A0A059T9W4_HUMAN Loading...

Atypical chemokine receptor 1

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1 and TARC. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.

AlphaFold DB , UniProt , Accession A0A059T9W4, Species HUMAN (Homo sapiens, Human), Gene DARC, Length 118 aa.

						>A0A059T9W4_HUMAN|A0A059T9W4|DARC
MASSGYVLQAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGTAGCGQCPLQHCGARLGPRAR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.7	Very low	42.5	Very low	252 Å²	252	141.5 Å²	141.5	100%	1.241	83%	0.828	S	S	*	*				0	112.7	0	-87.7	152.9	167.4	0	0	107.3
2	A	36.5	Very low	43.1	Very low	104 Å²	104	142.3 Å²	142.3	86%	0.86	82%	0.824	S	S	*	*			trans	-81.8	130.4	-166.3	0	0	0	0	0	111.3
3	S	40.5	Very low	42.6	Very low	131 Å²	131	138.6 Å²	138.6	92%	0.916	81%	0.812	S	S	*	*			trans	-97.6	96.2	161.9	-169.5	0	0	0	0	106.6
4	S	44.6	Very low	43.3	Very low	99 Å²	99	136.9 Å²	136.9	69%	0.692	81%	0.807	S	S	*	*			trans	-100.3	109.5	177.7	-169.4	0	0	0	0	107.8	Y6	S4-Y6 PolarHBondContact O-N 3.27Å
5	G	51.7	Low	42.8	Very low	76 Å²	76	135.2 Å²	135.2	78%	0.784	81%	0.805	S	S	*	*			trans	-57.9	135	170.5	0	0	0	0	0	110.2
6	Y	46.8	Very low	43.5	Very low	205 Å²	205	135 Å²	135	80%	0.804	81%	0.805	S	S	*	*			trans	-119.7	125.2	167.9	55.1	-89.7	0	0	0	109.3	S4	S4-Y6 PolarHBondContact O-N 3.27Å
7	V	40.8	Very low	43.2	Very low	128 Å²	128	137.6 Å²	137.6	78%	0.776	81%	0.808	S	S	*	*			trans	-64.5	126.8	172.9	175.3	0	0	0	0	107.9	Q9	V7-Q9 PolarHBondContact O-N 3.5Å
8	L	49.3	Very low	43.1	Very low	158 Å²	158	138.3 Å²	138.3	83%	0.827	81%	0.807	S	S	*	*			trans	-74.6	97.7	166	-70	177.6	0	0	0	108.1	A10	L8-A10 PolarHBondContact O-N 2.78Å
9	Q	39.4	Very low	43.4	Very low	169 Å²	169	137.2 Å²	137.2	79%	0.79	81%	0.808	S	S	*	*			trans	-62.2	114.6	165.7	-96.6	170.1	-16.9	0	0	109.1	V7 E11	V7-Q9 PolarHBondContact O-N 3.5Å; Q9-E11 PolarHBondContact O-N 2.93Å
10	A	44	Very low	43.9	Very low	88 Å²	88	135 Å²	135	73%	0.727	80%	0.8	S	S	*	*			trans	-79.9	93.3	155.4	0	0	0	0	0	107.3	L8 L12	L8-A10 PolarHBondContact O-N 2.78Å; A10-L12 HydrophobicContact CB-CD1 4.34Å; A10-L12 PolarHBondContact O-N 3.2Å
11	E	38.3	Very low	44.5	Very low	147 Å²	147	137.2 Å²	137.2	69%	0.687	80%	0.802	S	S	*	*			trans	-75.6	92.8	165.7	-107	-78.8	107.5	0	0	107.7	Q9 S13	Q9-E11 PolarHBondContact O-N 2.93Å; E11-S13 PolarHBondContact O-N 3.49Å; E11-S13 PolarHBondContact OE2-OG 3.14Å
12	L	49.6	Very low	45.5	Very low	150 Å²	150	131.4 Å²	131.4	79%	0.785	78%	0.775	S	S	*	*			trans	-80.2	98	157.2	-81.7	95.5	0	0	0	107.1	A10 P14	A10-L12 HydrophobicContact CB-CD1 4.34Å; A10-L12 PolarHBondContact O-N 3.2Å; L12-P14 WeakPolarHBondContact O-CD 3.26Å
13	S	36.2	Very low	46.5	Very low	95 Å²	95	130.2 Å²	130.2	66%	0.664	76%	0.755	S	S	*	*			trans	-77.5	120.6	165.2	-85.5	0	0	0	0	109.5	E11	E11-S13 PolarHBondContact O-N 3.49Å; E11-S13 PolarHBondContact OE2-OG 3.14Å
14	P	53.3	Low	47.3	Very low	114 Å²	114	132.5 Å²	132.5	74%	0.74	75%	0.749	S	S	*	*			trans	-95	98.3	174.7	33.8	-23.1	0	0	0	109	L12 T16	L12-P14 WeakPolarHBondContact O-CD 3.26Å; P14-T16 PolarHBondContact O-N 3Å; P14-T16 VanDerWaalsContact O-N 3.15Å
15	S	35.6	Very low	48	Very low	112 Å²	112	134 Å²	134	78%	0.783	75%	0.745	S	S	*	*			trans	-79.1	99.4	168.2	55.5	0	0	0	0	109	E17	S15-E17 PolarHBondContact O-N 3.23Å
16	T	54.1	Low	48.3	Very low	132 Å²	132	135.9 Å²	135.9	81%	0.81	74%	0.737	S	S	*	*			trans	-75.2	109.1	168	-63.2	0	0	0	0	109	P14	P14-T16 PolarHBondContact O-N 3Å; P14-T16 VanDerWaalsContact O-N 3.15Å
17	E	37.8	Very low	48.9	Very low	180 Å²	180	130.5 Å²	130.5	84%	0.841	73%	0.725	S	S	*	*			trans	-155.7	148.6	148.1	51.7	-156.1	114.3	0	0	112.6	S15	S15-E17 PolarHBondContact O-N 3.23Å
18	N	41.2	Very low	49.8	Very low	149 Å²	149	132.2 Å²	132.2	80%	0.797	72%	0.718	S	S	*	*			trans	-51.8	147.1	-161.5	-169.6	-96.3	0	0	0	116.8	S20	N18-S20 PolarHBondContact O-N 3.43Å
19	S	48.9	Very low	50.1	Low	117 Å²	117	128.9 Å²	128.9	82%	0.818	70%	0.701	S	S	*	*			trans	-45.3	100.9	171	-54.8	0	0	0	0	114.3
20	S	53.2	Low	50.9	Low	94 Å²	94	125.4 Å²	125.4	66%	0.657	70%	0.695	S	S	*	*			trans	-108.3	105.3	144.7	56.7	0	0	0	0	107.3	N18 L22	N18-S20 PolarHBondContact O-N 3.43Å; S20-L22 PolarHBondContact O-N 3.42Å
21	Q	56.1	Low	51.6	Low	181 Å²	181	125.9 Å²	125.9	85%	0.846	69%	0.693	S	S	*	*			trans	-37.5	98.8	170.4	179.9	176.5	-14.2	0	0	110.3	D23	Q21-D23 PolarHBondContact O-N 3.39Å; Q21-D23 VanDerWaalsContact O-N 3.14Å
22	L	58.3	Low	52.3	Low	130 Å²	130	124 Å²	124	68%	0.681	68%	0.68	S	S	*	*			trans	-71.4	108.8	171.5	-65.1	179.3	0	0	0	106.2	S20 F24	S20-L22 PolarHBondContact O-N 3.42Å; L22-F24 PolarHBondContact O-N 3.21Å
23	D	56.1	Low	52.3	Low	80 Å²	80	119.2 Å²	119.2	43%	0.428	67%	0.667	S	S	.	*			trans	-67.3	113.7	173.7	-169.9	83.4	0	0	0	108	Q21 E25 D26	Q21-D23 PolarHBondContact O-N 3.39Å; Q21-D23 VanDerWaalsContact O-N 3.14Å; D23-E25 PolarHBondContact O-N 2.83Å; D23-E25 VanDerWaalsContact OD2-CB 3.3Å; D23-E25 WeakPolarHBondContact OD2-CB 3.48Å; D23-E25 PolarHBondContact OD2-N 3.47Å; D23-E25 VanDerWaalsContact OD2-N 3.14Å; D23-D26 PolarHBondContact O-N 3.15Å; D23-D26 PolarHBondContact OD2-N 3.07Å
24	F	58.5	Low	52.8	Low	179 Å²	179	119.5 Å²	119.5	79%	0.785	67%	0.665	S	S	*	*	H	α-helix	trans	-62.3	-25.7	-173.6	-93.6	-97.3	0	0	0	111.8	L22 W28	L22-F24 PolarHBondContact O-N 3.21Å; F24-W28 WeakPolarHBondContact O-CB 3.23Å; F24-W28 PolarHBondContact O-N 3.22Å; F24-W28 VanDerWaalsContact O-N 3.09Å
25	E	58.1	Low	52.8	Low	130 Å²	130	120.9 Å²	120.9	61%	0.607	67%	0.666	S	S	*	*	H	α-helix	trans	-73.4	-34.2	-179.8	-67.9	-78	110.3	0	0	111.7	D23 N29	D23-E25 PolarHBondContact O-N 2.83Å; D23-E25 VanDerWaalsContact OD2-CB 3.3Å; D23-E25 WeakPolarHBondContact OD2-CB 3.48Å; D23-E25 PolarHBondContact OD2-N 3.47Å; D23-E25 VanDerWaalsContact OD2-N 3.14Å; E25-N29 WeakPolarHBondContact O-CB 3.21Å; E25-N29 PolarHBondContact O-N 3.49Å
26	D	57.9	Low	53.2	Low	116 Å²	116	120.8 Å²	120.8	62%	0.62	66%	0.657	S	S	*	*	H	α-helix	trans	-71.2	-37.5	178.2	-81.4	-42.6	0	0	0	112.8	D23 S30	D23-D26 PolarHBondContact O-N 3.15Å; D23-D26 PolarHBondContact OD2-N 3.07Å; D26-S30 VanDerWaalsContact O-CB 3.31Å; D26-S30 WeakPolarHBondContact O-CB 3.43Å; D26-S30 PolarHBondContact O-N 3.04Å
27	V	61.2	Low	53.2	Low	92 Å²	92	120 Å²	120	56%	0.558	66%	0.657	S	S	*	*	H	α-helix	trans	-69.3	-42.6	175.6	173	0	0	0	0	110.7	S31	V27-S31 PolarHBondContact O-N 3.34Å
28	W	59.1	Low	53.5	Low	163 Å²	163	118.4 Å²	118.4	62%	0.617	65%	0.647	S	S	*	*	H	α-helix	trans	-58.9	-57	174.4	-169	-115.2	0	0	0	107	F24 S30 S31 Y32	F24-W28 WeakPolarHBondContact O-CB 3.23Å; F24-W28 PolarHBondContact O-N 3.22Å; F24-W28 VanDerWaalsContact O-N 3.09Å; W28-S30 VanDerWaalsContact C-N 3.29Å; W28-S30 PolarHBondContact O-N 3.25Å; W28-S31 WeakPolarHBondContact O-CA 3.44Å; W28-S31 WeakPolarHBondContact O-CB 3.41Å; W28-S31 PolarHBondContact O-N 3.01Å; W28-Y32 VanDerWaalsContact C-CZ 3.44Å; W28-Y32 HydrophobicContact CB-CE1 3.74Å; W28-Y32 AromaticContact CD1-CE1 3.08Å; W28-Y32 AromaticContact CD1-CZ 3.38Å; W28-Y32 AromaticContact CD2-CD1 3.96Å; W28-Y32 HydrophobicContact CD2-CD1 3.96Å; W28-Y32 AromaticContact CD2-CE1 3.43Å; W28-Y32 HydrophobicContact CD2-CE1 3.43Å; W28-Y32 VanDerWaalsContact CD2-CE1 3.43Å; W28-Y32 AromaticContact CE2-CD1 3.83Å; W28-Y32 AromaticContact CE2-CE1 3.38Å; W28-Y32 HydrophobicContact CE3-CE1 4.34Å; W28-Y32 HydrophobicContact CG-CD1 4.14Å; W28-Y32 AromaticContact CG-CE1 3.19Å; W28-Y32 HydrophobicContact CG-CE1 3.19Å; W28-Y32 AromaticContact CG-CZ 3.89Å; W28-Y32 HydrophobicContact CZ2-CD1 4.28Å; W28-Y32 HydrophobicContact CZ2-CE1 4.23Å; W28-Y32 AromaticContact NE1-CD1 3.98Å; W28-Y32 AromaticContact NE1-CE1 3.13Å; W28-Y32 AromaticContact NE1-CZ 3.56Å; W28-Y32 WeakPolarHBondContact O-CD1 3.34Å; W28-Y32 WeakPolarHBondContact O-CE1 3.29Å; W28-Y32 PolarHBondContact O-N 3.15Å
29	N	54.3	Low	53.7	Low	89 Å²	89	115.9 Å²	115.9	48%	0.476	64%	0.639	S	S	.	*	H	α-helix	trans	-63.9	-27.9	-174.3	-154.6	41.1	0	0	0	114.6	E25 Y32 G33	E25-N29 WeakPolarHBondContact O-CB 3.21Å; E25-N29 PolarHBondContact O-N 3.49Å; N29-Y32 WeakPolarHBondContact CA-OH 3.49Å; N29-Y32 HydrophobicContact CB-CE2 4.31Å; N29-Y32 WeakPolarHBondContact CB-OH 3.42Å; N29-Y32 PolarHBondContact N-OH 2.84Å; N29-Y32 VanDerWaalsContact N-OH 3.17Å; N29-Y32 WeakPolarHBondContact OD1-CE2 3.1Å; N29-Y32 PolarHBondContact OD1-OH 3.38Å; N29-G33 WeakPolarHBondContact O-CA 3.43Å; N29-G33 PolarHBondContact O-N 2.89Å
30	S	57	Low	53.8	Low	96 Å²	96	118.8 Å²	118.8	67%	0.671	65%	0.646	S	S	*	*	H	α-helix	trans	-71.1	-31.6	170.5	-171.2	0	0	0	0	112.7	D26 W28	D26-S30 VanDerWaalsContact O-CB 3.31Å; D26-S30 WeakPolarHBondContact O-CB 3.43Å; D26-S30 PolarHBondContact O-N 3.04Å; W28-S30 VanDerWaalsContact C-N 3.29Å; W28-S30 PolarHBondContact O-N 3.25Å
31	S	59.2	Low	53.7	Low	98 Å²	98	116.7 Å²	116.7	69%	0.685	64%	0.638	S	S	*	*	H	α-helix	trans	-79.3	-26.5	-176.6	-171.7	0	0	0	0	114.3	V27 W28	V27-S31 PolarHBondContact O-N 3.34Å; W28-S31 WeakPolarHBondContact O-CA 3.44Å; W28-S31 WeakPolarHBondContact O-CB 3.41Å; W28-S31 PolarHBondContact O-N 3.01Å
32	Y	53.8	Low	53.4	Low	106 Å²	106	114.3 Å²	114.3	42%	0.416	63%	0.631	S	S	.	*	H	α-helix	trans	-122.5	-2.8	177.6	57.4	-99.1	0	0	0	114.1	W28 N29 V34	W28-Y32 VanDerWaalsContact C-CZ 3.44Å; W28-Y32 HydrophobicContact CB-CE1 3.74Å; W28-Y32 AromaticContact CD1-CE1 3.08Å; W28-Y32 AromaticContact CD1-CZ 3.38Å; W28-Y32 AromaticContact CD2-CD1 3.96Å; W28-Y32 HydrophobicContact CD2-CD1 3.96Å; W28-Y32 AromaticContact CD2-CE1 3.43Å; W28-Y32 HydrophobicContact CD2-CE1 3.43Å; W28-Y32 VanDerWaalsContact CD2-CE1 3.43Å; W28-Y32 AromaticContact CE2-CD1 3.83Å; W28-Y32 AromaticContact CE2-CE1 3.38Å; W28-Y32 HydrophobicContact CE3-CE1 4.34Å; W28-Y32 HydrophobicContact CG-CD1 4.14Å; W28-Y32 AromaticContact CG-CE1 3.19Å; W28-Y32 HydrophobicContact CG-CE1 3.19Å; W28-Y32 AromaticContact CG-CZ 3.89Å; W28-Y32 HydrophobicContact CZ2-CD1 4.28Å; W28-Y32 HydrophobicContact CZ2-CE1 4.23Å; W28-Y32 AromaticContact NE1-CD1 3.98Å; W28-Y32 AromaticContact NE1-CE1 3.13Å; W28-Y32 AromaticContact NE1-CZ 3.56Å; W28-Y32 WeakPolarHBondContact O-CD1 3.34Å; W28-Y32 WeakPolarHBondContact O-CE1 3.29Å; W28-Y32 PolarHBondContact O-N 3.15Å; N29-Y32 WeakPolarHBondContact CA-OH 3.49Å; N29-Y32 HydrophobicContact CB-CE2 4.31Å; N29-Y32 WeakPolarHBondContact CB-OH 3.42Å; N29-Y32 PolarHBondContact N-OH 2.84Å; N29-Y32 VanDerWaalsContact N-OH 3.17Å; N29-Y32 WeakPolarHBondContact OD1-CE2 3.1Å; N29-Y32 PolarHBondContact OD1-OH 3.38Å; Y32-V34 PolarHBondContact O-N 3.44Å
33	G	48.3	Very low	53	Low	50 Å²	50	114.1 Å²	114.1	52%	0.515	62%	0.623	S	S	.	*			trans	-79.2	17.4	179	0	0	0	0	0	114.5	N29 N35	N29-G33 WeakPolarHBondContact O-CA 3.43Å; N29-G33 PolarHBondContact O-N 2.89Å; G33-N35 PolarHBondContact O-N 3.07Å
34	V	46.3	Very low	52.7	Low	101 Å²	101	112.5 Å²	112.5	61%	0.612	63%	0.625	S	S	*	*			trans	-91.4	98.1	171	-170	0	0	0	0	107.7	Y32 D36	Y32-V34 PolarHBondContact O-N 3.44Å; V34-D36 WeakPolarHBondContact CG1-OD2 3.28Å; V34-D36 PolarHBondContact O-N 2.93Å
35	N	54.3	Low	52.4	Low	144 Å²	144	105.7 Å²	105.7	77%	0.77	60%	0.602	S	S	*	*			trans	-60.5	82.8	168.9	176	49	0	0	0	110.2	G33	G33-N35 PolarHBondContact O-N 3.07Å
36	D	43.6	Very low	52	Low	110 Å²	110	106.3 Å²	106.3	59%	0.588	61%	0.61	S	S	*	*			trans	-118.3	102.2	165.3	-72.2	-46.2	0	0	0	107.5	V34 F38	V34-D36 WeakPolarHBondContact CG1-OD2 3.28Å; V34-D36 PolarHBondContact O-N 2.93Å; D36-F38 VanDerWaalsContact C-N 3.33Å; D36-F38 PolarHBondContact O-N 3.2Å
37	S	54	Low	51.6	Low	114 Å²	114	106.8 Å²	106.8	80%	0.797	61%	0.611	S	S	*	*			trans	-51.2	99.4	166.4	-67.3	0	0	0	0	108.6
38	F	44.3	Very low	50.9	Low	147 Å²	147	109 Å²	109	65%	0.645	62%	0.615	S	S	*	*			trans	-81.6	132.1	179.2	-111.7	-94.9	0	0	0	109.7	D36 Y43	D36-F38 VanDerWaalsContact C-N 3.33Å; D36-F38 PolarHBondContact O-N 3.2Å; F38-Y43 WeakPolarHBondContact CB-OH 3.35Å; F38-Y43 HydrophobicContact CD1-CE1 4.18Å; F38-Y43 HydrophobicContact CD1-CE2 4.41Å; F38-Y43 AromaticContact CD1-CZ 3.58Å; F38-Y43 WeakPolarHBondContact CD1-OH 3.23Å; F38-Y43 HydrophobicContact CE1-CE1 4.34Å; F38-Y43 AromaticContact CG-CZ 4Å; F38-Y43 WeakPolarHBondContact CG-OH 3.3Å
39	P	46.1	Very low	50.6	Low	97 Å²	97	105.7 Å²	105.7	63%	0.63	62%	0.623	S	S	*	*			trans	-64.9	141.3	176	26.5	-32.4	0	0	0	110.4	G41	P39-G41 VanDerWaalsContact C-N 3.26Å; P39-G41 PolarHBondContact O-N 2.88Å
40	D	50.8	Low	50.6	Low	178 Å²	178	104.9 Å²	104.9	95%	0.952	63%	0.629	S	S	*	*	S	Bend	trans	-54.9	90.5	166.4	-167.5	68.5	0	0	0	108.5
41	G	50.5	Low	50.3	Low	49 Å²	49	104.1 Å²	104.1	51%	0.505	63%	0.628	S	S	.	*			trans	-161.2	72.6	-159.5	0	0	0	0	0	110.8	P39 Y43	P39-G41 VanDerWaalsContact C-N 3.26Å; P39-G41 PolarHBondContact O-N 2.88Å; G41-Y43 PolarHBondContact O-N 3.42Å
42	D	50.4	Low	49.9	Very low	131 Å²	131	104.3 Å²	104.3	70%	0.701	63%	0.627	S	S	*	*			trans	55.2	50.2	153.4	-133	-21.3	0	0	0	116.5	G44 A45	D42-G44 PolarHBondContact O-N 3.36Å; D42-A45 PolarHBondContact O-N 2.78Å
43	Y	48.7	Very low	50.2	Low	126 Å²	126	105 Å²	105	49%	0.494	65%	0.646	S	S	.	*	T	Hydrogen-bonded Turn	trans	-63.3	0.8	162	-67	-81.4	0	0	0	113.6	F38 G41 L47	F38-Y43 WeakPolarHBondContact CB-OH 3.35Å; F38-Y43 HydrophobicContact CD1-CE1 4.18Å; F38-Y43 HydrophobicContact CD1-CE2 4.41Å; F38-Y43 AromaticContact CD1-CZ 3.58Å; F38-Y43 WeakPolarHBondContact CD1-OH 3.23Å; F38-Y43 HydrophobicContact CE1-CE1 4.34Å; F38-Y43 AromaticContact CG-CZ 4Å; F38-Y43 WeakPolarHBondContact CG-OH 3.3Å; G41-Y43 PolarHBondContact O-N 3.42Å; Y43-L47 WeakPolarHBondContact O-CD1 3.21Å; Y43-L47 VanDerWaalsContact O-CG 3.32Å; Y43-L47 WeakPolarHBondContact O-CG 3.14Å
44	G	50.9	Low	50.4	Low	47 Å²	47	111 Å²	111	49%	0.485	66%	0.661	S	S	.	*	T	Hydrogen-bonded Turn	trans	-72.7	-40.7	173.4	0	0	0	0	0	112.2	D42 E48	D42-G44 PolarHBondContact O-N 3.36Å; G44-E48 VanDerWaalsContact O-CG 3.27Å; G44-E48 WeakPolarHBondContact O-CG 3.37Å
45	A	51.6	Low	50.9	Low	36 Å²	36	109.4 Å²	109.4	30%	0.298	65%	0.654	S	S	.	*	T	Hydrogen-bonded Turn	trans	-78.3	-33.5	-170.3	0	0	0	0	0	114.2	D42 E48	D42-A45 PolarHBondContact O-N 2.78Å; A45-E48 VanDerWaalsContact CA-CD 3.43Å; A45-E48 WeakPolarHBondContact CA-OE2 3.16Å; A45-E48 WeakPolarHBondContact O-CG 3.4Å
46	N	49	Very low	51	Low	143 Å²	143	108.7 Å²	108.7	77%	0.765	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.7	-7.1	-177.1	-73.1	-9.9	0	0	0	114.2
47	L	49.5	Very low	51.5	Low	126 Å²	126	108.1 Å²	108.1	66%	0.66	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.5	-9.7	172.5	-66.8	175.3	0	0	0	112.7	Y43 A49	Y43-L47 WeakPolarHBondContact O-CD1 3.21Å; Y43-L47 VanDerWaalsContact O-CG 3.32Å; Y43-L47 WeakPolarHBondContact O-CG 3.14Å; L47-A49 VanDerWaalsContact C-N 3.33Å
48	E	47.7	Very low	51.4	Low	137 Å²	137	109.8 Å²	109.8	64%	0.64	65%	0.654	S	S	*	*	S	Bend	trans	-75.3	-25.9	177.3	-42.9	164.8	136.2	0	0	111.9	G44 A45	G44-E48 VanDerWaalsContact O-CG 3.27Å; G44-E48 WeakPolarHBondContact O-CG 3.37Å; A45-E48 VanDerWaalsContact CA-CD 3.43Å; A45-E48 WeakPolarHBondContact CA-OE2 3.16Å; A45-E48 WeakPolarHBondContact O-CG 3.4Å
49	A	52.3	Low	51.9	Low	94 Å²	94	106.8 Å²	106.8	78%	0.777	65%	0.645	S	S	*	*	S	Bend	trans	-92.9	-11.6	-174.9	0	0	0	0	0	114	L47	L47-A49 VanDerWaalsContact C-N 3.33Å
50	A	54.1	Low	52.2	Low	73 Å²	73	107 Å²	107	60%	0.603	64%	0.641	S	S	*	*	S	Bend	trans	-97.8	88.1	166.8	0	0	0	0	0	108.3
51	A	51.3	Low	52.6	Low	80 Å²	80	104.8 Å²	104.8	66%	0.661	63%	0.629	S	S	*	*			trans	24.6	97.2	170	0	0	0	0	0	115.3	C53	A51-C53 PolarHBondContact O-N 2.89Å
52	P	49.8	Very low	53.1	Low	102 Å²	102	106.5 Å²	106.5	66%	0.662	63%	0.633	S	S	*	*			trans	-45.3	109.7	179.6	-31.1	33.9	0	0	0	113.8	H54	P52-H54 HydrophobicContact CB-CB 4.45Å; P52-H54 PolarHBondContact O-N 3.43Å
53	C	60	Low	53.8	Low	119 Å²	119	102.2 Å²	102.2	80%	0.804	62%	0.616	S	S	*	*			trans	-76.9	62	163.3	-70.2	0	0	0	0	109.5	A51 S55	A51-C53 PolarHBondContact O-N 2.89Å; C53-S55 PolarHBondContact O-N 2.81Å
54	H	53.4	Low	54.8	Low	178 Å²	178	99.5 Å²	99.5	82%	0.824	61%	0.61	S	S	*	*			trans	-84.4	14.5	177.7	-161.8	-63.9	0	0	0	112.6	P52	P52-H54 HydrophobicContact CB-CB 4.45Å; P52-H54 PolarHBondContact O-N 3.43Å
55	S	56.8	Low	56.1	Low	67 Å²	67	100.2 Å²	100.2	47%	0.469	61%	0.605	S	S	.	*			trans	-163.3	83.3	162.8	-157.1	0	0	0	0	111.8	C53 N57	C53-S55 PolarHBondContact O-N 2.81Å; S55-N57 PolarHBondContact O-N 3.18Å; S55-N57 VanDerWaalsContact O-N 3.08Å; S55-N57 PolarHBondContact OG-N 2.86Å; S55-N57 PolarHBondContact OG-O 3.23Å
56	C	56.4	Low	57.6	Low	129 Å²	129	105.3 Å²	105.3	87%	0.872	62%	0.621	S	S	*	*	S	Bend	trans	-76.9	45.4	151.7	-73.9	0	0	0	0	110.3
57	N	53.4	Low	59.1	Low	97 Å²	97	104.6 Å²	104.6	52%	0.519	61%	0.611	S	S	.	*			trans	-144.4	54.8	171.2	-159.6	12.6	0	0	0	109.8	S55	S55-N57 PolarHBondContact O-N 3.18Å; S55-N57 VanDerWaalsContact O-N 3.08Å; S55-N57 PolarHBondContact OG-N 2.86Å; S55-N57 PolarHBondContact OG-O 3.23Å
58	L	52.6	Low	60.9	Low	149 Å²	149	103.2 Å²	103.2	78%	0.78	60%	0.604	S	S	*	*			trans	-105.7	3.7	176.4	-140.4	141.5	0	0	0	112.6
59	L	54	Low	62.9	Low	85 Å²	85	101.7 Å²	101.7	45%	0.445	60%	0.6	S	S	.	*	S	Bend	trans	-100.7	74.2	147.6	-93	78.4	0	0	0	106.5	D61 L64	L59-D61 PolarHBondContact O-N 3.31Å; L59-L64 HydrophobicContact CB-CD2 4.49Å; L59-L64 HydrophobicContact CB-CG 4.22Å; L59-L64 HydrophobicContact CD2-CD2 3.51Å; L59-L64 HydrophobicContact CD2-CG 3.92Å
60	D	54.2	Low	64.8	Low	102 Å²	102	101.4 Å²	101.4	55%	0.545	59%	0.588	S	S	.	*			trans	-39.7	137.9	158.8	-117.7	-66.1	0	0	0	107.8	S62 A63	D60-S62 CarbonylContact O-C 3.59Å; D60-S62 PolarHBondContact O-N 3.18Å; D60-A63 PolarHBondContact O-N 2.8Å
61	D	58.3	Low	66.6	Low	131 Å²	131	100.5 Å²	100.5	70%	0.701	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.8	-20.3	-176	-76.9	-65.2	0	0	0	113.7	L59 P65	L59-D61 PolarHBondContact O-N 3.31Å; D61-P65 VanDerWaalsContact O-CD 3.28Å; D61-P65 WeakPolarHBondContact O-CD 3.23Å
62	S	60.4	Low	68.7	Low	85 Å²	85	100.2 Å²	100.2	59%	0.594	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.4	-27.7	175.6	-52.1	0	0	0	0	115.1	D60 P65 F66	D60-S62 CarbonylContact O-C 3.59Å; D60-S62 PolarHBondContact O-N 3.18Å; S62-P65 WeakPolarHBondContact O-CD 3.45Å; S62-P65 VanDerWaalsContact O-CG 3.32Å; S62-P65 WeakPolarHBondContact O-CG 3.26Å; S62-F66 WeakPolarHBondContact O-CD2 3.22Å; S62-F66 WeakPolarHBondContact O-CE2 3.32Å
63	A	66.1	Low	70.9	Confident	40 Å²	40	100.6 Å²	100.6	33%	0.331	56%	0.563	S	S	.	*	H	α-helix	trans	-90.2	-25.7	-177	0	0	0	0	0	113.3	D60 F66 F67	D60-A63 PolarHBondContact O-N 2.8Å; A63-F66 PolarHBondContact O-N 2.89Å; A63-F67 WeakPolarHBondContact O-CB 3.17Å; A63-F67 PolarHBondContact O-N 2.84Å
64	L	68.9	Low	72.6	Confident	70 Å²	70	96.5 Å²	96.5	37%	0.366	54%	0.541	S	S	.	.	H	α-helix	trans	-48.9	-51.7	171.6	-82.4	163.7	0	0	0	113.7	L59 F66 F67 I68	L59-L64 HydrophobicContact CB-CD2 4.49Å; L59-L64 HydrophobicContact CB-CG 4.22Å; L59-L64 HydrophobicContact CD2-CD2 3.51Å; L59-L64 HydrophobicContact CD2-CG 3.92Å; L64-F66 PolarHBondContact O-N 3.18Å; L64-F67 PolarHBondContact O-N 3.47Å; L64-I68 VanDerWaalsContact O-CG1 3.28Å; L64-I68 WeakPolarHBondContact O-CG1 3.35Å; L64-I68 PolarHBondContact O-N 2.84Å
65	P	78.2	Confident	74.7	Confident	61 Å²	61	93.3 Å²	93.3	40%	0.396	53%	0.529	S	S	.	.	H	α-helix	trans	-64.7	-38.3	-178.8	23.7	-34.2	0	0	0	112.5	D61 S62 I68 L69	D61-P65 VanDerWaalsContact O-CD 3.28Å; D61-P65 WeakPolarHBondContact O-CD 3.23Å; S62-P65 WeakPolarHBondContact O-CD 3.45Å; S62-P65 VanDerWaalsContact O-CG 3.32Å; S62-P65 WeakPolarHBondContact O-CG 3.26Å; P65-I68 PolarHBondContact O-N 3.45Å; P65-L69 WeakPolarHBondContact O-CB 3.18Å; P65-L69 VanDerWaalsContact O-CG 3.24Å; P65-L69 WeakPolarHBondContact O-CG 3.26Å; P65-L69 PolarHBondContact O-N 3.46Å
66	F	82.9	Confident	76.6	Confident	143 Å²	143	94.6 Å²	94.6	63%	0.627	53%	0.53	S	S	*	.	H	α-helix	trans	-68.6	-36.7	176.9	-65.1	-76.1	0	0	0	112.1	S62 A63 L64 L69 T70	S62-F66 WeakPolarHBondContact O-CD2 3.22Å; S62-F66 WeakPolarHBondContact O-CE2 3.32Å; A63-F66 PolarHBondContact O-N 2.89Å; L64-F66 PolarHBondContact O-N 3.18Å; F66-L69 PolarHBondContact O-N 2.94Å; F66-T70 WeakPolarHBondContact O-CB 3.39Å; F66-T70 VanDerWaalsContact O-CG2 3.32Å; F66-T70 WeakPolarHBondContact O-CG2 3.32Å; F66-T70 PolarHBondContact O-N 3.42Å; F66-T70 PolarHBondContact O-OG1 3.05Å
67	F	81.7	Confident	78.5	Confident	128 Å²	128	91 Å²	91	56%	0.561	51%	0.509	S	S	*	.	H	α-helix	trans	-63.9	-42.6	173.9	-178.2	-100.7	0	0	0	111.7	A63 L64 T70 S71	A63-F67 WeakPolarHBondContact O-CB 3.17Å; A63-F67 PolarHBondContact O-N 2.84Å; L64-F67 PolarHBondContact O-N 3.47Å; F67-T70 WeakPolarHBondContact CA-OG1 3.41Å; F67-T70 PolarHBondContact O-N 2.78Å; F67-T70 PolarHBondContact O-OG1 2.84Å; F67-S71 WeakPolarHBondContact O-CB 3.45Å; F67-S71 PolarHBondContact O-N 3.15Å
68	I	86.9	Confident	80.5	Confident	98 Å²	98	90.1 Å²	90.1	50%	0.503	51%	0.511	S	S	.	.	H	α-helix	trans	-63.6	-47.1	175.8	-66.2	164.5	0	0	0	110.4	L64 P65 T70 S71 V72	L64-I68 VanDerWaalsContact O-CG1 3.28Å; L64-I68 WeakPolarHBondContact O-CG1 3.35Å; L64-I68 PolarHBondContact O-N 2.84Å; P65-I68 PolarHBondContact O-N 3.45Å; I68-T70 PolarHBondContact O-N 2.95Å; I68-S71 PolarHBondContact O-N 3.4Å; I68-V72 HydrophobicContact CG2-CG2 4.32Å; I68-V72 WeakPolarHBondContact O-CB 3.27Å; I68-V72 VanDerWaalsContact O-CG2 3.27Å; I68-V72 WeakPolarHBondContact O-CG2 3.47Å; I68-V72 PolarHBondContact O-N 3.33Å
69	L	90	Very high	82.5	Confident	105 Å²	105	85.7 Å²	85.7	55%	0.55	49%	0.493	S	S	.	.	H	α-helix	trans	-60.4	-46.3	179	-73.2	173.1	0	0	0	112	P65 F66 V72 L73	P65-L69 WeakPolarHBondContact O-CB 3.18Å; P65-L69 VanDerWaalsContact O-CG 3.24Å; P65-L69 WeakPolarHBondContact O-CG 3.26Å; P65-L69 PolarHBondContact O-N 3.46Å; F66-L69 PolarHBondContact O-N 2.94Å; L69-V72 PolarHBondContact O-N 2.95Å; L69-L73 WeakPolarHBondContact O-CB 3.39Å; L69-L73 VanDerWaalsContact O-CG 3.22Å; L69-L73 WeakPolarHBondContact O-CG 3.12Å; L69-L73 PolarHBondContact O-N 3.33Å
70	T	91	Very high	84.4	Confident	87 Å²	87	85.2 Å²	85.2	53%	0.534	49%	0.493	S	S	.	.	H	α-helix	trans	-67.1	-37.9	178.7	49.6	0	0	0	0	112.1	F66 F67 I68 G74	F66-T70 WeakPolarHBondContact O-CB 3.39Å; F66-T70 VanDerWaalsContact O-CG2 3.32Å; F66-T70 WeakPolarHBondContact O-CG2 3.32Å; F66-T70 PolarHBondContact O-N 3.42Å; F66-T70 PolarHBondContact O-OG1 3.05Å; F67-T70 WeakPolarHBondContact CA-OG1 3.41Å; F67-T70 PolarHBondContact O-N 2.78Å; F67-T70 PolarHBondContact O-OG1 2.84Å; I68-T70 PolarHBondContact O-N 2.95Å; T70-G74 PolarHBondContact O-N 2.94Å
71	S	92.6	Very high	86.3	Confident	55 Å²	55	85.2 Å²	85.2	39%	0.385	50%	0.496	S	S	.	.	H	α-helix	trans	-62.6	-49	173.7	-176.8	0	0	0	0	111.9	F67 I68 L73 G74 I75	F67-S71 WeakPolarHBondContact O-CB 3.45Å; F67-S71 PolarHBondContact O-N 3.15Å; I68-S71 PolarHBondContact O-N 3.4Å; S71-L73 PolarHBondContact O-N 2.89Å; S71-G74 PolarHBondContact O-N 3.28Å; S71-I75 WeakPolarHBondContact O-CG1 3.46Å; S71-I75 PolarHBondContact O-N 2.91Å
72	V	95.9	Very high	87.9	Confident	73 Å²	73	83.4 Å²	83.4	44%	0.442	49%	0.487	S	S	.	.	H	α-helix	trans	-61.7	-44.8	177.5	171.4	0	0	0	0	111.2	I68 L69 G74 I75 L76	I68-V72 HydrophobicContact CG2-CG2 4.32Å; I68-V72 WeakPolarHBondContact O-CB 3.27Å; I68-V72 VanDerWaalsContact O-CG2 3.27Å; I68-V72 WeakPolarHBondContact O-CG2 3.47Å; I68-V72 PolarHBondContact O-N 3.33Å; L69-V72 PolarHBondContact O-N 2.95Å; V72-G74 VanDerWaalsContact C-N 3.32Å; V72-G74 PolarHBondContact O-N 3.01Å; V72-I75 PolarHBondContact O-N 3.47Å; V72-L76 HydrophobicContact CG1-CD1 3.96Å; V72-L76 WeakPolarHBondContact O-CB 3.41Å; V72-L76 PolarHBondContact O-N 2.94Å
73	L	95.7	Very high	89.2	Confident	111 Å²	111	85 Å²	85	58%	0.581	48%	0.483	S	S	*	.	H	α-helix	trans	-62.8	-39	175.7	-74.1	170	0	0	0	111.8	L69 S71 L76 A77	L69-L73 WeakPolarHBondContact O-CB 3.39Å; L69-L73 VanDerWaalsContact O-CG 3.22Å; L69-L73 WeakPolarHBondContact O-CG 3.12Å; L69-L73 PolarHBondContact O-N 3.33Å; S71-L73 PolarHBondContact O-N 2.89Å; L73-L76 PolarHBondContact O-N 2.91Å; L73-A77 VanDerWaalsContact O-CB 3.26Å; L73-A77 WeakPolarHBondContact O-CB 3.24Å; L73-A77 PolarHBondContact O-N 3.46Å
74	G	95.6	Very high	90.3	Very high	33 Å²	33	88.6 Å²	88.6	34%	0.34	49%	0.494	S	S	.	.	H	α-helix	trans	-63.3	-41.9	175.9	0	0	0	0	0	112.8	T70 S71 V72 S78	T70-G74 PolarHBondContact O-N 2.94Å; S71-G74 PolarHBondContact O-N 3.28Å; V72-G74 VanDerWaalsContact C-N 3.32Å; V72-G74 PolarHBondContact O-N 3.01Å; G74-S78 VanDerWaalsContact O-CB 3.26Å; G74-S78 WeakPolarHBondContact O-CB 3.47Å; G74-S78 PolarHBondContact O-N 2.77Å; G74-S78 PolarHBondContact O-OG 3.5Å
75	I	96.6	Very high	91.2	Very high	111 Å²	111	90.9 Å²	90.9	57%	0.569	51%	0.506	S	S	*	.	H	α-helix	trans	-67.7	-43.3	176.4	-64.6	164.8	0	0	0	110.6	S71 V72 S78 S79	S71-I75 WeakPolarHBondContact O-CG1 3.46Å; S71-I75 PolarHBondContact O-N 2.91Å; V72-I75 PolarHBondContact O-N 3.47Å; I75-S78 PolarHBondContact O-N 2.74Å; I75-S79 VanDerWaalsContact O-CB 3.23Å; I75-S79 WeakPolarHBondContact O-CB 3.28Å; I75-S79 PolarHBondContact O-N 3.42Å; I75-S79 PolarHBondContact O-OG 3.43Å
76	L	96.7	Very high	91.4	Very high	94 Å²	94	91.8 Å²	91.8	49%	0.492	50%	0.504	S	S	.	.	H	α-helix	trans	-62.7	-45.8	175.8	-85.2	161.9	0	0	0	111.9	V72 L73 S79 T80	V72-L76 HydrophobicContact CG1-CD1 3.96Å; V72-L76 WeakPolarHBondContact O-CB 3.41Å; V72-L76 PolarHBondContact O-N 2.94Å; L73-L76 PolarHBondContact O-N 2.91Å; L76-S79 WeakPolarHBondContact CA-OG 3.32Å; L76-S79 PolarHBondContact O-OG 3.38Å; L76-S79 VanDerWaalsContact O-OG 3.05Å; L76-T80 WeakPolarHBondContact O-CB 3.4Å; L76-T80 WeakPolarHBondContact O-CG2 3.28Å; L76-T80 PolarHBondContact O-N 2.96Å; L76-T80 PolarHBondContact O-OG1 3Å
77	A	96.1	Very high	90.9	Very high	52 Å²	52	89.3 Å²	89.3	43%	0.43	49%	0.491	S	S	.	.	H	α-helix	trans	-62.4	-47.3	176.8	0	0	0	0	0	111.3	L73 T80 V81	L73-A77 VanDerWaalsContact O-CB 3.26Å; L73-A77 WeakPolarHBondContact O-CB 3.24Å; L73-A77 PolarHBondContact O-N 3.46Å; A77-T80 PolarHBondContact O-N 3.45Å; A77-T80 PolarHBondContact O-OG1 2.88Å; A77-V81 VanDerWaalsContact O-CG2 3.3Å; A77-V81 WeakPolarHBondContact O-CG2 3.22Å; A77-V81 PolarHBondContact O-N 3.46Å
78	S	95.3	Very high	90.5	Very high	80 Å²	80	87.1 Å²	87.1	56%	0.559	49%	0.489	S	S	*	.	H	α-helix	trans	-63.7	-47.3	179.7	-59.9	0	0	0	0	111.5	G74 I75 T80 V81 L82	G74-S78 VanDerWaalsContact O-CB 3.26Å; G74-S78 WeakPolarHBondContact O-CB 3.47Å; G74-S78 PolarHBondContact O-N 2.77Å; G74-S78 PolarHBondContact O-OG 3.5Å; I75-S78 PolarHBondContact O-N 2.74Å; S78-T80 PolarHBondContact O-N 3.27Å; S78-V81 PolarHBondContact O-N 2.98Å; S78-L82 WeakPolarHBondContact O-CB 3.27Å; S78-L82 PolarHBondContact O-N 2.91Å
79	S	94.5	Very high	89.4	Confident	56 Å²	56	87.4 Å²	87.4	39%	0.392	49%	0.491	S	S	.	.	H	α-helix	trans	-65	-36.9	179.7	59.7	0	0	0	0	113	I75 L76 F83	I75-S79 VanDerWaalsContact O-CB 3.23Å; I75-S79 WeakPolarHBondContact O-CB 3.28Å; I75-S79 PolarHBondContact O-N 3.42Å; I75-S79 PolarHBondContact O-OG 3.43Å; L76-S79 WeakPolarHBondContact CA-OG 3.32Å; L76-S79 PolarHBondContact O-OG 3.38Å; L76-S79 VanDerWaalsContact O-OG 3.05Å; S79-F83 WeakPolarHBondContact O-CB 3.18Å; S79-F83 PolarHBondContact O-N 3.41Å
80	T	94.7	Very high	87.9	Confident	74 Å²	74	87.9 Å²	87.9	45%	0.454	49%	0.489	S	S	.	.	H	α-helix	trans	-68.9	-43.2	176.9	52.6	0	0	0	0	112.3	L76 A77 S78 F83 M84	L76-T80 WeakPolarHBondContact O-CB 3.4Å; L76-T80 WeakPolarHBondContact O-CG2 3.28Å; L76-T80 PolarHBondContact O-N 2.96Å; L76-T80 PolarHBondContact O-OG1 3Å; A77-T80 PolarHBondContact O-N 3.45Å; A77-T80 PolarHBondContact O-OG1 2.88Å; S78-T80 PolarHBondContact O-N 3.27Å; T80-F83 PolarHBondContact O-N 2.74Å; T80-M84 WeakPolarHBondContact O-CG 3.32Å; T80-M84 PolarHBondContact O-N 2.89Å
81	V	94.3	Very high	86.4	Confident	102 Å²	102	91.3 Å²	91.3	62%	0.618	49%	0.492	S	S	*	.	H	α-helix	trans	-60.7	-48.1	173.5	170.9	0	0	0	0	110.1	A77 S78 F83 M84 L85	A77-V81 VanDerWaalsContact O-CG2 3.3Å; A77-V81 WeakPolarHBondContact O-CG2 3.22Å; A77-V81 PolarHBondContact O-N 3.46Å; S78-V81 PolarHBondContact O-N 2.98Å; V81-F83 VanDerWaalsContact C-N 3.33Å; V81-F83 PolarHBondContact O-N 3.41Å; V81-M84 PolarHBondContact O-N 3.14Å; V81-L85 PolarHBondContact O-N 3.09Å
82	L	92.7	Very high	84.7	Confident	94 Å²	94	96.4 Å²	96.4	49%	0.492	50%	0.503	S	S	.	.	H	α-helix	trans	-61	-42.9	178.6	-156.6	75.6	0	0	0	110.9	S78 M84 L85 F86	S78-L82 WeakPolarHBondContact O-CB 3.27Å; S78-L82 PolarHBondContact O-N 2.91Å; L82-M84 PolarHBondContact O-N 3.08Å; L82-L85 WeakPolarHBondContact O-CB 3.31Å; L82-L85 PolarHBondContact O-N 3.38Å; L82-F86 HydrophobicContact CD1-CD2 4.39Å; L82-F86 HydrophobicContact CD1-CE2 3.81Å; L82-F86 HydrophobicContact CD2-CD2 4.32Å; L82-F86 HydrophobicContact CD2-CE2 3.89Å; L82-F86 HydrophobicContact CG-CD2 3.7Å; L82-F86 HydrophobicContact CG-CE2 3.47Å; L82-F86 VanDerWaalsContact CG-CE2 3.47Å; L82-F86 WeakPolarHBondContact O-CB 3.36Å; L82-F86 WeakPolarHBondContact O-CD2 3.12Å; L82-F86 PolarHBondContact O-N 3.45Å
83	F	87.2	Confident	82.9	Confident	118 Å²	118	99.8 Å²	99.8	52%	0.518	51%	0.514	S	S	.	.	H	α-helix	trans	-64.2	-39.4	175.5	179.2	-114.9	0	0	0	112.7	S79 T80 V81 L85 F86 R87	S79-F83 WeakPolarHBondContact O-CB 3.18Å; S79-F83 PolarHBondContact O-N 3.41Å; T80-F83 PolarHBondContact O-N 2.74Å; V81-F83 VanDerWaalsContact C-N 3.33Å; V81-F83 PolarHBondContact O-N 3.41Å; F83-L85 VanDerWaalsContact C-N 3.32Å; F83-F86 PolarHBondContact O-N 3.22Å; F83-R87 HydrophobicContact CD1-CG 4.38Å; F83-R87 HydrophobicContact CE1-CG 4.21Å; F83-R87 VanDerWaalsContact CE1-NH2 3.35Å; F83-R87 HydrophobicContact CE2-CG 4.4Å; F83-R87 HydrophobicContact CZ-CG 4.2Å; F83-R87 WeakPolarHBondContact O-CB 3.13Å; F83-R87 VanDerWaalsContact O-CG 3.23Å; F83-R87 WeakPolarHBondContact O-CG 3.46Å; F83-R87 PolarHBondContact O-N 3.19Å
84	M	88.5	Confident	81.1	Confident	116 Å²	116	101.3 Å²	101.3	57%	0.571	52%	0.522	S	S	*	.	H	α-helix	trans	-65.3	-36.9	173.7	-72.6	-65.5	-170	0	0	112.1	T80 V81 L82 P88	T80-M84 WeakPolarHBondContact O-CG 3.32Å; T80-M84 PolarHBondContact O-N 2.89Å; V81-M84 PolarHBondContact O-N 3.14Å; L82-M84 PolarHBondContact O-N 3.08Å; M84-P88 VanDerWaalsContact O-CD 3.29Å; M84-P88 WeakPolarHBondContact O-CD 2.76Å
85	L	87.9	Confident	79.1	Confident	118 Å²	118	103.7 Å²	103.7	62%	0.618	53%	0.532	S	S	*	.	H	α-helix	trans	-68.2	-39.5	174.8	-164.8	86.4	0	0	0	112	V81 L82 F83 P88	V81-L85 PolarHBondContact O-N 3.09Å; L82-L85 WeakPolarHBondContact O-CB 3.31Å; L82-L85 PolarHBondContact O-N 3.38Å; F83-L85 VanDerWaalsContact C-N 3.32Å; L85-P88 VanDerWaalsContact O-CD 3.23Å; L85-P88 WeakPolarHBondContact O-CD 3.44Å; L85-P88 VanDerWaalsContact O-CG 3.26Å; L85-P88 WeakPolarHBondContact O-CG 3.21Å
86	F	81.6	Confident	76.9	Confident	80 Å²	80	104.4 Å²	104.4	35%	0.351	54%	0.544	S	S	.	.	H	α-helix	trans	-81.4	-19.8	179.1	-78.9	-64	0	0	0	114	L82 F83 L89 F90	L82-F86 HydrophobicContact CD1-CD2 4.39Å; L82-F86 HydrophobicContact CD1-CE2 3.81Å; L82-F86 HydrophobicContact CD2-CD2 4.32Å; L82-F86 HydrophobicContact CD2-CE2 3.89Å; L82-F86 HydrophobicContact CG-CD2 3.7Å; L82-F86 HydrophobicContact CG-CE2 3.47Å; L82-F86 VanDerWaalsContact CG-CE2 3.47Å; L82-F86 WeakPolarHBondContact O-CB 3.36Å; L82-F86 WeakPolarHBondContact O-CD2 3.12Å; L82-F86 PolarHBondContact O-N 3.45Å; F83-F86 PolarHBondContact O-N 3.22Å; F86-L89 HydrophobicContact CD1-CD1 3.63Å; F86-L89 HydrophobicContact CE1-CD1 3.99Å; F86-L89 WeakPolarHBondContact O-CB 2.9Å; F86-L89 PolarHBondContact O-N 3.21Å; F86-F90 HydrophobicContact CB-CD2 3.99Å; F86-F90 HydrophobicContact CB-CE2 3.97Å; F86-F90 HydrophobicContact CD1-CE2 4.22Å; F86-F90 HydrophobicContact CG-CE2 4.29Å; F86-F90 WeakPolarHBondContact O-CD2 3.16Å; F86-F90 PolarHBondContact O-N 3.3Å
87	R	74.1	Confident	75.1	Confident	91 Å²	91	103.1 Å²	103.1	34%	0.343	55%	0.554	S	S	.	*	H	α-helix	trans	-50.3	-46.4	176.2	-97.4	177	167.1	-168.6	-3.2	114.7	F83 L89 R91	F83-R87 HydrophobicContact CD1-CG 4.38Å; F83-R87 HydrophobicContact CE1-CG 4.21Å; F83-R87 VanDerWaalsContact CE1-NH2 3.35Å; F83-R87 HydrophobicContact CE2-CG 4.4Å; F83-R87 HydrophobicContact CZ-CG 4.2Å; F83-R87 WeakPolarHBondContact O-CB 3.13Å; F83-R87 VanDerWaalsContact O-CG 3.23Å; F83-R87 WeakPolarHBondContact O-CG 3.46Å; F83-R87 PolarHBondContact O-N 3.19Å; R87-L89 VanDerWaalsContact C-N 3.33Å; R87-R91 WeakPolarHBondContact O-CB 3.3Å; R87-R91 WeakPolarHBondContact O-CD 3.12Å; R87-R91 WeakPolarHBondContact O-CG 2.92Å; R87-R91 PolarHBondContact O-N 2.84Å
88	P	72.5	Confident	73.3	Confident	81 Å²	81	104.7 Å²	104.7	53%	0.526	56%	0.558	S	S	.	*	H	α-helix	trans	-66	-33.9	174.9	24.2	-34.4	0	0	0	112.9	M84 L85 W92	M84-P88 VanDerWaalsContact O-CD 3.29Å; M84-P88 WeakPolarHBondContact O-CD 2.76Å; L85-P88 VanDerWaalsContact O-CD 3.23Å; L85-P88 WeakPolarHBondContact O-CD 3.44Å; L85-P88 VanDerWaalsContact O-CG 3.26Å; L85-P88 WeakPolarHBondContact O-CG 3.21Å; P88-W92 PolarHBondContact O-N 3.25Å
89	L	64.8	Low	71	Confident	105 Å²	105	105.1 Å²	105.1	55%	0.55	57%	0.567	S	S	.	*	H	α-helix	trans	-68.6	-44.3	-178.9	-67.9	169.1	0	0	0	112.1	F86 R87 W92 Q93	F86-L89 HydrophobicContact CD1-CD1 3.63Å; F86-L89 HydrophobicContact CE1-CD1 3.99Å; F86-L89 WeakPolarHBondContact O-CB 2.9Å; F86-L89 PolarHBondContact O-N 3.21Å; R87-L89 VanDerWaalsContact C-N 3.33Å; L89-W92 WeakPolarHBondContact O-CB 2.84Å; L89-W92 PolarHBondContact O-N 3Å; L89-Q93 PolarHBondContact O-N 2.9Å
90	F	57.5	Low	69.2	Low	114 Å²	114	105.4 Å²	105.4	50%	0.5	58%	0.578	S	S	.	*	H	α-helix	trans	-77.2	-30.7	179.2	-74.7	-74.2	0	0	0	113.7	F86 W92 Q93 L94	F86-F90 HydrophobicContact CB-CD2 3.99Å; F86-F90 HydrophobicContact CB-CE2 3.97Å; F86-F90 HydrophobicContact CD1-CE2 4.22Å; F86-F90 HydrophobicContact CG-CE2 4.29Å; F86-F90 WeakPolarHBondContact O-CD2 3.16Å; F86-F90 PolarHBondContact O-N 3.3Å; F90-W92 PolarHBondContact O-N 2.8Å; F90-Q93 PolarHBondContact O-N 3.5Å; F90-Q93 VanDerWaalsContact O-N 3.15Å; F90-L94 WeakPolarHBondContact O-CD1 2.86Å; F90-L94 PolarHBondContact O-N 3.14Å
91	R	59.9	Low	66.9	Low	160 Å²	160	105.5 Å²	105.5	60%	0.604	58%	0.581	S	S	*	*	H	α-helix	trans	-63.3	-33.2	171.4	-75	174.6	-172	-174.4	2.3	111.8	R87 C95	R87-R91 WeakPolarHBondContact O-CB 3.3Å; R87-R91 WeakPolarHBondContact O-CD 3.12Å; R87-R91 WeakPolarHBondContact O-CG 2.92Å; R87-R91 PolarHBondContact O-N 2.84Å; R91-C95 PolarHBondContact O-N 3.19Å; R91-C95 VanDerWaalsContact O-N 3.15Å
92	W	56.6	Low	64.8	Low	161 Å²	161	104 Å²	104	61%	0.61	59%	0.587	S	S	*	*	H	α-helix	trans	-69.3	-35.3	173.8	-130.7	79.7	0	0	0	112.2	P88 L89 F90 C95 A99	P88-W92 PolarHBondContact O-N 3.25Å; L89-W92 WeakPolarHBondContact O-CB 2.84Å; L89-W92 PolarHBondContact O-N 3Å; F90-W92 PolarHBondContact O-N 2.8Å; W92-C95 CarbonylContact O-C 3.34Å; W92-C95 PolarHBondContact O-N 3.17Å; W92-A99 HydrophobicContact CH2-CB 3.48Å; W92-A99 VanDerWaalsContact CH2-CB 3.48Å; W92-A99 HydrophobicContact CZ2-CB 3.7Å
93	Q	58.2	Low	62.9	Low	145 Å²	145	108.5 Å²	108.5	68%	0.678	61%	0.605	S	S	*	*	H	α-helix	trans	-74.2	-30.2	177.9	-142.4	177.3	12.3	0	0	113.3	L89 F90	L89-Q93 PolarHBondContact O-N 2.9Å; F90-Q93 PolarHBondContact O-N 3.5Å; F90-Q93 VanDerWaalsContact O-N 3.15Å
94	L	57	Low	60.8	Low	142 Å²	142	107.8 Å²	107.8	74%	0.743	61%	0.613	S	S	*	*	H	α-helix	trans	-81.5	-15.9	172.4	-84.9	83.9	0	0	0	113.8	F90 P96	F90-L94 WeakPolarHBondContact O-CD1 2.86Å; F90-L94 PolarHBondContact O-N 3.14Å; L94-P96 VanDerWaalsContact C-CD 3.4Å; L94-P96 VanDerWaalsContact O-CD 3.28Å; L94-P96 WeakPolarHBondContact O-CD 3.18Å
95	C	54.2	Low	58.7	Low	83 Å²	83	107.5 Å²	107.5	56%	0.561	62%	0.62	S	S	*	*			trans	-114.5	77.6	171.5	-74.5	0	0	0	0	110.9	R91 W92 G97	R91-C95 PolarHBondContact O-N 3.19Å; R91-C95 VanDerWaalsContact O-N 3.15Å; W92-C95 CarbonylContact O-C 3.34Å; W92-C95 PolarHBondContact O-N 3.17Å; C95-G97 PolarHBondContact O-N 3.4Å
96	P	50.9	Low	56.9	Low	127 Å²	127	110.1 Å²	110.1	83%	0.825	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.1	81	166.7	32	-31.7	0	0	0	108.1	L94	L94-P96 VanDerWaalsContact C-CD 3.4Å; L94-P96 VanDerWaalsContact O-CD 3.28Å; L94-P96 WeakPolarHBondContact O-CD 3.18Å
97	G	58.3	Low	55.2	Low	67 Å²	67	114.4 Å²	114.4	69%	0.691	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-177	0.8	-178	0	0	0	0	0	118.6	C95	C95-G97 PolarHBondContact O-N 3.4Å
98	T	57.8	Low	53.7	Low	85 Å²	85	118.9 Å²	118.9	52%	0.521	68%	0.679	S	S	.	*			trans	-145	53	177.7	-18.6	0	0	0	0	113.3	G100 C101	T98-G100 PolarHBondContact O-N 3.05Å; T98-C101 HydrophobicContact CG2-CB 4.01Å
99	A	47.3	Very low	52.4	Low	89 Å²	89	121.9 Å²	121.9	74%	0.736	70%	0.701	S	S	*	*	S	Bend	trans	-72.9	68.2	155.6	0	0	0	0	0	108.7	W92	W92-A99 HydrophobicContact CH2-CB 3.48Å; W92-A99 VanDerWaalsContact CH2-CB 3.48Å; W92-A99 HydrophobicContact CZ2-CB 3.7Å
100	G	56.9	Low	51.3	Low	62 Å²	62	119.8 Å²	119.8	64%	0.639	70%	0.704	S	S	*	*			trans	162.6	44.9	-173.3	0	0	0	0	0	114.7	T98	T98-G100 PolarHBondContact O-N 3.05Å
101	C	45.9	Very low	50.9	Low	76 Å²	76	119 Å²	119	51%	0.514	72%	0.719	S	S	.	*			trans	-145.8	82.1	158.9	-107.8	0	0	0	0	108.7	T98 Q103	T98-C101 HydrophobicContact CG2-CB 4.01Å; C101-Q103 PolarHBondContact O-N 3.29Å
102	G	52.1	Low	50	Low	71 Å²	71	123.1 Å²	123.1	73%	0.732	74%	0.735	S	S	*	*	S	Bend	trans	-57.9	120.6	145.6	0	0	0	0	0	106.3
103	Q	52.8	Low	49.7	Very low	188 Å²	188	123.7 Å²	123.7	88%	0.879	75%	0.749	S	S	*	*			trans	82.1	74.8	179.8	-44.5	173.3	78.5	0	0	115.5	C101	C101-Q103 PolarHBondContact O-N 3.29Å
104	C	41.8	Very low	48.7	Very low	102 Å²	102	119.8 Å²	119.8	69%	0.689	75%	0.747	S	S	*	*			trans	-120.3	108.8	149.1	-91.2	0	0	0	0	108.2	L106	C104-L106 PolarHBondContact O-N 2.84Å
105	P	43.8	Very low	48.3	Very low	111 Å²	111	119.2 Å²	119.2	72%	0.721	75%	0.752	S	S	*	*			trans	-67	136.9	176.9	28.2	-31.2	0	0	0	109.3	Q107	P105-Q107 PolarHBondContact O-N 2.85Å
106	L	50.4	Low	48	Very low	172 Å²	172	127.4 Å²	127.4	90%	0.901	77%	0.771	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.3	64.3	-178.8	-162.6	151.5	0	0	0	111.3	C104	C104-L106 PolarHBondContact O-N 2.84Å
107	Q	45.7	Very low	47.8	Very low	170 Å²	170	125.9 Å²	125.9	79%	0.794	77%	0.77	S	S	*	*	T	Hydrogen-bonded Turn	trans	-136.4	-7.4	177.6	-69.3	-145.5	62.7	0	0	115.9	P105	P105-Q107 PolarHBondContact O-N 2.85Å
108	H	43.6	Very low	47.3	Very low	185 Å²	185	138 Å²	138	86%	0.856	79%	0.794	S	S	*	*	S	Bend	trans	-118.6	7.5	-175	-94.8	-58.5	0	0	0	118.1	G110	H108-G110 PolarHBondContact O-N 3.39Å; H108-G110 VanDerWaalsContact O-N 3.14Å
109	C	44.5	Very low	46.8	Very low	144 Å²	144	140.6 Å²	140.6	97%	0.973	81%	0.808	S	S	*	*			trans	-87.5	55.6	160.7	-97	0	0	0	0	110.5
110	G	41.8	Very low	46.7	Very low	61 Å²	61	143.3 Å²	143.3	63%	0.629	81%	0.812	S	S	*	*			trans	-78	123.4	167.2	0	0	0	0	0	109.5	H108 R112	H108-G110 PolarHBondContact O-N 3.39Å; H108-G110 VanDerWaalsContact O-N 3.14Å; G110-R112 PolarHBondContact O-N 3.18Å
111	A	49.9	Very low	46.2	Very low	98 Å²	98	147.8 Å²	147.8	81%	0.81	82%	0.821	S	S	*	*			trans	-49.8	117.9	171	0	0	0	0	0	111.1
112	R	40.6	Very low	46.2	Very low	247 Å²	247	152.1 Å²	152.1	93%	0.932	84%	0.84	S	S	*	*			trans	-107.8	79.8	165.7	-127.9	-175.8	-152.6	-110.8	4.3	108.5	G110 G114	G110-R112 PolarHBondContact O-N 3.18Å; R112-G114 PolarHBondContact O-N 3.44Å
113	L	50	Low	45.8	Very low	172 Å²	172	157.1 Å²	157.1	90%	0.901	85%	0.846	S	S	*	*			trans	-65.2	104.6	154.7	-87.7	147.6	0	0	0	106.7
114	G	37	Very low	45.4	Very low	63 Å²	63	155.1 Å²	155.1	65%	0.649	84%	0.844	S	S	*	*			trans	-92.6	135.5	173.4	0	0	0	0	0	111	R112	R112-G114 PolarHBondContact O-N 3.44Å
115	P	48.7	Very low	45.6	Very low	130 Å²	130	158.9 Å²	158.9	84%	0.844	86%	0.855	S	S	*	*			trans	-80.3	127.2	167.7	31.5	-28.7	0	0	0	109	A117	P115-A117 PolarHBondContact O-N 2.81Å
116	R	48.9	Very low	45.8	Very low	255 Å²	255	162.5 Å²	162.5	96%	0.962	87%	0.866	S	S	*	*			trans	-92.5	97.3	171	-145.6	-173.8	-172.4	-164.2	2.3	108.5
117	A	45.5	Very low	45.4	Very low	96 Å²	96	161.8 Å²	161.8	79%	0.793	86%	0.863	S	S	*	*			trans	-91.9	115.5	161.9	0	0	0	0	0	108.7	P115	P115-A117 PolarHBondContact O-N 2.81Å
118	R	48.3	Very low	45.3	Very low	320 Å²	320	161 Å²	161	100%	1.208	87%	0.869	S	S	*	*			trans	-171.1	0	134.5	-137.6	178.3	-152.2	-121.9	2.7	110.4

Retrieved 118 of 118 residues in 47.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).