2 3.89Å; F84-F88 WeakPolarHBondContact O-CD2 3.28Å; F84-F88 PolarHBondContact O-N 3.26Å; F84-F88 VanDerWaalsContact O-N 3.13Å; F88-W90 PolarHBondContact O-N 3.25Å; F88-Q91 PolarHBondContact O-N 3.46Å; F88-Q91 VanDerWaalsContact O-N 3.12Å; F88-L92 WeakPolarHBondContact O-CD1 3.45Å; F88-L92 PolarHBondContact O-N 3.36Å
89	R	59.1	Low	66.9	Low	179 Å²	179	106.7 Å²	106.7	68%	0.675	59%	0.585	S	S	*	*	H	α-helix	trans	-63.1	-33.6	171.5	-75.9	-179.8	-179.3	-170.6	0.1	112.1	R85 Q91 C93	R85-R89 WeakPolarHBondContact O-CG 3.25Å; R85-R89 PolarHBondContact O-N 3.5Å; R89-Q91 VanDerWaalsContact C-N 3.32Å; R89-C93 PolarHBondContact O-N 3.37Å; R89-C93 VanDerWaalsContact O-N 3.1Å
90	W	55.9	Low	64.8	Low	164 Å²	164	105.6 Å²	105.6	62%	0.621	59%	0.594	S	S	*	*	H	α-helix	trans	-67.5	-34.1	173.5	-127.6	74.3	0	0	0	112.2	P86 L87 F88 C93 A97	P86-W90 PolarHBondContact O-N 3.1Å; L87-W90 WeakPolarHBondContact O-CB 3.08Å; L87-W90 PolarHBondContact O-N 2.83Å; F88-W90 PolarHBondContact O-N 3.25Å; W90-C93 CarbonylContact O-C 3.19Å; W90-C93 PolarHBondContact O-N 2.93Å; W90-C93 VanDerWaalsContact O-O 3.1Å; W90-A97 HydrophobicContact CH2-CB 3.48Å; W90-A97 VanDerWaalsContact CH2-CB 3.48Å; W90-A97 HydrophobicContact CZ2-CB 3.58Å
91	Q	58.3	Low	62.9	Low	143 Å²	143	109.9 Å²	109.9	67%	0.668	61%	0.611	S	S	*	*	H	α-helix	trans	-74	-31.5	177.2	-134.7	173.1	11.7	0	0	113.2	L87 F88 R89	L87-Q91 PolarHBondContact O-N 3.02Å; F88-Q91 PolarHBondContact O-N 3.46Å; F88-Q91 VanDerWaalsContact O-N 3.12Å; R89-Q91 VanDerWaalsContact C-N 3.32Å
92	L	56.7	Low	60.7	Low	147 Å²	147	109.5 Å²	109.5	77%	0.77	62%	0.621	S	S	*	*	H	α-helix	trans	-79.9	-18.6	172.1	-82	91.5	0	0	0	113.8	F88 P94	F88-L92 WeakPolarHBondContact O-CD1 3.45Å; F88-L92 PolarHBondContact O-N 3.36Å; L92-P94 VanDerWaalsContact C-CD 3.43Å; L92-P94 WeakPolarHBondContact O-CD 2.97Å
93	C	57.4	Low	58.6	Low	88 Å²	88	108.9 Å²	108.9	60%	0.595	63%	0.626	S	S	*	*			trans	-119.5	75.1	170.8	-72.9	0	0	0	0	110.9	R89 W90 G95	R89-C93 PolarHBondContact O-N 3.37Å; R89-C93 VanDerWaalsContact O-N 3.1Å; W90-C93 CarbonylContact O-C 3.19Å; W90-C93 PolarHBondContact O-N 2.93Å; W90-C93 VanDerWaalsContact O-O 3.1Å; C93-G95 PolarHBondContact O-N 3.3Å
94	P	51.1	Low	56.8	Low	118 Å²	118	111.8 Å²	111.8	77%	0.766	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.1	82.5	169.2	31.9	-30.7	0	0	0	107.9	L92	L92-P94 VanDerWaalsContact C-CD 3.43Å; L92-P94 WeakPolarHBondContact O-CD 2.97Å
95	G	57.1	Low	55	Low	65 Å²	65	115.8 Å²	115.8	67%	0.67	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-174.8	0.4	-176.3	0	0	0	0	0	119.1	C93	C93-G95 PolarHBondContact O-N 3.3Å
96	T	57.1	Low	53.5	Low	92 Å²	92	120 Å²	120	56%	0.564	68%	0.684	S	S	*	*			trans	-149.3	62.1	174.9	-14.5	0	0	0	0	113.2	G98 C99	T96-G98 PolarHBondContact O-N 3.26Å; T96-C99 HydrophobicContact CG2-CB 4.2Å
97	A	46.8	Very low	52.1	Low	88 Å²	88	123.3 Å²	123.3	73%	0.727	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.4	73.2	156	0	0	0	0	0	108.6	W90	W90-A97 HydrophobicContact CH2-CB 3.48Å; W90-A97 VanDerWaalsContact CH2-CB 3.48Å; W90-A97 HydrophobicContact CZ2-CB 3.58Å
98	G	54.3	Low	50.9	Low	65 Å²	65	120.8 Å²	120.8	67%	0.67	71%	0.709	S	S	*	*	T	Hydrogen-bonded Turn	trans	161.9	29.4	-175.8	0	0	0	0	0	117.3	T96	T96-G98 PolarHBondContact O-N 3.26Å
99	C	45.7	Very low	50.5	Low	75 Å²	75	119.8 Å²	119.8	51%	0.507	72%	0.721	S	S	.	*			trans	-131.5	83.8	163.6	-98.8	0	0	0	0	109.2	T96 Q101	T96-C99 HydrophobicContact CG2-CB 4.2Å; C99-Q101 PolarHBondContact O-N 2.91Å
100	G	51.4	Low	49.6	Very low	75 Å²	75	123.2 Å²	123.2	77%	0.773	73%	0.734	S	S	*	*	S	Bend	trans	-56	121.4	147	0	0	0	0	0	106.8
101	Q	51.6	Low	49.2	Very low	186 Å²	186	123 Å²	123	87%	0.869	74%	0.744	S	S	*	*			trans	73.6	74.2	178.2	-46.4	174.5	42.6	0	0	115.5	C99	C99-Q101 PolarHBondContact O-N 2.91Å
102	C	41.7	Very low	48.2	Very low	102 Å²	102	119.6 Å²	119.6	69%	0.689	75%	0.748	S	S	*	*			trans	-99.9	106	146.4	-79.2	0	0	0	0	108.3
103	P	42.9	Very low	47.8	Very low	102 Å²	102	118.6 Å²	118.6	66%	0.662	75%	0.75	S	S	*	*			trans	-65.3	143	171.7	28.5	-30.8	0	0	0	108.6	Q105	P103-Q105 PolarHBondContact O-N 3.13Å
104	L	50.8	Low	47.2	Very low	179 Å²	179	126.2 Å²	126.2	94%	0.937	77%	0.766	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.3	64.3	-179.5	-155.1	153.2	0	0	0	110.8
105	Q	45	Very low	47	Very low	164 Å²	164	125.4 Å²	125.4	77%	0.766	77%	0.77	S	S	*	*	T	Hydrogen-bonded Turn	trans	-137.3	-7.1	-179.8	-76.8	-156.1	62.1	0	0	115.7	P103	P103-Q105 PolarHBondContact O-N 3.13Å
106	H	42.3	Very low	46.4	Very low	186 Å²	186	137.7 Å²	137.7	86%	0.861	80%	0.796	S	S	*	*	S	Bend	trans	-114.7	11.5	-179.4	-94.8	-43.7	0	0	0	117.7	G108	H106-G108 PolarHBondContact O-N 3.04Å
107	C	44	Very low	45.9	Very low	148 Å²	148	140 Å²	140	100%	1	81%	0.807	S	S	*	*			trans	-87.4	52	151	-90.4	0	0	0	0	109.6
108	G	41.8	Very low	45.8	Very low	57 Å²	57	142.7 Å²	142.7	59%	0.588	81%	0.811	S	S	*	*			trans	-82.3	128	169.7	0	0	0	0	0	109.4	H106 R110	H106-G108 PolarHBondContact O-N 3.04Å; G108-R110 PolarHBondContact O-N 2.98Å
109	A	49.6	Very low	45.4	Very low	93 Å²	93	147 Å²	147	77%	0.769	82%	0.819	S	S	*	*			trans	-37.2	127.1	170.7	0	0	0	0	0	113.5
110	R	40.2	Very low	45.4	Very low	251 Å²	251	151.2 Å²	151.2	95%	0.947	84%	0.838	S	S	*	*			trans	-105.7	87.4	153.5	-116.9	-177.2	-158.3	-116.2	3.5	108.3	G108 G112	G108-R110 PolarHBondContact O-N 2.98Å; R110-G112 PolarHBondContact O-N 2.66Å
111	L	48.3	Very low	45	Very low	159 Å²	159	156 Å²	156	83%	0.832	84%	0.842	S	S	*	*	P	Polyproline II helix	trans	-52	116.7	145	-86.2	128.4	0	0	0	107.2
112	G	37	Very low	44.5	Very low	72 Å²	72	154 Å²	154	74%	0.742	84%	0.84	S	S	*	*	P	Polyproline II helix	trans	-96.4	121.3	166.6	0	0	0	0	0	109.9	R110	R110-G112 PolarHBondContact O-N 2.66Å
113	P	46.9	Very low	44.7	Very low	125 Å²	125	157.7 Å²	157.7	81%	0.812	85%	0.85	S	S	*	*	P	Polyproline II helix	trans	-88.6	147.9	165.9	33.2	-28.4	0	0	0	112
114	R	46.3	Very low	44.9	Very low	249 Å²	249	162 Å²	162	94%	0.94	87%	0.865	S	S	*	*			trans	-9.1	137.9	164.9	-92.8	-178.6	160.4	178.6	-4.4	119
115	A	45.3	Very low	44.4	Very low	101 Å²	101	160.6 Å²	160.6	84%	0.835	86%	0.859	S	S	*	*				162.8	121.5	108.5	0	0	0	0	0	112.2
116	R	45.9	Very low	44.3	Very low	322 Å²	322	160.3 Å²	160.3	100%	1.215	87%	0.867	S	S	*	*				-175	0	100.6	-144.2	176.9	-152.6	-132.1	4.2	110.1

Retrieved 116 of 116 residues in 149.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).