A0A059U1E2_CAPHI Loading...

Beta-defensin

Has antibacterial activity.

AlphaFold DB , UniProt , Accession A0A059U1E2, Species CAPHI (Capra hircus, Goat), Gene DEFB121, Length 60 aa.

						>A0A059U1E2_CAPHI|A0A059U1E2|DEFB121
MKFLLILTVTLLLAQVTPAMKCWNNLGRCRETCEQNEVFHIMCKNEGMCCISPKHLPARN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	64.1	Low	72.5	Confident	194 Å²	194	119.2 Å²	119.2	96%	0.956	61%	0.609	S	S	*	*				0	-55.7	0	-52.8	-50.4	176.1	0	0	113.1	F3 L4	M1-F3 PolarHBondContact O-N 3.44Å; M1-L4 PolarHBondContact O-N 3.27Å
2	K	68.4	Low	72.1	Confident	166 Å²	166	117 Å²	117	72%	0.722	60%	0.599	S	S	*	*	H	α-helix	trans	-61	-42.3	-176.8	-158.9	89	109.2	-178.2	0	114.4	L4 L5 I6	K2-L4 PolarHBondContact O-N 3.07Å; K2-L5 PolarHBondContact O-N 3.31Å; K2-I6 HydrophobicContact CG-CD1 4.28Å; K2-I6 WeakPolarHBondContact O-CG1 3.4Å; K2-I6 PolarHBondContact O-N 3.49Å
3	F	72.8	Confident	71.3	Confident	178 Å²	178	116.2 Å²	116.2	78%	0.781	60%	0.596	S	S	*	*	H	α-helix	trans	-65	-34.7	-177.8	-68.5	-76.6	0	0	0	114.1	M1 L5 I6 L7	M1-F3 PolarHBondContact O-N 3.44Å; F3-L5 VanDerWaalsContact C-N 3.33Å; F3-L5 PolarHBondContact O-N 3.27Å; F3-I6 PolarHBondContact O-N 3.3Å; F3-L7 PolarHBondContact O-N 3.42Å
4	L	75	Confident	70.7	Confident	116 Å²	116	113.2 Å²	113.2	61%	0.607	60%	0.597	S	S	*	*	H	α-helix	trans	-65.1	-39.1	177.7	-69.5	168.1	0	0	0	111.4	M1 K2 L7 T8	M1-L4 PolarHBondContact O-N 3.27Å; K2-L4 PolarHBondContact O-N 3.07Å; L4-L7 PolarHBondContact O-N 3.04Å; L4-T8 WeakPolarHBondContact O-CG2 3.4Å; L4-T8 PolarHBondContact O-N 3.14Å; L4-T8 VanDerWaalsContact O-N 3.14Å; L4-T8 PolarHBondContact O-OG1 3.47Å
5	L	74	Confident	70.1	Confident	114 Å²	114	114.5 Å²	114.5	60%	0.597	60%	0.598	S	S	*	*	H	α-helix	trans	-67.4	-35.3	176.7	-74.1	164.6	0	0	0	112.5	K2 F3 T8 V9	K2-L5 PolarHBondContact O-N 3.31Å; F3-L5 VanDerWaalsContact C-N 3.33Å; F3-L5 PolarHBondContact O-N 3.27Å; L5-T8 PolarHBondContact O-OG1 3.03Å; L5-V9 VanDerWaalsContact O-CG2 3.23Å; L5-V9 WeakPolarHBondContact O-CG2 3.38Å; L5-V9 PolarHBondContact O-N 3.43Å
6	I	75.6	Confident	69.2	Low	98 Å²	98	113.8 Å²	113.8	50%	0.503	60%	0.6	S	S	.	*	H	α-helix	trans	-68.8	-44	177.8	-61.6	163.5	0	0	0	109.7	K2 F3 T8 V9 T10	K2-I6 HydrophobicContact CG-CD1 4.28Å; K2-I6 WeakPolarHBondContact O-CG1 3.4Å; K2-I6 PolarHBondContact O-N 3.49Å; F3-I6 PolarHBondContact O-N 3.3Å; I6-T8 PolarHBondContact O-N 3.01Å; I6-V9 PolarHBondContact O-N 3.38Å; I6-T10 PolarHBondContact O-N 3.45Å; I6-T10 PolarHBondContact O-OG1 2.96Å; I6-T10 VanDerWaalsContact O-OG1 3.04Å
7	L	73.8	Confident	68.6	Low	105 Å²	105	112.8 Å²	112.8	55%	0.55	60%	0.6	S	S	.	*	H	α-helix	trans	-61.7	-43.1	-179.7	-167.7	73.4	0	0	0	112.2	F3 L4 T10 L11	F3-L7 PolarHBondContact O-N 3.42Å; L4-L7 PolarHBondContact O-N 3.04Å; L7-T10 WeakPolarHBondContact CA-OG1 3.23Å; L7-T10 PolarHBondContact O-N 3.32Å; L7-T10 PolarHBondContact O-OG1 2.97Å; L7-L11 PolarHBondContact O-N 3.22Å
8	T	75.8	Confident	68.2	Low	75 Å²	75	113.2 Å²	113.2	46%	0.46	61%	0.609	S	S	.	*	H	α-helix	trans	-64.9	-42	178.3	52.4	0	0	0	0	111.7	L4 L5 I6 L11 L12	L4-T8 WeakPolarHBondContact O-CG2 3.4Å; L4-T8 PolarHBondContact O-N 3.14Å; L4-T8 VanDerWaalsContact O-N 3.14Å; L4-T8 PolarHBondContact O-OG1 3.47Å; L5-T8 PolarHBondContact O-OG1 3.03Å; I6-T8 PolarHBondContact O-N 3.01Å; T8-L11 PolarHBondContact O-N 3.41Å; T8-L12 WeakPolarHBondContact O-CB 3.38Å; T8-L12 WeakPolarHBondContact O-CD1 3.41Å; T8-L12 WeakPolarHBondContact O-CG 3.37Å; T8-L12 PolarHBondContact O-N 2.84Å
9	V	76.5	Confident	68.3	Low	82 Å²	82	109.5 Å²	109.5	50%	0.497	60%	0.596	S	S	.	*	H	α-helix	trans	-63	-43.4	176.8	171.6	0	0	0	0	111.6	L5 I6 L12 L13	L5-V9 VanDerWaalsContact O-CG2 3.23Å; L5-V9 WeakPolarHBondContact O-CG2 3.38Å; L5-V9 PolarHBondContact O-N 3.43Å; I6-V9 PolarHBondContact O-N 3.38Å; V9-L12 PolarHBondContact O-N 3.48Å; V9-L13 HydrophobicContact CG1-CD1 4Å; V9-L13 WeakPolarHBondContact O-CG 3.33Å; V9-L13 PolarHBondContact O-N 3.27Å
10	T	73.1	Confident	69.1	Low	73 Å²	73	108.6 Å²	108.6	45%	0.448	59%	0.589	S	S	.	*	H	α-helix	trans	-65.1	-40.8	176.3	40.5	0	0	0	0	112.9	I6 L7 L12 L13 A14	I6-T10 PolarHBondContact O-N 3.45Å; I6-T10 PolarHBondContact O-OG1 2.96Å; I6-T10 VanDerWaalsContact O-OG1 3.04Å; L7-T10 WeakPolarHBondContact CA-OG1 3.23Å; L7-T10 PolarHBondContact O-N 3.32Å; L7-T10 PolarHBondContact O-OG1 2.97Å; T10-L12 VanDerWaalsContact C-N 3.32Å; T10-L12 PolarHBondContact O-N 3.46Å; T10-L13 PolarHBondContact O-N 3.26Å; T10-A14 PolarHBondContact O-N 3.41Å
11	L	68.6	Low	70.1	Confident	110 Å²	110	109.6 Å²	109.6	58%	0.576	59%	0.588	S	S	*	*	H	α-helix	trans	-62.9	-42.3	176.2	-113.8	81.3	0	0	0	110.9	L7 T8 A14 Q15	L7-L11 PolarHBondContact O-N 3.22Å; T8-L11 PolarHBondContact O-N 3.41Å; L11-A14 PolarHBondContact O-N 2.89Å; L11-Q15 WeakPolarHBondContact O-CG 2.87Å; L11-Q15 PolarHBondContact O-N 3.33Å; L11-Q15 PolarHBondContact O-NE2 3.06Å
12	L	67.1	Low	71.3	Confident	93 Å²	93	101.1 Å²	101.1	49%	0.487	55%	0.547	S	S	.	.	H	α-helix	trans	-61.4	-40.3	176.9	-81.9	157.5	0	0	0	112.3	T8 V9 T10 Q15 V16	T8-L12 WeakPolarHBondContact O-CB 3.38Å; T8-L12 WeakPolarHBondContact O-CD1 3.41Å; T8-L12 WeakPolarHBondContact O-CG 3.37Å; T8-L12 PolarHBondContact O-N 2.84Å; V9-L12 PolarHBondContact O-N 3.48Å; T10-L12 VanDerWaalsContact C-N 3.32Å; T10-L12 PolarHBondContact O-N 3.46Å; L12-Q15 WeakPolarHBondContact O-CG 3.43Å; L12-Q15 PolarHBondContact O-N 3.27Å; L12-V16 WeakPolarHBondContact O-CG2 3.02Å; L12-V16 PolarHBondContact O-N 3.21Å
13	L	62	Low	72.4	Confident	107 Å²	107	98.4 Å²	98.4	56%	0.56	53%	0.533	S	S	*	.	H	α-helix	trans	-66.6	-38.5	178.8	-71.2	164.3	0	0	0	112.4	V9 T10 Q15 V16 T17	V9-L13 HydrophobicContact CG1-CD1 4Å; V9-L13 WeakPolarHBondContact O-CG 3.33Å; V9-L13 PolarHBondContact O-N 3.27Å; T10-L13 PolarHBondContact O-N 3.26Å; L13-Q15 VanDerWaalsContact C-N 3.32Å; L13-Q15 PolarHBondContact O-N 3.03Å; L13-V16 PolarHBondContact O-N 3.35Å; L13-T17 PolarHBondContact O-N 3.46Å
14	A	62.8	Low	73.1	Confident	74 Å²	74	97 Å²	97	61%	0.612	53%	0.533	S	S	*	.	H	α-helix	trans	-66	-30	178.4	0	0	0	0	0	113.8	T10 L11 T17	T10-A14 PolarHBondContact O-N 3.41Å; L11-A14 PolarHBondContact O-N 2.89Å; A14-T17 PolarHBondContact O-OG1 2.99Å
15	Q	61.6	Low	73.7	Confident	132 Å²	132	96.6 Å²	96.6	62%	0.617	53%	0.532	S	S	*	.	H	α-helix	trans	-75.3	-32.8	175.6	-9.1	173.4	-21.7	0	0	111.7	L11 L12 L13	L11-Q15 WeakPolarHBondContact O-CG 2.87Å; L11-Q15 PolarHBondContact O-N 3.33Å; L11-Q15 PolarHBondContact O-NE2 3.06Å; L12-Q15 WeakPolarHBondContact O-CG 3.43Å; L12-Q15 PolarHBondContact O-N 3.27Å; L13-Q15 VanDerWaalsContact C-N 3.32Å; L13-Q15 PolarHBondContact O-N 3.03Å
16	V	56.1	Low	74.5	Confident	103 Å²	103	94.7 Å²	94.7	62%	0.624	52%	0.522	S	S	*	.	H	α-helix	trans	-89.2	-23.5	-168.5	178.6	0	0	0	0	112.1	L12 L13 P18	L12-V16 WeakPolarHBondContact O-CG2 3.02Å; L12-V16 PolarHBondContact O-N 3.21Å; L13-V16 PolarHBondContact O-N 3.35Å; V16-P18 WeakPolarHBondContact O-CD 3.17Å
17	T	59.2	Low	75.3	Confident	98 Å²	98	90.2 Å²	90.2	60%	0.601	50%	0.5	S	S	*	.	S	Bend	trans	-64.2	107.2	172.4	46.6	0	0	0	0	109.5	L13 A14 A19	L13-T17 PolarHBondContact O-N 3.46Å; A14-T17 PolarHBondContact O-OG1 2.99Å; T17-A19 PolarHBondContact O-N 2.83Å; T17-A19 VanDerWaalsContact O-N 3.11Å
18	P	61.4	Low	76.1	Confident	119 Å²	119	91.2 Å²	91.2	77%	0.773	50%	0.496	S	S	*	.			trans	-70.1	116.1	178.3	17.5	-7.9	0	0	0	106.9	V16 M20	V16-P18 WeakPolarHBondContact O-CD 3.17Å; P18-M20 PolarHBondContact O-N 3.38Å
19	A	70.6	Confident	76.9	Confident	43 Å²	43	88.1 Å²	88.1	36%	0.355	48%	0.478	S	S	.	.			trans	-55.9	112.3	174.1	0	0	0	0	0	108.4	T17 K21 R28	T17-A19 PolarHBondContact O-N 2.83Å; T17-A19 VanDerWaalsContact O-N 3.11Å; A19-K21 PolarHBondContact O-N 2.76Å; A19-K21 VanDerWaalsContact O-N 3.15Å; A19-R28 HydrophobicContact CB-CB 4.24Å; A19-R28 HydrophobicContact CB-CG 4.11Å
20	M	83.6	Confident	77.5	Confident	92 Å²	92	87.3 Å²	87.3	45%	0.453	47%	0.466	S	S	.	.			trans	-61.2	121.3	-176.1	-169	163.4	98.4	0	0	108.3	P18 C29 K44	P18-M20 PolarHBondContact O-N 3.38Å; M20-C29 HydrophobicContact CB-CB 4.1Å; M20-C29 WeakPolarHBondContact O-CB 3.14Å; M20-C29 PolarHBondContact O-N 2.04Å; M20-C29 PolarHBondContact O-SG 3.38Å; M20-C29 VanDerWaalsContact O-SG 3.41Å; M20-K44 HydrophobicContact CE-CB 4.44Å
21	K	89.4	Confident	78.3	Confident	130 Å²	130	92.2 Å²	92.2	57%	0.565	48%	0.484	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.8	145.4	-178.5	-65.9	-176.8	-176.6	178	0	110	A19 N25 G27	A19-K21 PolarHBondContact O-N 2.76Å; A19-K21 VanDerWaalsContact O-N 3.15Å; K21-N25 WeakPolarHBondContact CB-OD1 3.37Å; K21-N25 HydrophobicContact CD-CB 4.03Å; K21-N25 WeakPolarHBondContact CD-OD1 3.34Å; K21-G27 WeakPolarHBondContact CA-O 3.41Å
22	C	90.5	Very high	79.2	Confident	16 Å²	16	92 Å²	92	11%	0.108	49%	0.487	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137	174.8	176.4	63.1	0	0	0	0	109.8	N24 N25 L26 G27 C49	C22-N24 PolarHBondContact O-N 3.24Å; C22-N25 PolarHBondContact O-N 3.4Å; C22-N25 VanDerWaalsContact O-N 3.14Å; C22-L26 PolarHBondContact O-N 3.3Å; C22-G27 PolarHBondContact N-O 3.18Å; C22-G27 PolarHBondContact O-N 3.42Å; C22-C49 HydrophobicContact CB-CB 3.84Å; C22-C49 WeakPolarHBondContact CB-SG 3.13Å; C22-C49 WeakPolarHBondContact SG-CA 3.43Å; C22-C49 WeakPolarHBondContact SG-CB 3.38Å; C22-C49 CovalentContact SG-SG 2.02Å; C22-C49 PolarHBondContact SG-SG 3.2Å
23	W	90.1	Very high	80.4	Confident	108 Å²	108	89 Å²	89	41%	0.409	47%	0.473	S	S	.	.	T	Hydrogen-bonded Turn	trans	48.5	59.9	179.3	-163.3	-112.6	0	0	0	113.5	N25 L26 H40 I51	W23-N25 VanDerWaalsContact C-N 3.25Å; W23-N25 PolarHBondContact O-N 3.47Å; W23-N25 VanDerWaalsContact O-N 3.17Å; W23-L26 VanDerWaalsContact O-CB 3.26Å; W23-L26 WeakPolarHBondContact O-CB 2.95Å; W23-L26 WeakPolarHBondContact O-CG 3.11Å; W23-L26 PolarHBondContact O-N 3.03Å; W23-H40 AromaticContact CD2-CD2 3.68Å; W23-H40 AromaticContact CD2-NE2 3.6Å; W23-H40 AromaticContact CE2-NE2 3.71Å; W23-H40 AromaticContact CE3-CD2 3.39Å; W23-H40 AromaticContact CE3-NE2 3.22Å; W23-H40 AromaticContact CH2-CE1 3.8Å; W23-H40 AromaticContact CH2-NE2 3.13Å; W23-H40 WeakPolarHBondContact CH2-NE2 3.1Å; W23-H40 AromaticContact CZ2-CE1 3.88Å; W23-H40 AromaticContact CZ2-NE2 3.51Å; W23-H40 AromaticContact CZ3-CD2 3.66Å; W23-H40 AromaticContact CZ3-NE2 2.98Å; W23-H40 WeakPolarHBondContact CZ3-NE2 3.43Å; W23-I51 HydrophobicContact CB-CD1 3.51Å; W23-I51 HydrophobicContact CB-CG1 4.12Å; W23-I51 VanDerWaalsContact CD1-CD1 3.42Å; W23-I51 HydrophobicContact CD2-CD1 4.01Å; W23-I51 HydrophobicContact CG-CD1 3.35Å; W23-I51 HydrophobicContact CG-CG1 4.37Å
24	N	89.3	Confident	81.7	Confident	149 Å²	149	88.6 Å²	88.6	80%	0.797	47%	0.469	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.8	41.1	-178.5	-159.7	28.2	0	0	0	114.2	C22 L26	C22-N24 PolarHBondContact O-N 3.24Å; N24-L26 VanDerWaalsContact C-N 3.26Å; N24-L26 PolarHBondContact O-N 2.82Å
25	N	87.9	Confident	83	Confident	107 Å²	107	94.6 Å²	94.6	57%	0.572	48%	0.484	S	S	*	.	T	Hydrogen-bonded Turn	trans	70	8	-177	-56	-54.7	0	0	0	116.6	K21 C22 W23	K21-N25 WeakPolarHBondContact CB-OD1 3.37Å; K21-N25 HydrophobicContact CD-CB 4.03Å; K21-N25 WeakPolarHBondContact CD-OD1 3.34Å; C22-N25 PolarHBondContact O-N 3.4Å; C22-N25 VanDerWaalsContact O-N 3.14Å; W23-N25 VanDerWaalsContact C-N 3.25Å; W23-N25 PolarHBondContact O-N 3.47Å; W23-N25 VanDerWaalsContact O-N 3.17Å
26	L	89.8	Confident	84.3	Confident	74 Å²	74	94.4 Å²	94.4	39%	0.387	49%	0.487	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.5	-14.9	176.1	-58.9	170.9	0	0	0	112.7	C22 W23 N24 H55	C22-L26 PolarHBondContact O-N 3.3Å; W23-L26 VanDerWaalsContact O-CB 3.26Å; W23-L26 WeakPolarHBondContact O-CB 2.95Å; W23-L26 WeakPolarHBondContact O-CG 3.11Å; W23-L26 PolarHBondContact O-N 3.03Å; N24-L26 VanDerWaalsContact C-N 3.26Å; N24-L26 PolarHBondContact O-N 2.82Å; L26-H55 HydrophobicContact CB-CB 4.27Å; L26-H55 HydrophobicContact CD1-CB 4.35Å; L26-H55 HydrophobicContact CD2-CB 4.4Å
27	G	91.8	Very high	86.1	Confident	4 Å²	4	91.3 Å²	91.3	4%	0.041	47%	0.466	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	169.4	178.4	0	0	0	0	0	113.7	K21 C22 C50	K21-G27 WeakPolarHBondContact CA-O 3.41Å; C22-G27 PolarHBondContact N-O 3.18Å; C22-G27 PolarHBondContact O-N 3.42Å; G27-C50 CarbonylContact C-O 3.54Å; G27-C50 WeakPolarHBondContact CA-O 3.47Å
28	R	91.5	Very high	87.7	Confident	126 Å²	126	89.5 Å²	89.5	48%	0.475	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	138	173.2	-71.9	178.1	179.7	-173.7	0.4	110.1	A19 C50	A19-R28 HydrophobicContact CB-CB 4.24Å; A19-R28 HydrophobicContact CB-CG 4.11Å; R28-C50 PolarHBondContact N-O 2.02Å; R28-C50 PolarHBondContact O-N 3.38Å
29	C	91.3	Very high	89.2	Confident	11 Å²	11	89.1 Å²	89.1	7%	0.074	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.2	125.5	170.6	-59.9	0	0	0	0	109.5	M20 C43 M48	M20-C29 HydrophobicContact CB-CB 4.1Å; M20-C29 WeakPolarHBondContact O-CB 3.14Å; M20-C29 PolarHBondContact O-N 2.04Å; M20-C29 PolarHBondContact O-SG 3.38Å; M20-C29 VanDerWaalsContact O-SG 3.41Å; C29-C43 HydrophobicContact CB-CB 3.75Å; C29-C43 WeakPolarHBondContact CB-SG 3.02Å; C29-C43 WeakPolarHBondContact SG-CB 3.45Å; C29-C43 CovalentContact SG-SG 2.03Å; C29-C43 PolarHBondContact SG-SG 2.78Å; C29-M48 CarbonylContact C-O 3.55Å; C29-M48 VanDerWaalsContact CA-O 3.28Å; C29-M48 WeakPolarHBondContact CA-O 3.43Å
30	R	89.6	Confident	90.1	Very high	65 Å²	65	90 Å²	90	25%	0.245	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.5	159.7	179.2	-58.6	176.3	-175.6	-102.2	14.4	109.3	T32 E34 E37 G47 M48	R30-T32 VanDerWaalsContact C-N 3.28Å; R30-T32 WeakPolarHBondContact CB-O 3.49Å; R30-E34 IonicContact CZ-OE1 3.89Å; R30-E34 IonicContact NE-OE1 3.06Å; R30-E34 IonicContact NH1-OE1 3.78Å; R30-E34 PolarHBondContact NH1-OE1 2.87Å; R30-E34 IonicContact NH2-OE1 2.76Å; R30-E34 PolarHBondContact NH2-OE1 2.95Å; R30-E37 WeakPolarHBondContact CD-OE2 3.49Å; R30-E37 IonicContact CZ-OE1 2.83Å; R30-E37 IonicContact CZ-OE2 3.78Å; R30-E37 IonicContact NE-OE1 3.99Å; R30-E37 PolarHBondContact NE-OE1 3.32Å; R30-E37 IonicContact NE-OE2 3.46Å; R30-E37 PolarHBondContact NE-OE2 3.05Å; R30-E37 IonicContact NH2-OE1 3.01Å; R30-E37 PolarHBondContact NH2-OE1 2.95Å; R30-E37 IonicContact NH2-OE2 3.21Å; R30-G47 CarbonylContact O-C 3.59Å; R30-G47 WeakPolarHBondContact O-CA 3.32Å; R30-M48 PolarHBondContact N-O 2.78Å; R30-M48 WeakPolarHBondContact O-CA 3.1Å; R30-M48 WeakPolarHBondContact O-CB 3Å; R30-M48 PolarHBondContact O-N 2.99Å
31	E	89.6	Confident	90.5	Very high	176 Å²	176	89.5 Å²	89.5	82%	0.822	44%	0.436	S	S	*	.	S	Bend	trans	-67.4	-33.7	170.8	-68.1	-179.4	172.3	0	0	111.8
32	T	89.3	Confident	90.7	Very high	106 Å²	106	89.8 Å²	89.8	65%	0.65	44%	0.441	S	S	*	.	S	Bend	trans	-143	138.8	177	-53.8	0	0	0	0	109	R30	R30-T32 VanDerWaalsContact C-N 3.28Å; R30-T32 WeakPolarHBondContact CB-O 3.49Å
33	C	90.4	Very high	90.7	Very high	28 Å²	28	89.8 Å²	89.8	19%	0.189	44%	0.441	C	S	.	.			trans	-72.2	146.7	177.2	-60.1	0	0	0	0	111.7	E37 C50	C33-E37 HydrophobicContact CB-CB 4.08Å; C33-C50 WeakPolarHBondContact CA-SG 3.03Å; C33-C50 HydrophobicContact CB-CB 3.7Å; C33-C50 WeakPolarHBondContact CB-SG 3.28Å; C33-C50 VanDerWaalsContact SG-CA 3.55Å; C33-C50 WeakPolarHBondContact SG-CB 3.48Å; C33-C50 CovalentContact SG-SG 2.04Å; C33-C50 PolarHBondContact SG-SG 3.42Å
34	E	90.6	Very high	90.5	Very high	100 Å²	100	94.3 Å²	94.3	47%	0.467	46%	0.463	S	S	.	.			trans	-68.5	159.5	171.6	-65.3	179.2	-163.4	0	0	110.3	R30 N36 E37	R30-E34 IonicContact CZ-OE1 3.89Å; R30-E34 IonicContact NE-OE1 3.06Å; R30-E34 IonicContact NH1-OE1 3.78Å; R30-E34 PolarHBondContact NH1-OE1 2.87Å; R30-E34 IonicContact NH2-OE1 2.76Å; R30-E34 PolarHBondContact NH2-OE1 2.95Å; E34-N36 PolarHBondContact O-N 3.23Å; E34-E37 HydrophobicContact CB-CG 4.24Å; E34-E37 PolarHBondContact N-OE2 3.23Å; E34-E37 PolarHBondContact O-N 2.68Å
35	Q	90	Very high	90.2	Very high	200 Å²	200	91.7 Å²	91.7	94%	0.935	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.5	-24.5	-177.6	-69.4	177.2	-46	0	0	114
36	N	89.1	Confident	90	Very high	128 Å²	128	95 Å²	95	68%	0.684	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.1	13.8	179.8	-62.1	-47.1	0	0	0	113	E34 P53	E34-N36 PolarHBondContact O-N 3.23Å; N36-P53 WeakPolarHBondContact O-CD 3.48Å
37	E	92.6	Very high	90	Very high	37 Å²	37	91.7 Å²	91.7	17%	0.173	45%	0.445	C	S	.	.			trans	-118.1	153.1	175.1	-66.5	177.2	154.1	0	0	109.5	R30 C33 E34 C50 I51	R30-E37 WeakPolarHBondContact CD-OE2 3.49Å; R30-E37 IonicContact CZ-OE1 2.83Å; R30-E37 IonicContact CZ-OE2 3.78Å; R30-E37 IonicContact NE-OE1 3.99Å; R30-E37 PolarHBondContact NE-OE1 3.32Å; R30-E37 IonicContact NE-OE2 3.46Å; R30-E37 PolarHBondContact NE-OE2 3.05Å; R30-E37 IonicContact NH2-OE1 3.01Å; R30-E37 PolarHBondContact NH2-OE1 2.95Å; R30-E37 IonicContact NH2-OE2 3.21Å; C33-E37 HydrophobicContact CB-CB 4.08Å; E34-E37 HydrophobicContact CB-CG 4.24Å; E34-E37 PolarHBondContact N-OE2 3.23Å; E34-E37 PolarHBondContact O-N 2.68Å; E37-C50 HydrophobicContact CB-CB 3.93Å; E37-C50 HydrophobicContact CG-CB 4.36Å; E37-C50 WeakPolarHBondContact OE2-CB 3.11Å; E37-I51 CarbonylContact C-O 3.52Å; E37-I51 WeakPolarHBondContact CA-O 3.41Å
38	V	92.7	Very high	90	Very high	61 Å²	61	94.9 Å²	94.9	37%	0.37	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	139.3	175.1	-120.7	0	0	0	0	109	H40 I51 P53 L56	V38-H40 PolarHBondContact O-N 2.92Å; V38-I51 WeakPolarHBondContact CG2-O 3.06Å; V38-I51 PolarHBondContact N-O 2.95Å; V38-I51 PolarHBondContact O-N 2.88Å; V38-P53 HydrophobicContact CG2-CB 4.09Å; V38-P53 HydrophobicContact CG2-CG 3.79Å; V38-L56 HydrophobicContact CB-CD1 4.31Å; V38-L56 HydrophobicContact CG2-CD1 3.58Å
39	F	93	Very high	90.1	Very high	111 Å²	111	88.9 Å²	88.9	49%	0.487	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.7	130.7	168.2	171.5	-102.2	0	0	0	109.7	I41 M48	F39-I41 VanDerWaalsContact CE2-C 3.46Å; F39-I41 VanDerWaalsContact CE2-O 3.32Å; F39-I41 WeakPolarHBondContact CE2-O 3.03Å; F39-M48 HydrophobicContact CD2-CB 3.77Å; F39-M48 HydrophobicContact CD2-CG 3.79Å; F39-M48 HydrophobicContact CD2-SD 4.27Å; F39-M48 HydrophobicContact CE2-CB 4.17Å; F39-M48 HydrophobicContact CE2-CG 4.02Å
40	H	90.6	Very high	90.2	Very high	62 Å²	62	88.4 Å²	88.4	29%	0.287	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	-55.8	178.2	-169.6	67.6	0	0	0	113	W23 V38 C49 I51	W23-H40 AromaticContact CD2-CD2 3.68Å; W23-H40 AromaticContact CD2-NE2 3.6Å; W23-H40 AromaticContact CE2-NE2 3.71Å; W23-H40 AromaticContact CE3-CD2 3.39Å; W23-H40 AromaticContact CE3-NE2 3.22Å; W23-H40 AromaticContact CH2-CE1 3.8Å; W23-H40 AromaticContact CH2-NE2 3.13Å; W23-H40 WeakPolarHBondContact CH2-NE2 3.1Å; W23-H40 AromaticContact CZ2-CE1 3.88Å; W23-H40 AromaticContact CZ2-NE2 3.51Å; W23-H40 AromaticContact CZ3-CD2 3.66Å; W23-H40 AromaticContact CZ3-NE2 2.98Å; W23-H40 WeakPolarHBondContact CZ3-NE2 3.43Å; V38-H40 PolarHBondContact O-N 2.92Å; H40-C49 PolarHBondContact N-O 3.08Å; H40-I51 HydrophobicContact CB-CD1 3.29Å; H40-I51 HydrophobicContact CB-CG1 3.99Å
41	I	91.9	Very high	90.4	Very high	81 Å²	81	85.3 Å²	85.3	42%	0.415	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.9	164.3	179	59.3	172	0	0	0	110.6	F39 C49	F39-I41 VanDerWaalsContact CE2-C 3.46Å; F39-I41 VanDerWaalsContact CE2-O 3.32Å; F39-I41 WeakPolarHBondContact CE2-O 3.03Å; I41-C49 HydrophobicContact CG1-CB 3.64Å; I41-C49 WeakPolarHBondContact O-CA 3.14Å; I41-C49 WeakPolarHBondContact O-CB 2.98Å; I41-C49 PolarHBondContact O-N 2.03Å
42	M	92.4	Very high	90.5	Very high	135 Å²	135	78.4 Å²	78.4	67%	0.665	39%	0.394	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80	137	170.7	-147.5	122.1	73.8	0	0	110.6	G47	M42-G47 CarbonylContact C-O 3.47Å
43	C	90.4	Very high	90.4	Very high	16 Å²	16	76.7 Å²	76.7	11%	0.108	38%	0.384	C	S	.	.			trans	-81.5	163.5	172.8	-67.4	0	0	0	0	111.1	C29 N45 E46 G47	C29-C43 HydrophobicContact CB-CB 3.75Å; C29-C43 WeakPolarHBondContact CB-SG 3.02Å; C29-C43 WeakPolarHBondContact SG-CB 3.45Å; C29-C43 CovalentContact SG-SG 2.03Å; C29-C43 PolarHBondContact SG-SG 2.78Å; C43-N45 WeakPolarHBondContact CB-OD1 3.4Å; C43-N45 PolarHBondContact O-N 3.15Å; C43-E46 PolarHBondContact O-N 2.95Å; C43-E46 VanDerWaalsContact O-N 3.08Å; C43-G47 WeakPolarHBondContact CB-O 3.01Å; C43-G47 PolarHBondContact N-O 3.11Å
44	K	85.8	Confident	90.2	Very high	204 Å²	204	84.4 Å²	84.4	89%	0.887	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63	-22.9	179.3	-68.3	-174.1	177.5	-176.8	0	113.9	M20 E46	M20-K44 HydrophobicContact CE-CB 4.44Å; K44-E46 VanDerWaalsContact C-N 3.25Å
45	N	84	Confident	89.8	Confident	94 Å²	94	84.2 Å²	84.2	50%	0.503	41%	0.414	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92	22.1	177.1	69.9	-30.4	0	0	0	112.3	C43 G47	C43-N45 WeakPolarHBondContact CB-OD1 3.4Å; C43-N45 PolarHBondContact O-N 3.15Å; N45-G47 PolarHBondContact O-N 3.11Å; N45-G47 PolarHBondContact OD1-N 2.94Å
46	E	83.9	Confident	89.3	Confident	175 Å²	175	77.1 Å²	77.1	82%	0.818	38%	0.382	S	S	*	.	S	Bend	trans	63.3	4.1	-177.7	-55	176.4	177.2	0	0	114.5	C43 K44	C43-E46 PolarHBondContact O-N 2.95Å; C43-E46 VanDerWaalsContact O-N 3.08Å; K44-E46 VanDerWaalsContact C-N 3.25Å
47	G	90	Very high	88.7	Confident	5 Å²	5	76.5 Å²	76.5	5%	0.052	39%	0.385	C	S	.	.			trans	-74.4	163.1	171.2	0	0	0	0	0	112.7	R30 M42 C43 N45	R30-G47 CarbonylContact O-C 3.59Å; R30-G47 WeakPolarHBondContact O-CA 3.32Å; M42-G47 CarbonylContact C-O 3.47Å; C43-G47 WeakPolarHBondContact CB-O 3.01Å; C43-G47 PolarHBondContact N-O 3.11Å; N45-G47 PolarHBondContact O-N 3.11Å; N45-G47 PolarHBondContact OD1-N 2.94Å
48	M	92.4	Very high	87.5	Confident	72 Å²	72	79.2 Å²	79.2	36%	0.355	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.1	127.5	170.8	-66	-176.8	-162.8	0	0	110.7	C29 R30 F39 C50	C29-M48 CarbonylContact C-O 3.55Å; C29-M48 VanDerWaalsContact CA-O 3.28Å; C29-M48 WeakPolarHBondContact CA-O 3.43Å; R30-M48 PolarHBondContact N-O 2.78Å; R30-M48 WeakPolarHBondContact O-CA 3.1Å; R30-M48 WeakPolarHBondContact O-CB 3Å; R30-M48 PolarHBondContact O-N 2.99Å; F39-M48 HydrophobicContact CD2-CB 3.77Å; F39-M48 HydrophobicContact CD2-CG 3.79Å; F39-M48 HydrophobicContact CD2-SD 4.27Å; F39-M48 HydrophobicContact CE2-CB 4.17Å; F39-M48 HydrophobicContact CE2-CG 4.02Å; M48-C50 PolarHBondContact O-N 2.73Å; M48-C50 PolarHBondContact O-SG 3.14Å; M48-C50 VanDerWaalsContact O-SG 3.38Å
49	C	92.9	Very high	86	Confident	0 Å²	0	88.6 Å²	88.6	0%	0	44%	0.442	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.6	105.6	165.5	-179.8	0	0	0	0	108.8	C22 H40 I41	C22-C49 HydrophobicContact CB-CB 3.84Å; C22-C49 WeakPolarHBondContact CB-SG 3.13Å; C22-C49 WeakPolarHBondContact SG-CA 3.43Å; C22-C49 WeakPolarHBondContact SG-CB 3.38Å; C22-C49 CovalentContact SG-SG 2.02Å; C22-C49 PolarHBondContact SG-SG 3.2Å; H40-C49 PolarHBondContact N-O 3.08Å; I41-C49 HydrophobicContact CG1-CB 3.64Å; I41-C49 WeakPolarHBondContact O-CA 3.14Å; I41-C49 WeakPolarHBondContact O-CB 2.98Å; I41-C49 PolarHBondContact O-N 2.03Å
50	C	93.5	Very high	83.8	Confident	0 Å²	0	94 Å²	94	0%	0	48%	0.476	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	125.8	-177.4	-55.9	0	0	0	0	109.5	G27 R28 C33 E37 M48	G27-C50 CarbonylContact C-O 3.54Å; G27-C50 WeakPolarHBondContact CA-O 3.47Å; R28-C50 PolarHBondContact N-O 2.02Å; R28-C50 PolarHBondContact O-N 3.38Å; C33-C50 WeakPolarHBondContact CA-SG 3.03Å; C33-C50 HydrophobicContact CB-CB 3.7Å; C33-C50 WeakPolarHBondContact CB-SG 3.28Å; C33-C50 VanDerWaalsContact SG-CA 3.55Å; C33-C50 WeakPolarHBondContact SG-CB 3.48Å; C33-C50 CovalentContact SG-SG 2.04Å; C33-C50 PolarHBondContact SG-SG 3.42Å; E37-C50 HydrophobicContact CB-CB 3.93Å; E37-C50 HydrophobicContact CG-CB 4.36Å; E37-C50 WeakPolarHBondContact OE2-CB 3.11Å; M48-C50 PolarHBondContact O-N 2.73Å; M48-C50 PolarHBondContact O-SG 3.14Å; M48-C50 VanDerWaalsContact O-SG 3.38Å
51	I	92.9	Very high	83.4	Confident	0 Å²	0	95.6 Å²	95.6	0%	0	49%	0.486	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.1	139.8	-174.9	-53.2	172.9	0	0	0	108.4	W23 E37 V38 H40 H55 L56	W23-I51 HydrophobicContact CB-CD1 3.51Å; W23-I51 HydrophobicContact CB-CG1 4.12Å; W23-I51 VanDerWaalsContact CD1-CD1 3.42Å; W23-I51 HydrophobicContact CD2-CD1 4.01Å; W23-I51 HydrophobicContact CG-CD1 3.35Å; W23-I51 HydrophobicContact CG-CG1 4.37Å; E37-I51 CarbonylContact C-O 3.52Å; E37-I51 WeakPolarHBondContact CA-O 3.41Å; V38-I51 WeakPolarHBondContact CG2-O 3.06Å; V38-I51 PolarHBondContact N-O 2.95Å; V38-I51 PolarHBondContact O-N 2.88Å; H40-I51 HydrophobicContact CB-CD1 3.29Å; H40-I51 HydrophobicContact CB-CG1 3.99Å; I51-H55 HydrophobicContact CG2-CB 4.07Å; I51-L56 HydrophobicContact CD1-CD2 4.3Å; I51-L56 HydrophobicContact CG2-CD2 4.29Å; I51-L56 HydrophobicContact CG2-CG 4.45Å
52	S	91.5	Very high	83	Confident	32 Å²	32	96.3 Å²	96.3	22%	0.224	49%	0.489	C	S	.	.			trans	-66.4	132.5	170.7	-177.4	0	0	0	0	110.2	K54 H55	S52-K54 PolarHBondContact O-N 2.96Å; S52-H55 PolarHBondContact O-N 3.04Å
53	P	88.3	Confident	82.4	Confident	70 Å²	70	94.2 Å²	94.2	46%	0.455	48%	0.479	S	S	.	.	G	3₁₀ helix	trans	-51.8	-27.5	178.9	-16.5	17.3	0	0	0	113.7	N36 V38 H55 L56	N36-P53 WeakPolarHBondContact O-CD 3.48Å; V38-P53 HydrophobicContact CG2-CB 4.09Å; V38-P53 HydrophobicContact CG2-CG 3.79Å; P53-H55 PolarHBondContact O-N 3.38Å; P53-L56 WeakPolarHBondContact O-CB 3.26Å; P53-L56 PolarHBondContact O-N 3.41Å
54	K	86.4	Confident	82	Confident	190 Å²	190	98.8 Å²	98.8	83%	0.826	50%	0.501	S	S	*	.	G	3₁₀ helix	trans	-61.4	-24.7	178.3	-60.7	-179.3	-177.9	179.4	0	113.9	S52	S52-K54 PolarHBondContact O-N 2.96Å
55	H	81.9	Confident	81.7	Confident	96 Å²	96	92.2 Å²	92.2	44%	0.444	48%	0.477	S	S	.	.	G	3₁₀ helix	trans	-94	-5.8	178.1	-55.9	108.4	0	0	0	112.6	L26 I51 S52 P53	L26-H55 HydrophobicContact CB-CB 4.27Å; L26-H55 HydrophobicContact CD1-CB 4.35Å; L26-H55 HydrophobicContact CD2-CB 4.4Å; I51-H55 HydrophobicContact CG2-CB 4.07Å; S52-H55 PolarHBondContact O-N 3.04Å; P53-H55 PolarHBondContact O-N 3.38Å
56	L	78.8	Confident	81.6	Confident	51 Å²	51	92.1 Å²	92.1	27%	0.267	48%	0.476	S	S	.	.	S	Bend	trans	-86.6	137.4	173.4	-62.6	177.8	0	0	0	108.7	V38 I51 P53 A58	V38-L56 HydrophobicContact CB-CD1 4.31Å; V38-L56 HydrophobicContact CG2-CD1 3.58Å; I51-L56 HydrophobicContact CD1-CD2 4.3Å; I51-L56 HydrophobicContact CG2-CD2 4.29Å; I51-L56 HydrophobicContact CG2-CG 4.45Å; P53-L56 WeakPolarHBondContact O-CB 3.26Å; P53-L56 PolarHBondContact O-N 3.41Å; L56-A58 PolarHBondContact O-N 3.34Å
57	P	77.1	Confident	81.4	Confident	114 Å²	114	86.1 Å²	86.1	74%	0.74	45%	0.451	S	S	*	.	P	Polyproline II helix	trans	-59.3	135.4	172.1	23.9	-30.4	0	0	0	109	R59	P57-R59 PolarHBondContact O-N 3.17Å; P57-R59 VanDerWaalsContact O-N 3.11Å
58	A	67.9	Low	80.7	Confident	95 Å²	95	92.4 Å²	92.4	79%	0.785	48%	0.482	S	S	*	.	P	Polyproline II helix	trans	-56.5	120.4	169.6	0	0	0	0	0	107.5	L56 N60	L56-A58 PolarHBondContact O-N 3.34Å; A58-N60 PolarHBondContact O-N 2.95Å
59	R	60.1	Low	79.8	Confident	257 Å²	257	94.1 Å²	94.1	97%	0.97	49%	0.492	S	S	*	.			trans	-62	105.1	166.3	-102.9	-170	177.8	178	0	106.1	P57	P57-R59 PolarHBondContact O-N 3.17Å; P57-R59 VanDerWaalsContact O-N 3.11Å
60	N	45.9	Very low	78.6	Confident	224 Å²	224	102.6 Å²	102.6	100%	1.198	54%	0.537	S	S	*	.			trans	-89	0	168.9	-163.3	82.9	0	0	0	109.7	A58	A58-N60 PolarHBondContact O-N 2.95Å

Retrieved 60 of 60 residues in 16.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).