A0A059TA82_HUMAN Loading...

Atypical chemokine receptor 1

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1 and TARC. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.

AlphaFold DB , UniProt , Accession A0A059TA82, Species HUMAN (Homo sapiens, Human), Gene DARC, Length 95 aa.

						>A0A059TA82_HUMAN|A0A059TA82|DARC
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.9	Very low	42.7	Very low	245 Å²	245	152.3 Å²	152.3	100%	1.207	83%	0.833	S	S	*	*				0	99.5	0	-70	174.2	71.4	0	0	106.8
2	G	45.3	Very low	42.5	Very low	80 Å²	80	149.5 Å²	149.5	83%	0.825	83%	0.828	S	S	*	*			trans	-75.6	134.9	-179.1	0	0	0	0	0	110.6
3	N	42.1	Very low	42	Very low	138 Å²	138	146.1 Å²	146.1	74%	0.738	82%	0.821	S	S	*	*			trans	-108	93.7	164.9	-171	54.9	0	0	0	107.6	L5	N3-L5 PolarHBondContact O-N 3.42Å
4	C	47.2	Very low	41.7	Very low	115 Å²	115	143.9 Å²	143.9	78%	0.777	81%	0.812	S	S	*	*			trans	-77.4	108.7	169.8	-56.4	0	0	0	0	107.2	H6	C4-H6 PolarHBondContact O-N 3.47Å
5	L	49	Very low	41.2	Very low	153 Å²	153	144.6 Å²	144.6	80%	0.801	81%	0.807	S	S	*	*			trans	-62.8	136.6	173.3	-69	176.3	0	0	0	109.7	N3	N3-L5 PolarHBondContact O-N 3.42Å
6	H	35.6	Very low	40.7	Very low	184 Å²	184	144.9 Å²	144.9	85%	0.852	81%	0.806	S	S	*	*			trans	-54.5	142.8	-174.3	-90.3	35.1	0	0	0	113	C4 A8	C4-H6 PolarHBondContact O-N 3.47Å; H6-A8 PolarHBondContact O-N 3.28Å; H6-A8 VanDerWaalsContact O-N 3.15Å
7	R	43.8	Very low	40.8	Very low	238 Å²	238	143.7 Å²	143.7	90%	0.898	81%	0.81	S	S	*	*			trans	-59.4	113.5	158.9	-173.2	171.6	-162.9	105.2	2.3	107.5	E9	R7-E9 PolarHBondContact O-N 3.49Å
8	A	45.6	Very low	40.9	Very low	81 Å²	81	141.1 Å²	141.1	67%	0.669	80%	0.802	S	S	*	*			trans	-60.8	119.8	168.2	0	0	0	0	0	107.9	H6 L10	H6-A8 PolarHBondContact O-N 3.28Å; H6-A8 VanDerWaalsContact O-N 3.15Å; A8-L10 PolarHBondContact O-N 3.42Å
9	E	45.8	Very low	41.2	Very low	177 Å²	177	144 Å²	144	83%	0.827	81%	0.808	S	S	*	*			trans	-60	121.7	172.5	-63.8	-165.2	157.5	0	0	109.1	R7	R7-E9 PolarHBondContact O-N 3.49Å
10	L	41	Very low	41.8	Very low	159 Å²	159	143.5 Å²	143.5	83%	0.832	80%	0.803	S	S	*	*			trans	-115.9	98.5	148.7	-78.1	108.2	0	0	0	106	A8 P12	A8-L10 PolarHBondContact O-N 3.42Å; L10-P12 WeakPolarHBondContact O-CD 3.34Å
11	S	38.4	Very low	42.1	Very low	105 Å²	105	141.6 Å²	141.6	73%	0.734	79%	0.791	S	S	*	*			trans	-66.9	136.4	156	-55.3	0	0	0	0	108.2
12	P	40.7	Very low	42.8	Very low	119 Å²	119	138.2 Å²	138.2	77%	0.773	77%	0.77	S	S	*	*			trans	-104.7	116	149	23	-6.9	0	0	0	108.2	L10 T14	L10-P12 WeakPolarHBondContact O-CD 3.34Å; P12-T14 PolarHBondContact O-N 3.26Å
13	S	35.9	Very low	43	Very low	105 Å²	105	141.5 Å²	141.5	73%	0.734	76%	0.764	S	S	*	*			trans	-52.3	127.9	152.5	52	0	0	0	0	109.7
14	T	37.2	Very low	43.4	Very low	115 Å²	115	140.6 Å²	140.6	71%	0.706	76%	0.759	S	S	*	*			trans	53.7	149.9	147.3	-38	0	0	0	0	119.4	P12	P12-T14 PolarHBondContact O-N 3.26Å
15	E	34.2	Very low	43.8	Very low	155 Å²	155	139.4 Å²	139.4	72%	0.724	75%	0.748	S	S	*	*			trans	97.1	85.1	160.2	-39	-78.7	143.6	0	0	116
16	N	33.4	Very low	43.9	Very low	150 Å²	150	139.3 Å²	139.3	80%	0.802	74%	0.737	S	S	*	*			trans	44.5	122.4	137.7	-58.2	-40.5	0	0	0	122.2
17	S	43.3	Very low	44.3	Very low	124 Å²	124	136.1 Å²	136.1	87%	0.867	73%	0.726	S	S	*	*			trans	36.5	93	147.2	-68.9	0	0	0	0	119.5
18	S	41.6	Very low	44.7	Very low	96 Å²	96	129 Å²	129	67%	0.671	71%	0.713	S	S	*	*				-150.5	117.8	127.7	54.4	0	0	0	0	109.1	L20	S18-L20 PolarHBondContact O-N 2.97Å
19	Q	47.8	Very low	45.1	Very low	197 Å²	197	129.1 Å²	129.1	92%	0.921	71%	0.709	S	S	*	*			trans	-64	99.4	169	178.8	175.7	1.9	0	0	106.6	D21	Q19-D21 PolarHBondContact O-N 3.45Å
20	L	52	Low	45.1	Very low	134 Å²	134	128 Å²	128	70%	0.702	70%	0.699	S	S	*	*			trans	-70	113.8	176.4	-66.5	178.2	0	0	0	108.1	S18 F22	S18-L20 PolarHBondContact O-N 2.97Å; L20-F22 PolarHBondContact O-N 3.4Å
21	D	48.4	Very low	45.1	Very low	104 Å²	104	123.2 Å²	123.2	56%	0.556	69%	0.687	S	S	*	*			trans	-70.2	122.6	174.9	-165.5	8.6	0	0	0	108.9	Q19 E23 D24	Q19-D21 PolarHBondContact O-N 3.45Å; D21-E23 PolarHBondContact O-N 3.47Å; D21-D24 PolarHBondContact O-N 2.88Å
22	F	50.6	Low	45.3	Very low	174 Å²	174	122.7 Å²	122.7	76%	0.763	68%	0.679	S	S	*	*	H	α-helix	trans	-67	-24.7	-169.6	-140	-94.8	0	0	0	111.6	L20 W26	L20-F22 PolarHBondContact O-N 3.4Å; F22-W26 WeakPolarHBondContact O-CB 3.26Å; F22-W26 PolarHBondContact O-N 3.09Å
23	E	49.4	Very low	45.7	Very low	149 Å²	149	124 Å²	124	70%	0.696	68%	0.68	S	S	*	*	H	α-helix	trans	-66.4	-39.4	176.2	-81.7	-107.6	133.1	0	0	112.8	D21 W26 N27	D21-E23 PolarHBondContact O-N 3.47Å; E23-W26 PolarHBondContact O-N 2.85Å; E23-N27 WeakPolarHBondContact O-CB 3.45Å; E23-N27 PolarHBondContact O-N 3.39Å
24	D	50	Low	45.9	Very low	118 Å²	118	124.4 Å²	124.4	63%	0.631	67%	0.674	S	S	*	*	H	α-helix	trans	-70.7	-36.8	-177.8	-94.1	-19.3	0	0	0	112.2	D21 S28	D21-D24 PolarHBondContact O-N 2.88Å; D24-S28 WeakPolarHBondContact O-CB 2.92Å; D24-S28 PolarHBondContact O-N 3.4Å
25	V	55.2	Low	46.5	Very low	90 Å²	90	124.3 Å²	124.3	55%	0.545	68%	0.677	S	S	.	*	H	α-helix	trans	-68.7	-40.3	175.8	175.4	0	0	0	0	110.7	S29	V25-S29 WeakPolarHBondContact O-CB 3.41Å; V25-S29 PolarHBondContact O-N 2.98Å; V25-S29 VanDerWaalsContact O-N 3.09Å
26	W	51.4	Low	46.8	Very low	151 Å²	151	124.1 Å²	124.1	57%	0.572	68%	0.675	S	S	*	*	H	α-helix	trans	-64.5	-47.2	176.1	-174.8	-95.4	0	0	0	111.1	F22 E23 S28 S29 Y30	F22-W26 WeakPolarHBondContact O-CB 3.26Å; F22-W26 PolarHBondContact O-N 3.09Å; E23-W26 PolarHBondContact O-N 2.85Å; W26-S28 VanDerWaalsContact C-N 3.31Å; W26-S28 PolarHBondContact O-N 2.91Å; W26-S29 PolarHBondContact O-N 3.18Å; W26-S29 VanDerWaalsContact O-N 3.1Å; W26-Y30 AromaticContact CD2-CD2 3.87Å; W26-Y30 HydrophobicContact CD2-CD2 3.87Å; W26-Y30 AromaticContact CD2-CE2 3.67Å; W26-Y30 HydrophobicContact CD2-CE2 3.67Å; W26-Y30 AromaticContact CE2-CD2 3.68Å; W26-Y30 AromaticContact CE2-CE2 3.49Å; W26-Y30 VanDerWaalsContact CE2-CE2 3.49Å; W26-Y30 HydrophobicContact CE3-CD2 4.31Å; W26-Y30 AromaticContact CE3-CE2 3.69Å; W26-Y30 HydrophobicContact CE3-CE2 3.69Å; W26-Y30 HydrophobicContact CG-CD2 4.26Å; W26-Y30 HydrophobicContact CG-CE2 4.5Å; W26-Y30 HydrophobicContact CH2-CD2 4.41Å; W26-Y30 AromaticContact CH2-CE2 3.42Å; W26-Y30 HydrophobicContact CH2-CE2 3.42Å; W26-Y30 VanDerWaalsContact CH2-CE2 3.42Å; W26-Y30 AromaticContact CH2-CZ 3.65Å; W26-Y30 WeakPolarHBondContact CH2-OH 3.24Å; W26-Y30 AromaticContact CZ2-CD2 3.98Å; W26-Y30 HydrophobicContact CZ2-CD2 3.98Å; W26-Y30 AromaticContact CZ2-CE2 3.38Å; W26-Y30 HydrophobicContact CZ2-CE2 3.38Å; W26-Y30 AromaticContact CZ2-CZ 3.74Å; W26-Y30 AromaticContact CZ3-CE2 3.58Å; W26-Y30 HydrophobicContact CZ3-CE2 3.58Å; W26-Y30 AromaticContact NE1-CD2 3.93Å; W26-Y30 WeakPolarHBondContact O-CD2 3.34Å; W26-Y30 PolarHBondContact O-N 3.33Å
27	N	45.6	Very low	47.2	Very low	117 Å²	117	121.8 Å²	121.8	63%	0.626	67%	0.667	S	S	*	*	H	α-helix	trans	-66.3	-33.8	-179.2	-155.6	32.5	0	0	0	112.4	E23 G31	E23-N27 WeakPolarHBondContact O-CB 3.45Å; E23-N27 PolarHBondContact O-N 3.39Å; N27-G31 PolarHBondContact O-N 2.83Å
28	S	50.7	Low	47.5	Very low	88 Å²	88	124 Å²	124	62%	0.615	67%	0.669	S	S	*	*	H	α-helix	trans	-70.4	-28.5	173	-173.8	0	0	0	0	113.5	D24 W26	D24-S28 WeakPolarHBondContact O-CB 2.92Å; D24-S28 PolarHBondContact O-N 3.4Å; W26-S28 VanDerWaalsContact C-N 3.31Å; W26-S28 PolarHBondContact O-N 2.91Å
29	S	54.9	Low	47.8	Very low	85 Å²	85	121.6 Å²	121.6	59%	0.594	66%	0.66	S	S	*	*	H	α-helix	trans	-80	-26.3	-179.3	-174.5	0	0	0	0	112.9	V25 W26	V25-S29 WeakPolarHBondContact O-CB 3.41Å; V25-S29 PolarHBondContact O-N 2.98Å; V25-S29 VanDerWaalsContact O-N 3.09Å; W26-S29 PolarHBondContact O-N 3.18Å; W26-S29 VanDerWaalsContact O-N 3.1Å
30	Y	45.2	Very low	47.8	Very low	154 Å²	154	118.1 Å²	118.1	60%	0.604	65%	0.648	S	S	*	*	H	α-helix	trans	-108.9	-8.4	-177.1	-72.7	-86.2	0	0	0	113.6	W26	W26-Y30 AromaticContact CD2-CD2 3.87Å; W26-Y30 HydrophobicContact CD2-CD2 3.87Å; W26-Y30 AromaticContact CD2-CE2 3.67Å; W26-Y30 HydrophobicContact CD2-CE2 3.67Å; W26-Y30 AromaticContact CE2-CD2 3.68Å; W26-Y30 AromaticContact CE2-CE2 3.49Å; W26-Y30 VanDerWaalsContact CE2-CE2 3.49Å; W26-Y30 HydrophobicContact CE3-CD2 4.31Å; W26-Y30 AromaticContact CE3-CE2 3.69Å; W26-Y30 HydrophobicContact CE3-CE2 3.69Å; W26-Y30 HydrophobicContact CG-CD2 4.26Å; W26-Y30 HydrophobicContact CG-CE2 4.5Å; W26-Y30 HydrophobicContact CH2-CD2 4.41Å; W26-Y30 AromaticContact CH2-CE2 3.42Å; W26-Y30 HydrophobicContact CH2-CE2 3.42Å; W26-Y30 VanDerWaalsContact CH2-CE2 3.42Å; W26-Y30 AromaticContact CH2-CZ 3.65Å; W26-Y30 WeakPolarHBondContact CH2-OH 3.24Å; W26-Y30 AromaticContact CZ2-CD2 3.98Å; W26-Y30 HydrophobicContact CZ2-CD2 3.98Å; W26-Y30 AromaticContact CZ2-CE2 3.38Å; W26-Y30 HydrophobicContact CZ2-CE2 3.38Å; W26-Y30 AromaticContact CZ2-CZ 3.74Å; W26-Y30 AromaticContact CZ3-CE2 3.58Å; W26-Y30 HydrophobicContact CZ3-CE2 3.58Å; W26-Y30 AromaticContact NE1-CD2 3.93Å; W26-Y30 WeakPolarHBondContact O-CD2 3.34Å; W26-Y30 PolarHBondContact O-N 3.33Å
31	G	40.3	Very low	47.7	Very low	57 Å²	57	117.3 Å²	117.3	59%	0.588	64%	0.637	S	S	*	*			trans	-86.9	5.7	179.6	0	0	0	0	0	115.7	N27 N33	N27-G31 PolarHBondContact O-N 2.83Å; G31-N33 PolarHBondContact O-N 3.47Å
32	V	43.4	Very low	47.7	Very low	95 Å²	95	114.6 Å²	114.6	58%	0.576	63%	0.633	S	S	*	*			trans	-89.2	109.6	176.2	-174.3	0	0	0	0	108.9	D34	V32-D34 WeakPolarHBondContact CG1-OD2 3.44Å; V32-D34 PolarHBondContact O-N 3.14Å
33	N	50.1	Low	47.8	Very low	147 Å²	147	108.6 Å²	108.6	79%	0.786	62%	0.616	S	S	*	*			trans	-67.4	68.8	-178	-164.4	31.4	0	0	0	111.5	G31 S35	G31-N33 PolarHBondContact O-N 3.47Å; N33-S35 PolarHBondContact O-N 2.86Å
34	D	39.3	Very low	47.8	Very low	113 Å²	113	107.6 Å²	107.6	60%	0.604	62%	0.615	S	S	*	*			trans	-96.2	94.3	177.2	-71.4	-30.5	0	0	0	109.4	V32 F36	V32-D34 WeakPolarHBondContact CG1-OD2 3.44Å; V32-D34 PolarHBondContact O-N 3.14Å; D34-F36 VanDerWaalsContact C-N 3.34Å; D34-F36 HydrophobicContact CB-CD2 4.35Å; D34-F36 HydrophobicContact CB-CE2 4.35Å; D34-F36 PolarHBondContact O-N 3.35Å
35	S	50.2	Low	47.8	Very low	112 Å²	112	107.9 Å²	107.9	78%	0.783	62%	0.616	S	S	*	*			trans	-60	95.3	167	-62.8	0	0	0	0	109.1	N33	N33-S35 PolarHBondContact O-N 2.86Å
36	F	41.1	Very low	47.5	Very low	152 Å²	152	110.9 Å²	110.9	67%	0.667	62%	0.624	S	S	*	*			trans	-75.2	134.2	173.1	-97.7	-89.6	0	0	0	110.2	D34 Y41	D34-F36 VanDerWaalsContact C-N 3.34Å; D34-F36 HydrophobicContact CB-CD2 4.35Å; D34-F36 HydrophobicContact CB-CE2 4.35Å; D34-F36 PolarHBondContact O-N 3.35Å; F36-Y41 WeakPolarHBondContact CD1-OH 3.32Å
37	P	41.3	Very low	47.5	Very low	100 Å²	100	107.5 Å²	107.5	65%	0.649	63%	0.628	S	S	*	*			trans	-66.4	138.1	179.1	27.4	-33	0	0	0	110.4	G39 Y41	P37-G39 VanDerWaalsContact C-N 3.26Å; P37-G39 PolarHBondContact O-N 2.96Å; P37-Y41 WeakPolarHBondContact O-CE2 3.26Å
38	D	49	Very low	47.9	Very low	170 Å²	170	104.8 Å²	104.8	91%	0.909	62%	0.622	S	S	*	*			trans	-59.3	83.2	175.6	-168.8	46.1	0	0	0	110.4
39	G	48.1	Very low	48	Very low	46 Å²	46	104.2 Å²	104.2	47%	0.474	62%	0.623	S	S	.	*			trans	-128.2	87.2	-175.6	0	0	0	0	0	109.2	P37 Y41	P37-G39 VanDerWaalsContact C-N 3.26Å; P37-G39 PolarHBondContact O-N 2.96Å; G39-Y41 VanDerWaalsContact C-N 3.33Å; G39-Y41 VanDerWaalsContact O-CD2 3.31Å; G39-Y41 WeakPolarHBondContact O-CD2 3.29Å; G39-Y41 PolarHBondContact O-N 3.35Å
40	D	48.8	Very low	47.8	Very low	125 Å²	125	105.5 Å²	105.5	67%	0.668	63%	0.629	S	S	*	*			trans	29.7	60	164.8	-156.7	2.9	0	0	0	115.7	G42	D40-G42 PolarHBondContact O-N 3.43Å
41	Y	48.8	Very low	48.5	Very low	117 Å²	117	104.7 Å²	104.7	46%	0.459	64%	0.644	S	S	.	*			trans	-75.5	2.8	173.7	-69.8	-83.6	0	0	0	112.8	F36 P37 G39 L45	F36-Y41 WeakPolarHBondContact CD1-OH 3.32Å; P37-Y41 WeakPolarHBondContact O-CE2 3.26Å; G39-Y41 VanDerWaalsContact C-N 3.33Å; G39-Y41 VanDerWaalsContact O-CD2 3.31Å; G39-Y41 WeakPolarHBondContact O-CD2 3.29Å; G39-Y41 PolarHBondContact O-N 3.35Å; Y41-L45 WeakPolarHBondContact O-CD1 3.36Å; Y41-L45 VanDerWaalsContact O-CG 3.26Å; Y41-L45 WeakPolarHBondContact O-CG 3.22Å
42	G	49.3	Very low	49.1	Very low	47 Å²	47	109.2 Å²	109.2	49%	0.485	65%	0.65	S	S	.	*	H	α-helix	trans	-74.1	-51.4	178.8	0	0	0	0	0	111.9	D40 N44	D40-G42 PolarHBondContact O-N 3.43Å; G42-N44 PolarHBondContact O-N 3.01Å
43	A	51.3	Low	49.9	Very low	48 Å²	48	109.8 Å²	109.8	40%	0.397	66%	0.658	S	S	.	*	H	α-helix	trans	-72.4	-23	-169.6	0	0	0	0	0	115.1	E46	A43-E46 WeakPolarHBondContact CA-OE1 3.03Å; A43-E46 WeakPolarHBondContact O-CG 3.46Å
44	N	49.6	Very low	50.3	Low	127 Å²	127	107.9 Å²	107.9	68%	0.679	66%	0.655	S	S	*	*	H	α-helix	trans	-97.7	-15	-178	-71.8	-28.2	0	0	0	113.6	G42 A47 A48	G42-N44 PolarHBondContact O-N 3.01Å; N44-A47 PolarHBondContact O-N 3.43Å; N44-A48 PolarHBondContact O-N 2.87Å
45	L	50.9	Low	51.2	Low	125 Å²	125	108.4 Å²	108.4	65%	0.654	66%	0.658	S	S	*	*	H	α-helix	trans	-80.9	-23.9	173.9	-75	175.5	0	0	0	112.3	Y41 A47	Y41-L45 WeakPolarHBondContact O-CD1 3.36Å; Y41-L45 VanDerWaalsContact O-CG 3.26Å; Y41-L45 WeakPolarHBondContact O-CG 3.22Å; L45-A47 VanDerWaalsContact C-N 3.28Å
46	E	47.9	Very low	51.7	Low	153 Å²	153	111.5 Å²	111.5	72%	0.715	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.2	-17.2	169.2	50.1	-174.6	126.4	0	0	113.1	A43	A43-E46 WeakPolarHBondContact CA-OE1 3.03Å; A43-E46 WeakPolarHBondContact O-CG 3.46Å
47	A	51.5	Low	52.7	Low	79 Å²	79	107.2 Å²	107.2	65%	0.653	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.5	-18.4	173	0	0	0	0	0	113.7	N44 L45 A49	N44-A47 PolarHBondContact O-N 3.43Å; L45-A47 VanDerWaalsContact C-N 3.28Å; A47-A49 PolarHBondContact O-N 2.9Å; A47-A49 VanDerWaalsContact O-N 3.13Å
48	A	54.9	Low	53.9	Low	60 Å²	60	107.7 Å²	107.7	50%	0.496	65%	0.645	S	S	.	*	S	Bend	trans	-69.9	107.2	162.7	0	0	0	0	0	106.8	N44	N44-A48 PolarHBondContact O-N 2.87Å
49	A	52.5	Low	54.7	Low	77 Å²	77	105.4 Å²	105.4	64%	0.636	63%	0.633	S	S	*	*			trans	-31.4	128.1	-171.5	0	0	0	0	0	112.4	A47 C51	A47-A49 PolarHBondContact O-N 2.9Å; A47-A49 VanDerWaalsContact O-N 3.13Å; A49-C51 PolarHBondContact O-N 3.47Å
50	P	50.8	Low	55.8	Low	112 Å²	112	107.4 Å²	107.4	73%	0.727	64%	0.64	S	S	*	*			trans	-48	117.6	177.9	-23.3	29.9	0	0	0	108.3	H52	P50-H52 PolarHBondContact O-N 3.5Å
51	C	58.8	Low	57.1	Low	136 Å²	136	103.4 Å²	103.4	92%	0.919	62%	0.624	S	S	*	*			trans	-69.8	62	167.2	-70.6	0	0	0	0	107.9	A49 S53	A49-C51 PolarHBondContact O-N 3.47Å; C51-S53 PolarHBondContact O-N 3.32Å
52	H	53.8	Low	58.7	Low	153 Å²	153	100.9 Å²	100.9	71%	0.708	62%	0.618	S	S	*	*			trans	-71.1	111.5	165.1	-154.3	-54.3	0	0	0	104.4	P50 C54	P50-H52 PolarHBondContact O-N 3.5Å; H52-C54 PolarHBondContact O-N 3.42Å
53	S	60.5	Low	60.3	Low	107 Å²	107	101.8 Å²	101.8	75%	0.748	62%	0.616	S	S	*	*			trans	-52.6	97.5	166	-179.3	0	0	0	0	107.1	C51 N55	C51-S53 PolarHBondContact O-N 3.32Å; S53-N55 PolarHBondContact O-N 2.96Å
54	C	58.3	Low	62.1	Low	107 Å²	107	106.5 Å²	106.5	72%	0.723	63%	0.627	S	S	*	*			trans	-75.7	112.2	172.1	-74.9	0	0	0	0	105.2	H52 L56	H52-C54 PolarHBondContact O-N 3.42Å; C54-L56 PolarHBondContact O-N 3.47Å
55	N	58.6	Low	63.8	Low	123 Å²	123	106 Å²	106	66%	0.658	62%	0.619	S	S	*	*			trans	-61.5	106.5	170.7	-140.6	9.5	0	0	0	106.3	S53 L57	S53-N55 PolarHBondContact O-N 2.96Å; N55-L57 PolarHBondContact ND2-O 2.86Å; N55-L57 PolarHBondContact O-N 3.24Å
56	L	60.5	Low	65.7	Low	177 Å²	177	104.4 Å²	104.4	93%	0.927	61%	0.611	S	S	*	*	S	Bend	trans	-60.9	-13.4	178.3	-107.9	167.8	0	0	0	111.9	C54	C54-L56 PolarHBondContact O-N 3.47Å
57	L	60.9	Low	67.9	Low	63 Å²	63	102.3 Å²	102.3	33%	0.33	60%	0.603	S	S	.	*	S	Bend	trans	-114.9	93.3	170.4	-135.1	68.4	0	0	0	108	N55 L62 F65	N55-L57 PolarHBondContact ND2-O 2.86Å; N55-L57 PolarHBondContact O-N 3.24Å; L57-L62 HydrophobicContact CD2-CD2 4.08Å; L57-L62 HydrophobicContact CD2-CG 3.95Å; L57-L62 HydrophobicContact CG-CG 4.43Å; L57-F65 HydrophobicContact CD1-CB 4.43Å; L57-F65 HydrophobicContact CD1-CD2 4.48Å; L57-F65 HydrophobicContact CD1-CG 4.36Å; L57-F65 HydrophobicContact CD2-CD1 4.21Å; L57-F65 HydrophobicContact CD2-CG 4.4Å
58	D	66.3	Low	69.9	Low	109 Å²	109	102.6 Å²	102.6	58%	0.583	60%	0.597	S	S	*	*			trans	-66.5	147.7	168.8	-161.4	9.6	0	0	0	109	S60 A61 L62	D58-S60 PolarHBondContact O-N 2.87Å; D58-A61 WeakPolarHBondContact O-CB 3.45Å; D58-A61 PolarHBondContact O-N 3.4Å; D58-L62 PolarHBondContact O-N 3.46Å
59	D	67.4	Low	71.8	Confident	123 Å²	123	102.2 Å²	102.2	66%	0.658	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.7	-26.1	-173.5	-75.4	-34.5	0	0	0	112.3	P63	D59-P63 WeakPolarHBondContact O-CD 3.25Å
60	S	71.3	Confident	73.9	Confident	87 Å²	87	102.1 Å²	102.1	61%	0.608	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.8	-28.2	175.4	-54	0	0	0	0	113.8	D58 P63	D58-S60 PolarHBondContact O-N 2.87Å; S60-P63 WeakPolarHBondContact O-CD 3.3Å
61	A	75.8	Confident	76.1	Confident	41 Å²	41	102.1 Å²	102.1	34%	0.339	58%	0.576	S	S	.	*	T	Hydrogen-bonded Turn	trans	-90.9	-21.8	-177.1	0	0	0	0	0	113.1	D58 F64 F65	D58-A61 WeakPolarHBondContact O-CB 3.45Å; D58-A61 PolarHBondContact O-N 3.4Å; A61-F64 PolarHBondContact O-N 2.94Å; A61-F65 PolarHBondContact O-N 2.7Å
62	L	80.8	Confident	77.9	Confident	65 Å²	65	97.5 Å²	97.5	34%	0.34	55%	0.551	S	S	.	*	H	α-helix	trans	-48.1	-50.3	176	-115.5	167	0	0	0	114.5	L57 D58 F64 F65 I66	L57-L62 HydrophobicContact CD2-CD2 4.08Å; L57-L62 HydrophobicContact CD2-CG 3.95Å; L57-L62 HydrophobicContact CG-CG 4.43Å; D58-L62 PolarHBondContact O-N 3.46Å; L62-F64 PolarHBondContact O-N 2.93Å; L62-F65 PolarHBondContact O-N 3.49Å; L62-I66 HydrophobicContact CD2-CD1 4.04Å; L62-I66 HydrophobicContact CD2-CG1 4.43Å; L62-I66 WeakPolarHBondContact O-CG1 3.23Å; L62-I66 PolarHBondContact O-N 2.97Å
63	P	84.8	Confident	79.9	Confident	66 Å²	66	95.1 Å²	95.1	43%	0.429	54%	0.543	S	S	.	.	H	α-helix	trans	-64.5	-38.9	-178.9	23.2	-33.7	0	0	0	112.7	D59 S60 I66 L67	D59-P63 WeakPolarHBondContact O-CD 3.25Å; S60-P63 WeakPolarHBondContact O-CD 3.3Å; P63-I66 PolarHBondContact O-N 3.29Å; P63-L67 VanDerWaalsContact O-CG 3.31Å; P63-L67 WeakPolarHBondContact O-CG 3.22Å; P63-L67 PolarHBondContact O-N 2.92Å
64	F	87.8	Confident	81.7	Confident	147 Å²	147	95 Å²	95	65%	0.645	53%	0.533	S	S	*	.	H	α-helix	trans	-68.1	-38.6	177.3	-66.6	-79.9	0	0	0	111.9	A61 L62 L67 T68	A61-F64 PolarHBondContact O-N 2.94Å; L62-F64 PolarHBondContact O-N 2.93Å; F64-L67 PolarHBondContact O-N 2.98Å; F64-T68 WeakPolarHBondContact O-CB 3.25Å; F64-T68 VanDerWaalsContact O-CG2 3.31Å; F64-T68 WeakPolarHBondContact O-CG2 3.44Å; F64-T68 PolarHBondContact O-N 3.32Å; F64-T68 PolarHBondContact O-OG1 2.82Å
65	F	86.3	Confident	83.5	Confident	115 Å²	115	92.4 Å²	92.4	50%	0.504	52%	0.519	S	S	.	.	H	α-helix	trans	-61.8	-43.7	174.3	179.6	-100.6	0	0	0	111.8	L57 A61 L62 T68 S69	L57-F65 HydrophobicContact CD1-CB 4.43Å; L57-F65 HydrophobicContact CD1-CD2 4.48Å; L57-F65 HydrophobicContact CD1-CG 4.36Å; L57-F65 HydrophobicContact CD2-CD1 4.21Å; L57-F65 HydrophobicContact CD2-CG 4.4Å; A61-F65 PolarHBondContact O-N 2.7Å; L62-F65 PolarHBondContact O-N 3.49Å; F65-T68 WeakPolarHBondContact CA-OG1 3.44Å; F65-T68 PolarHBondContact O-OG1 2.94Å; F65-S69 WeakPolarHBondContact O-CB 3.31Å; F65-S69 PolarHBondContact O-N 3.47Å
66	I	90.9	Very high	85.3	Confident	93 Å²	93	89.7 Å²	89.7	48%	0.477	51%	0.51	S	S	.	.	H	α-helix	trans	-62.5	-47.8	176.7	-66.4	165.6	0	0	0	110.5	L62 P63 T68 S69 V70	L62-I66 HydrophobicContact CD2-CD1 4.04Å; L62-I66 HydrophobicContact CD2-CG1 4.43Å; L62-I66 WeakPolarHBondContact O-CG1 3.23Å; L62-I66 PolarHBondContact O-N 2.97Å; P63-I66 PolarHBondContact O-N 3.29Å; I66-T68 PolarHBondContact O-N 3.01Å; I66-S69 PolarHBondContact O-N 3.41Å; I66-V70 HydrophobicContact CG2-CG2 4.42Å; I66-V70 WeakPolarHBondContact O-CG2 3.36Å; I66-V70 PolarHBondContact O-N 3.42Å
67	L	93.7	Very high	86.9	Confident	108 Å²	108	84.2 Å²	84.2	57%	0.565	49%	0.487	S	S	*	.	H	α-helix	trans	-60.3	-47.3	-180	-72.7	172	0	0	0	112	P63 F64 S69 V70 L71	P63-L67 VanDerWaalsContact O-CG 3.31Å; P63-L67 WeakPolarHBondContact O-CG 3.22Å; P63-L67 PolarHBondContact O-N 2.92Å; F64-L67 PolarHBondContact O-N 2.98Å; L67-S69 VanDerWaalsContact C-N 3.35Å; L67-V70 PolarHBondContact O-N 2.95Å; L67-L71 WeakPolarHBondContact O-CB 3.34Å; L67-L71 VanDerWaalsContact O-CG 3.25Å; L67-L71 WeakPolarHBondContact O-CG 3.31Å; L67-L71 PolarHBondContact O-N 3.42Å
68	T	92.9	Very high	88.6	Confident	85 Å²	85	85.1 Å²	85.1	52%	0.521	50%	0.495	S	S	.	.	H	α-helix	trans	-66.1	-37.4	179.3	51.2	0	0	0	0	112.1	F64 F65 I66 G72	F64-T68 WeakPolarHBondContact O-CB 3.25Å; F64-T68 VanDerWaalsContact O-CG2 3.31Å; F64-T68 WeakPolarHBondContact O-CG2 3.44Å; F64-T68 PolarHBondContact O-N 3.32Å; F64-T68 PolarHBondContact O-OG1 2.82Å; F65-T68 WeakPolarHBondContact CA-OG1 3.44Å; F65-T68 PolarHBondContact O-OG1 2.94Å; I66-T68 PolarHBondContact O-N 3.01Å; T68-G72 PolarHBondContact O-N 3.2Å
69	S	94.1	Very high	89.9	Confident	52 Å²	52	84 Å²	84	36%	0.364	49%	0.492	S	S	.	.	H	α-helix	trans	-61.6	-50.3	173.8	-177.8	0	0	0	0	111.8	F65 I66 L67 L71 G72 I73	F65-S69 WeakPolarHBondContact O-CB 3.31Å; F65-S69 PolarHBondContact O-N 3.47Å; I66-S69 PolarHBondContact O-N 3.41Å; L67-S69 VanDerWaalsContact C-N 3.35Å; S69-L71 PolarHBondContact O-N 3.02Å; S69-G72 PolarHBondContact O-N 3.15Å; S69-I73 WeakPolarHBondContact O-CG1 3.21Å; S69-I73 PolarHBondContact O-N 2.98Å
70	V	97.1	Very high	91.2	Very high	75 Å²	75	81.9 Å²	81.9	46%	0.455	48%	0.48	S	S	.	.	H	α-helix	trans	-61.7	-45.6	178.4	172.9	0	0	0	0	111.2	I66 L67 G72 I73 L74	I66-V70 HydrophobicContact CG2-CG2 4.42Å; I66-V70 WeakPolarHBondContact O-CG2 3.36Å; I66-V70 PolarHBondContact O-N 3.42Å; L67-V70 PolarHBondContact O-N 2.95Å; V70-G72 VanDerWaalsContact C-N 3.33Å; V70-G72 PolarHBondContact O-N 3.37Å; V70-I73 PolarHBondContact O-N 3.35Å; V70-L74 HydrophobicContact CG1-CD1 4.05Å; V70-L74 WeakPolarHBondContact O-CG 3.45Å; V70-L74 PolarHBondContact O-N 3.4Å
71	L	96.9	Very high	92	Very high	113 Å²	113	83.1 Å²	83.1	59%	0.592	47%	0.474	S	S	*	.	H	α-helix	trans	-62.8	-40.4	177.5	-73.4	170.7	0	0	0	111.8	L67 S69 L74 A75	L67-L71 WeakPolarHBondContact O-CB 3.34Å; L67-L71 VanDerWaalsContact O-CG 3.25Å; L67-L71 WeakPolarHBondContact O-CG 3.31Å; L67-L71 PolarHBondContact O-N 3.42Å; S69-L71 PolarHBondContact O-N 3.02Å; L71-L74 PolarHBondContact O-N 3.46Å; L71-A75 VanDerWaalsContact O-CB 3.26Å; L71-A75 WeakPolarHBondContact O-CB 3.49Å; L71-A75 PolarHBondContact O-N 3.28Å
72	G	96.5	Very high	92.7	Very high	39 Å²	39	86.6 Å²	86.6	40%	0.402	49%	0.485	S	S	.	.	H	α-helix	trans	-61.9	-43.7	175.9	0	0	0	0	0	112.5	T68 S69 V70 A75 S76	T68-G72 PolarHBondContact O-N 3.2Å; S69-G72 PolarHBondContact O-N 3.15Å; V70-G72 VanDerWaalsContact C-N 3.33Å; V70-G72 PolarHBondContact O-N 3.37Å; G72-A75 PolarHBondContact O-N 2.81Å; G72-S76 VanDerWaalsContact O-CB 3.25Å; G72-S76 WeakPolarHBondContact O-CB 3.49Å; G72-S76 PolarHBondContact O-N 2.98Å
73	I	97.2	Very high	93.1	Very high	103 Å²	103	89 Å²	89	53%	0.528	50%	0.498	S	S	.	.	H	α-helix	trans	-64.1	-46	176.7	-66.4	165.5	0	0	0	110.7	S69 V70 S76 S77	S69-I73 WeakPolarHBondContact O-CG1 3.21Å; S69-I73 PolarHBondContact O-N 2.98Å; V70-I73 PolarHBondContact O-N 3.35Å; I73-S76 PolarHBondContact O-N 3.13Å; I73-S77 VanDerWaalsContact O-CB 3.22Å; I73-S77 WeakPolarHBondContact O-CB 3.33Å; I73-S77 PolarHBondContact O-N 2.7Å; I73-S77 PolarHBondContact O-OG 3.23Å
74	L	97.2	Very high	93.1	Very high	103 Å²	103	90.6 Å²	90.6	54%	0.539	50%	0.498	S	S	.	.	H	α-helix	trans	-63.4	-45.3	178.4	-74.4	171.7	0	0	0	111.7	V70 L71 S77 T78	V70-L74 HydrophobicContact CG1-CD1 4.05Å; V70-L74 WeakPolarHBondContact O-CG 3.45Å; V70-L74 PolarHBondContact O-N 3.4Å; L71-L74 PolarHBondContact O-N 3.46Å; L74-S77 PolarHBondContact O-N 3.21Å; L74-T78 WeakPolarHBondContact O-CB 3.46Å; L74-T78 WeakPolarHBondContact O-CG2 3.33Å; L74-T78 PolarHBondContact O-N 3.01Å; L74-T78 PolarHBondContact O-OG1 2.74Å
75	A	96.8	Very high	92.6	Very high	53 Å²	53	88.4 Å²	88.4	44%	0.438	49%	0.486	S	S	.	.	H	α-helix	trans	-61.9	-47.8	177.6	0	0	0	0	0	111.3	L71 G72 S77 T78 V79	L71-A75 VanDerWaalsContact O-CB 3.26Å; L71-A75 WeakPolarHBondContact O-CB 3.49Å; L71-A75 PolarHBondContact O-N 3.28Å; G72-A75 PolarHBondContact O-N 2.81Å; A75-S77 PolarHBondContact O-N 3.02Å; A75-T78 PolarHBondContact O-N 2.91Å; A75-T78 PolarHBondContact O-OG1 3.3Å; A75-V79 VanDerWaalsContact O-CG2 3.32Å; A75-V79 WeakPolarHBondContact O-CG2 3.45Å; A75-V79 PolarHBondContact O-N 3.34Å; A75-V79 VanDerWaalsContact O-N 3.09Å
76	S	95.9	Very high	92.1	Very high	66 Å²	66	86.1 Å²	86.1	46%	0.462	48%	0.482	S	S	.	.	H	α-helix	trans	-61.4	-46.5	177.9	-176.1	0	0	0	0	111.5	G72 I73 T78 V79 L80	G72-S76 VanDerWaalsContact O-CB 3.25Å; G72-S76 WeakPolarHBondContact O-CB 3.49Å; G72-S76 PolarHBondContact O-N 2.98Å; I73-S76 PolarHBondContact O-N 3.13Å; S76-T78 PolarHBondContact O-N 2.93Å; S76-V79 PolarHBondContact O-N 3.21Å; S76-L80 WeakPolarHBondContact O-CB 3.36Å; S76-L80 VanDerWaalsContact O-CG 3.3Å; S76-L80 WeakPolarHBondContact O-CG 3.47Å; S76-L80 PolarHBondContact O-N 3.24Å
77	S	95	Very high	90.9	Very high	63 Å²	63	87.1 Å²	87.1	44%	0.441	49%	0.488	S	S	.	.	H	α-helix	trans	-63.3	-39.9	-179.7	-57.8	0	0	0	0	112.5	I73 L74 A75 F81	I73-S77 VanDerWaalsContact O-CB 3.22Å; I73-S77 WeakPolarHBondContact O-CB 3.33Å; I73-S77 PolarHBondContact O-N 2.7Å; I73-S77 PolarHBondContact O-OG 3.23Å; L74-S77 PolarHBondContact O-N 3.21Å; A75-S77 PolarHBondContact O-N 3.02Å; S77-F81 VanDerWaalsContact O-CB 3.23Å; S77-F81 WeakPolarHBondContact O-CB 3.49Å; S77-F81 PolarHBondContact O-N 3.24Å
78	T	95.1	Very high	89.3	Confident	81 Å²	81	88.2 Å²	88.2	50%	0.497	49%	0.488	S	S	.	.	H	α-helix	trans	-68.5	-40.4	178.3	54.1	0	0	0	0	111.9	L74 A75 S76 F81 M82	L74-T78 WeakPolarHBondContact O-CB 3.46Å; L74-T78 WeakPolarHBondContact O-CG2 3.33Å; L74-T78 PolarHBondContact O-N 3.01Å; L74-T78 PolarHBondContact O-OG1 2.74Å; A75-T78 PolarHBondContact O-N 2.91Å; A75-T78 PolarHBondContact O-OG1 3.3Å; S76-T78 PolarHBondContact O-N 2.93Å; T78-F81 PolarHBondContact O-N 3.21Å; T78-M82 WeakPolarHBondContact O-CG 3.37Å; T78-M82 PolarHBondContact O-N 3Å
79	V	94.9	Very high	87.7	Confident	86 Å²	86	91.5 Å²	91.5	52%	0.521	49%	0.491	S	S	.	.	H	α-helix	trans	-63	-49.5	174.5	172.1	0	0	0	0	110.6	A75 S76 F81 M82 L83	A75-V79 VanDerWaalsContact O-CG2 3.32Å; A75-V79 WeakPolarHBondContact O-CG2 3.45Å; A75-V79 PolarHBondContact O-N 3.34Å; A75-V79 VanDerWaalsContact O-N 3.09Å; S76-V79 PolarHBondContact O-N 3.21Å; V79-F81 VanDerWaalsContact C-N 3.31Å; V79-F81 PolarHBondContact O-N 3.47Å; V79-M82 PolarHBondContact O-N 3.23Å; V79-L83 HydrophobicContact CG1-CD1 4.11Å; V79-L83 WeakPolarHBondContact O-CG 3.21Å; V79-L83 PolarHBondContact O-N 3.41Å
80	L	93.6	Very high	85.9	Confident	78 Å²	78	99.9 Å²	99.9	41%	0.408	52%	0.515	S	S	.	.	H	α-helix	trans	-57.6	-45.9	175.8	-71	167.6	0	0	0	110.8	S76 M82 L83 F84	S76-L80 WeakPolarHBondContact O-CB 3.36Å; S76-L80 VanDerWaalsContact O-CG 3.3Å; S76-L80 WeakPolarHBondContact O-CG 3.47Å; S76-L80 PolarHBondContact O-N 3.24Å; L80-M82 VanDerWaalsContact C-N 3.32Å; L80-M82 PolarHBondContact O-N 3.2Å; L80-L83 PolarHBondContact O-N 3.1Å; L80-L83 VanDerWaalsContact O-N 3.14Å; L80-F84 HydrophobicContact CB-CD2 4.19Å; L80-F84 HydrophobicContact CB-CE2 4.18Å; L80-F84 HydrophobicContact CD2-CE2 3.88Å; L80-F84 WeakPolarHBondContact O-CD2 3.38Å; L80-F84 PolarHBondContact O-N 3.09Å
81	F	89.3	Confident	84	Confident	113 Å²	113	104 Å²	104	50%	0.496	53%	0.529	S	S	.	.	H	α-helix	trans	-60.4	-39.8	178.1	180	-112.1	0	0	0	112.6	S77 T78 V79 F84 R85	S77-F81 VanDerWaalsContact O-CB 3.23Å; S77-F81 WeakPolarHBondContact O-CB 3.49Å; S77-F81 PolarHBondContact O-N 3.24Å; T78-F81 PolarHBondContact O-N 3.21Å; V79-F81 VanDerWaalsContact C-N 3.31Å; V79-F81 PolarHBondContact O-N 3.47Å; F81-F84 PolarHBondContact O-N 3.37Å; F81-R85 HydrophobicContact CD1-CG 4.3Å; F81-R85 HydrophobicContact CE1-CG 4.05Å; F81-R85 HydrophobicContact CE2-CG 4.39Å; F81-R85 HydrophobicContact CZ-CG 4.08Å; F81-R85 VanDerWaalsContact O-CB 3.26Å; F81-R85 WeakPolarHBondContact O-CB 3.15Å; F81-R85 VanDerWaalsContact O-CG 3.29Å; F81-R85 WeakPolarHBondContact O-CG 3.36Å; F81-R85 PolarHBondContact O-N 2.88Å
82	M	89.6	Confident	82.1	Confident	114 Å²	114	105.1 Å²	105.1	56%	0.562	54%	0.535	S	S	*	.	H	α-helix	trans	-66.7	-37.7	175.2	-71.9	-65.8	-177.8	0	0	112.6	T78 V79 L80 P86	T78-M82 WeakPolarHBondContact O-CG 3.37Å; T78-M82 PolarHBondContact O-N 3Å; V79-M82 PolarHBondContact O-N 3.23Å; L80-M82 VanDerWaalsContact C-N 3.32Å; L80-M82 PolarHBondContact O-N 3.2Å; M82-P86 WeakPolarHBondContact O-CD 3.33Å
83	L	88.9	Confident	80	Confident	117 Å²	117	108.5 Å²	108.5	61%	0.613	55%	0.551	S	S	*	*	H	α-helix	trans	-68.6	-38	175.6	-70.3	172.7	0	0	0	112.6	V79 L80 P86	V79-L83 HydrophobicContact CG1-CD1 4.11Å; V79-L83 WeakPolarHBondContact O-CG 3.21Å; V79-L83 PolarHBondContact O-N 3.41Å; L80-L83 PolarHBondContact O-N 3.1Å; L80-L83 VanDerWaalsContact O-N 3.14Å; L83-P86 VanDerWaalsContact O-CD 3.24Å; L83-P86 WeakPolarHBondContact O-CD 3.26Å; L83-P86 WeakPolarHBondContact O-CG 3.49Å
84	F	85.3	Confident	78.2	Confident	99 Å²	99	109.4 Å²	109.4	43%	0.434	56%	0.564	S	S	.	*	H	α-helix	trans	-85.8	-18.1	179.4	-68.7	-65.7	0	0	0	113.8	L80 F81 P86 L87 F88	L80-F84 HydrophobicContact CB-CD2 4.19Å; L80-F84 HydrophobicContact CB-CE2 4.18Å; L80-F84 HydrophobicContact CD2-CE2 3.88Å; L80-F84 WeakPolarHBondContact O-CD2 3.38Å; L80-F84 PolarHBondContact O-N 3.09Å; F81-F84 PolarHBondContact O-N 3.37Å; F84-P86 VanDerWaalsContact C-CD 3.44Å; F84-P86 VanDerWaalsContact C-N 3.34Å; F84-L87 HydrophobicContact CD1-CD1 3.69Å; F84-L87 HydrophobicContact CE1-CD1 4.27Å; F84-L87 WeakPolarHBondContact O-CB 3.03Å; F84-L87 PolarHBondContact O-N 2.83Å; F84-F88 HydrophobicContact CB-CD2 4.31Å; F84-F88 HydrophobicContact CB-CE2 3.99Å; F84-F88 WeakPolarHBondContact O-CD2 3.31Å; F84-F88 PolarHBondContact O-N 2.99Å
85	R	76.5	Confident	75.9	Confident	100 Å²	100	111.5 Å²	111.5	38%	0.377	61%	0.611	S	S	.	*	H	α-helix	trans	-47.8	-39.6	174.9	-106.4	-177.4	173.6	-158.8	-2.1	116.1	F81 R89	F81-R85 HydrophobicContact CD1-CG 4.3Å; F81-R85 HydrophobicContact CE1-CG 4.05Å; F81-R85 HydrophobicContact CE2-CG 4.39Å; F81-R85 HydrophobicContact CZ-CG 4.08Å; F81-R85 VanDerWaalsContact O-CB 3.26Å; F81-R85 WeakPolarHBondContact O-CB 3.15Å; F81-R85 VanDerWaalsContact O-CG 3.29Å; F81-R85 WeakPolarHBondContact O-CG 3.36Å; F81-R85 PolarHBondContact O-N 2.88Å; R85-R89 PolarHBondContact O-N 3.39Å; R85-R89 PolarHBondContact O-NE 3.36Å
86	P	75.8	Confident	74.8	Confident	67 Å²	67	114.5 Å²	114.5	44%	0.435	62%	0.62	S	S	.	*	H	α-helix	trans	-70.4	-30.9	175.1	24.1	-33.9	0	0	0	113.4	M82 L83 F84 R89 W90	M82-P86 WeakPolarHBondContact O-CD 3.33Å; L83-P86 VanDerWaalsContact O-CD 3.24Å; L83-P86 WeakPolarHBondContact O-CD 3.26Å; L83-P86 WeakPolarHBondContact O-CG 3.49Å; F84-P86 VanDerWaalsContact C-CD 3.44Å; F84-P86 VanDerWaalsContact C-N 3.34Å; P86-R89 PolarHBondContact O-N 3.44Å; P86-W90 VanDerWaalsContact O-CD1 3.32Å; P86-W90 PolarHBondContact O-N 2.91Å
87	L	66.2	Low	73.7	Confident	115 Å²	115	117 Å²	117	60%	0.602	63%	0.628	S	S	*	*	H	α-helix	trans	-69.3	-39.6	-178.9	-69	166.5	0	0	0	112	F84 W90	F84-L87 HydrophobicContact CD1-CD1 3.69Å; F84-L87 HydrophobicContact CE1-CD1 4.27Å; F84-L87 WeakPolarHBondContact O-CB 3.03Å; F84-L87 PolarHBondContact O-N 2.83Å; L87-W90 PolarHBondContact O-N 3.01Å
88	F	60.3	Low	72.5	Confident	130 Å²	130	120 Å²	120	57%	0.57	64%	0.638	S	S	*	*	H	α-helix	trans	-76.2	-22.7	177.2	-67.7	-69.9	0	0	0	113.8	F84 W90 Q91	F84-F88 HydrophobicContact CB-CD2 4.31Å; F84-F88 HydrophobicContact CB-CE2 3.99Å; F84-F88 WeakPolarHBondContact O-CD2 3.31Å; F84-F88 PolarHBondContact O-N 2.99Å; F88-W90 VanDerWaalsContact C-N 3.29Å; F88-Q91 PolarHBondContact O-N 3.3Å
89	R	59.6	Low	71.2	Confident	155 Å²	155	122.3 Å²	122.3	59%	0.585	65%	0.647	S	S	*	*	H	α-helix	trans	-73.8	-20.2	174.6	-81.2	-172.8	-96.9	-173.1	-3.8	113.2	R85 P86 Q91 L92	R85-R89 PolarHBondContact O-N 3.39Å; R85-R89 PolarHBondContact O-NE 3.36Å; P86-R89 PolarHBondContact O-N 3.44Å; R89-Q91 VanDerWaalsContact C-N 3.3Å; R89-L92 PolarHBondContact O-N 2.77Å
90	W	56.1	Low	69.7	Low	227 Å²	227	124.6 Å²	124.6	86%	0.86	65%	0.654	S	S	*	*	G	3₁₀ helix	trans	-75.1	-15.8	174.2	-87.8	54.9	0	0	0	113.8	P86 L87 F88	P86-W90 VanDerWaalsContact O-CD1 3.32Å; P86-W90 PolarHBondContact O-N 2.91Å; L87-W90 PolarHBondContact O-N 3.01Å; F88-W90 VanDerWaalsContact C-N 3.29Å
91	Q	56.6	Low	68.1	Low	161 Å²	161	127.7 Å²	127.7	75%	0.752	67%	0.671	S	S	*	*	G	3₁₀ helix	trans	-86.6	-3.6	172.9	-82.2	-177.3	-47.6	0	0	114	F88 R89	F88-Q91 PolarHBondContact O-N 3.3Å; R89-Q91 VanDerWaalsContact C-N 3.3Å
92	L	57.1	Low	66.6	Low	138 Å²	138	128.7 Å²	128.7	72%	0.723	68%	0.683	S	S	*	*	G	3₁₀ helix	trans	-101.1	19.3	-179.4	-81.7	153.7	0	0	0	113.4	R89 P94	R89-L92 PolarHBondContact O-N 2.77Å; L92-P94 WeakPolarHBondContact O-CD 3.4Å
93	C	53.5	Low	64.8	Low	109 Å²	109	129.8 Å²	129.8	74%	0.736	69%	0.693	S	S	*	*			trans	-81.5	102.6	160.6	-74.8	0	0	0	0	108.7	G95	C93-G95 PolarHBondContact O-N 3.43Å
94	P	58.8	Low	62.8	Low	122 Å²	122	130.9 Å²	130.9	79%	0.792	70%	0.699	S	S	*	*			trans	-65.8	116.6	160.5	28.7	-32.6	0	0	0	107.6	L92	L92-P94 WeakPolarHBondContact O-CD 3.4Å
95	G	48.5	Very low	60.8	Low	148 Å²	148	133.8 Å²	133.8	100%	1.526	72%	0.724	S	S	*	*			trans	-73.5	0	153.2	0	0	0	0	0	109.6	C93	C93-G95 PolarHBondContact O-N 3.43Å

Retrieved 95 of 95 residues in 22.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).