A0A059XI04_HUMAN Loading...

Rhesus blood group D antigen

AlphaFold DB , UniProt , Accession A0A059XI04, Species HUMAN (Homo sapiens, Human), Gene RHD, Length 49 aa.

						>A0A059XI04_HUMAN|A0A059XI04|RHD
MSSKYPRSVRRCLPLWALTLEAALILLFYFLTHYDASLEDQKGLVASYQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.1	Low	58.9	Low	245 Å²	245	155.7 Å²	155.7	100%	1.207	74%	0.743	S	S	*	*				0	88.3	0	-71.3	135.9	92.6	0	0	108.9	S3	M1-S3 PolarHBondContact O-N 3.36Å
2	S	57.4	Low	59.3	Low	117 Å²	117	149.4 Å²	149.4	82%	0.818	73%	0.726	S	S	*	*			trans	-86.2	101.2	-179.9	-178.3	0	0	0	0	108.9	K4	S2-K4 PolarHBondContact O-N 3.04Å
3	S	55.7	Low	59.9	Low	87 Å²	87	146.7 Å²	146.7	61%	0.608	72%	0.716	S	S	*	*			trans	-59.8	100.8	170.7	178.7	0	0	0	0	108.9	M1 Y5	M1-S3 PolarHBondContact O-N 3.36Å; S3-Y5 PolarHBondContact O-N 2.94Å
4	K	60.8	Low	61	Low	193 Å²	193	140.6 Å²	140.6	84%	0.839	69%	0.694	S	S	*	*			trans	-70.4	94.1	169.9	-91.9	172.6	173.5	170.4	0	107.1	S2 P6	S2-K4 PolarHBondContact O-N 3.04Å; K4-P6 WeakPolarHBondContact O-CD 3.46Å
5	Y	62	Low	62.2	Low	196 Å²	196	138.7 Å²	138.7	77%	0.769	69%	0.686	S	S	*	*			trans	-54.5	122.9	166.2	-76.7	-87.5	0	0	0	108.6	S3 R7	S3-Y5 PolarHBondContact O-N 2.94Å; Y5-R7 PolarHBondContact O-N 3.21Å
6	P	63.9	Low	63.6	Low	77 Å²	77	141.3 Å²	141.3	50%	0.5	69%	0.686	S	S	.	*			trans	-63.3	126.9	-173.3	11.6	-15.6	0	0	0	109.5	K4 S8 V9	K4-P6 WeakPolarHBondContact O-CD 3.46Å; P6-S8 PolarHBondContact O-N 3.07Å; P6-V9 HydrophobicContact CB-CG2 4.18Å; P6-V9 HydrophobicContact CG-CG2 3.63Å; P6-V9 VanDerWaalsContact O-CG2 3.23Å; P6-V9 WeakPolarHBondContact O-CG2 3.23Å; P6-V9 PolarHBondContact O-N 2.96Å; P6-V9 VanDerWaalsContact O-N 3.07Å
7	R	58.7	Low	64.9	Low	231 Å²	231	136 Å²	136	87%	0.872	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.8	-14	-178.2	-150.8	168.8	-175.1	162.4	-0.2	112.5	Y5	Y5-R7 PolarHBondContact O-N 3.21Å
8	S	58.7	Low	66.1	Low	78 Å²	78	134.6 Å²	134.6	55%	0.545	67%	0.665	S	S	.	*	T	Hydrogen-bonded Turn	trans	-69.4	-35.9	174.5	62.9	0	0	0	0	113.5	P6 R10 R11 C12	P6-S8 PolarHBondContact O-N 3.07Å; S8-R10 VanDerWaalsContact C-N 3.27Å; S8-R10 PolarHBondContact O-N 3.44Å; S8-R11 PolarHBondContact O-N 3.1Å; S8-C12 PolarHBondContact O-N 3.2Å; S8-C12 VanDerWaalsContact O-N 3.11Å
9	V	57.9	Low	67.4	Low	73 Å²	73	132.7 Å²	132.7	44%	0.442	66%	0.662	S	S	.	*	H	α-helix	trans	-66.5	-35.7	-178.4	-135.8	0	0	0	0	110.6	P6 R11 L13	P6-V9 HydrophobicContact CB-CG2 4.18Å; P6-V9 HydrophobicContact CG-CG2 3.63Å; P6-V9 VanDerWaalsContact O-CG2 3.23Å; P6-V9 WeakPolarHBondContact O-CG2 3.23Å; P6-V9 PolarHBondContact O-N 2.96Å; P6-V9 VanDerWaalsContact O-N 3.07Å; V9-R11 PolarHBondContact O-N 2.89Å; V9-L13 HydrophobicContact CG1-CD1 4.5Å; V9-L13 WeakPolarHBondContact O-CB 3.31Å; V9-L13 VanDerWaalsContact O-CD1 3.28Å; V9-L13 WeakPolarHBondContact O-CD1 3.24Å; V9-L13 VanDerWaalsContact O-CG 3.24Å; V9-L13 WeakPolarHBondContact O-CG 3.28Å; V9-L13 PolarHBondContact O-N 3.35Å; V9-L13 VanDerWaalsContact O-N 3.1Å
10	R	61.4	Low	68.7	Low	213 Å²	213	130.3 Å²	130.3	80%	0.804	65%	0.651	S	S	*	*	H	α-helix	trans	-64.4	-17	174.7	-85.9	-174.2	176.9	-161.9	-0.2	114.5	S8 P14	S8-R10 VanDerWaalsContact C-N 3.27Å; S8-R10 PolarHBondContact O-N 3.44Å; R10-P14 WeakPolarHBondContact O-CD 3.33Å; R10-P14 WeakPolarHBondContact O-CG 2.97Å
11	R	61.1	Low	69.9	Low	203 Å²	203	129.6 Å²	129.6	77%	0.766	65%	0.646	S	S	*	*	H	α-helix	trans	-104.7	-28.8	-179.5	-132.9	-176.6	-165.4	171	2.5	113.3	S8 V9 P14	S8-R11 PolarHBondContact O-N 3.1Å; V9-R11 PolarHBondContact O-N 2.89Å; R11-P14 VanDerWaalsContact C-CD 3.5Å; R11-P14 WeakPolarHBondContact O-CD 3.3Å; R11-P14 VanDerWaalsContact O-CG 3.29Å; R11-P14 WeakPolarHBondContact O-CG 3.35Å
12	C	63.3	Low	72	Confident	80 Å²	80	120.3 Å²	120.3	54%	0.541	61%	0.609	S	S	.	*	H	α-helix	trans	-72.6	-36.6	169.3	-84.3	0	0	0	0	112.4	S8 L15 W16	S8-C12 PolarHBondContact O-N 3.2Å; S8-C12 VanDerWaalsContact O-N 3.11Å; C12-L15 PolarHBondContact O-N 3.05Å; C12-W16 PolarHBondContact O-N 2.89Å
13	L	68.1	Low	73.8	Confident	114 Å²	114	117.3 Å²	117.3	60%	0.597	59%	0.591	S	S	*	*	H	α-helix	trans	-53.6	-49.4	176.2	-81.7	162.6	0	0	0	113.7	V9 W16 A17	V9-L13 HydrophobicContact CG1-CD1 4.5Å; V9-L13 WeakPolarHBondContact O-CB 3.31Å; V9-L13 VanDerWaalsContact O-CD1 3.28Å; V9-L13 WeakPolarHBondContact O-CD1 3.24Å; V9-L13 VanDerWaalsContact O-CG 3.24Å; V9-L13 WeakPolarHBondContact O-CG 3.28Å; V9-L13 PolarHBondContact O-N 3.35Å; V9-L13 VanDerWaalsContact O-N 3.1Å; L13-W16 PolarHBondContact O-N 3.26Å; L13-A17 VanDerWaalsContact O-CB 3.31Å; L13-A17 WeakPolarHBondContact O-CB 3.35Å; L13-A17 PolarHBondContact O-N 2.97Å
14	P	74.6	Confident	75.6	Confident	62 Å²	62	118 Å²	118	40%	0.403	59%	0.587	S	S	.	*	H	α-helix	trans	-69.1	-33	178.8	23.1	-32.9	0	0	0	113.1	R10 R11 A17 L18	R10-P14 WeakPolarHBondContact O-CD 3.33Å; R10-P14 WeakPolarHBondContact O-CG 2.97Å; R11-P14 VanDerWaalsContact C-CD 3.5Å; R11-P14 WeakPolarHBondContact O-CD 3.3Å; R11-P14 VanDerWaalsContact O-CG 3.29Å; R11-P14 WeakPolarHBondContact O-CG 3.35Å; P14-A17 PolarHBondContact O-N 3.4Å; P14-L18 VanDerWaalsContact O-CG 3.3Å; P14-L18 WeakPolarHBondContact O-CG 3.34Å; P14-L18 PolarHBondContact O-N 3.11Å
15	L	79.6	Confident	77.2	Confident	111 Å²	111	114 Å²	114	58%	0.581	57%	0.573	S	S	*	*	H	α-helix	trans	-66.4	-44	174.8	-82.4	163.8	0	0	0	111.5	C12 A17 L18 T19	C12-L15 PolarHBondContact O-N 3.05Å; L15-A17 VanDerWaalsContact C-N 3.32Å; L15-L18 PolarHBondContact O-N 3.41Å; L15-T19 PolarHBondContact O-N 2.99Å; L15-T19 VanDerWaalsContact O-N 3.11Å; L15-T19 PolarHBondContact O-OG1 2.81Å; L15-T19 VanDerWaalsContact O-OG1 3.06Å
16	W	83.4	Confident	78.7	Confident	181 Å²	181	110.3 Å²	110.3	69%	0.686	57%	0.567	S	S	*	*	H	α-helix	trans	-64.5	-39	174.5	-108.7	85.2	0	0	0	112	C12 L13 T19 L20	C12-W16 PolarHBondContact O-N 2.89Å; L13-W16 PolarHBondContact O-N 3.26Å; W16-T19 PolarHBondContact O-N 3.43Å; W16-L20 HydrophobicContact CE3-CD1 3.68Å; W16-L20 HydrophobicContact CE3-CG 4.24Å; W16-L20 HydrophobicContact CZ3-CD1 4.06Å; W16-L20 HydrophobicContact CZ3-CG 4.42Å; W16-L20 WeakPolarHBondContact O-CB 3.25Å; W16-L20 PolarHBondContact O-N 3.33Å
17	A	85.8	Confident	80.1	Confident	51 Å²	51	112 Å²	112	42%	0.421	57%	0.571	S	S	.	*	H	α-helix	trans	-61.7	-44.8	176.3	0	0	0	0	0	111.6	L13 P14 L15 T19 L20 E21	L13-A17 VanDerWaalsContact O-CB 3.31Å; L13-A17 WeakPolarHBondContact O-CB 3.35Å; L13-A17 PolarHBondContact O-N 2.97Å; P14-A17 PolarHBondContact O-N 3.4Å; L15-A17 VanDerWaalsContact C-N 3.32Å; A17-T19 PolarHBondContact O-N 3.24Å; A17-L20 PolarHBondContact O-N 2.88Å; A17-E21 VanDerWaalsContact O-CB 3.25Å; A17-E21 WeakPolarHBondContact O-CB 3.25Å; A17-E21 PolarHBondContact O-N 3.49Å
18	L	87.4	Confident	81.7	Confident	110 Å²	110	107.9 Å²	107.9	58%	0.576	56%	0.56	S	S	*	*	H	α-helix	trans	-61.9	-43.8	176.6	-73.5	169	0	0	0	112.2	P14 L15 E21 A22	P14-L18 VanDerWaalsContact O-CG 3.3Å; P14-L18 WeakPolarHBondContact O-CG 3.34Å; P14-L18 PolarHBondContact O-N 3.11Å; L15-L18 PolarHBondContact O-N 3.41Å; L18-E21 PolarHBondContact O-N 3.06Å; L18-A22 WeakPolarHBondContact O-CB 3.29Å; L18-A22 PolarHBondContact O-N 2.92Å
19	T	90.7	Very high	83.1	Confident	99 Å²	99	111.8 Å²	111.8	61%	0.607	56%	0.563	S	S	*	*	H	α-helix	trans	-65.3	-42.4	177.2	-53.1	0	0	0	0	111.6	L15 W16 A17 A23	L15-T19 PolarHBondContact O-N 2.99Å; L15-T19 VanDerWaalsContact O-N 3.11Å; L15-T19 PolarHBondContact O-OG1 2.81Å; L15-T19 VanDerWaalsContact O-OG1 3.06Å; W16-T19 PolarHBondContact O-N 3.43Å; A17-T19 PolarHBondContact O-N 3.24Å; T19-A23 VanDerWaalsContact O-CB 3.29Å; T19-A23 WeakPolarHBondContact O-CB 3.45Å; T19-A23 PolarHBondContact O-N 2.72Å
20	L	92.3	Very high	84.6	Confident	84 Å²	84	114.5 Å²	114.5	44%	0.44	57%	0.57	S	S	.	*	H	α-helix	trans	-63.1	-43.7	175.3	-102.3	156.2	0	0	0	111.7	W16 A17 A23 L24	W16-L20 HydrophobicContact CE3-CD1 3.68Å; W16-L20 HydrophobicContact CE3-CG 4.24Å; W16-L20 HydrophobicContact CZ3-CD1 4.06Å; W16-L20 HydrophobicContact CZ3-CG 4.42Å; W16-L20 WeakPolarHBondContact O-CB 3.25Å; W16-L20 PolarHBondContact O-N 3.33Å; A17-L20 PolarHBondContact O-N 2.88Å; L20-A23 PolarHBondContact O-N 3.49Å; L20-L24 WeakPolarHBondContact O-CB 3.19Å; L20-L24 VanDerWaalsContact O-CG 3.23Å; L20-L24 WeakPolarHBondContact O-CG 3.23Å; L20-L24 PolarHBondContact O-N 3.37Å
21	E	93.9	Very high	85.7	Confident	116 Å²	116	109.6 Å²	109.6	54%	0.542	56%	0.559	S	S	.	*	H	α-helix	trans	-62.9	-48.1	179.7	-173.1	172.2	179.6	0	0	110.8	A17 L18 A23 L24 I25	A17-E21 VanDerWaalsContact O-CB 3.25Å; A17-E21 WeakPolarHBondContact O-CB 3.25Å; A17-E21 PolarHBondContact O-N 3.49Å; L18-E21 PolarHBondContact O-N 3.06Å; E21-A23 VanDerWaalsContact C-N 3.33Å; E21-A23 PolarHBondContact O-N 3.39Å; E21-L24 PolarHBondContact O-N 3.11Å; E21-I25 HydrophobicContact CG-CD1 4.04Å; E21-I25 VanDerWaalsContact O-CG1 3.25Å; E21-I25 WeakPolarHBondContact O-CG1 3.35Å; E21-I25 PolarHBondContact O-N 3.41Å
22	A	95.2	Very high	87	Confident	51 Å²	51	103.4 Å²	103.4	42%	0.421	54%	0.543	S	S	.	.	H	α-helix	trans	-60.2	-42.3	174.5	0	0	0	0	0	112.3	L18 I25 L26	L18-A22 WeakPolarHBondContact O-CB 3.29Å; L18-A22 PolarHBondContact O-N 2.92Å; A22-I25 PolarHBondContact O-N 3.39Å; A22-L26 WeakPolarHBondContact O-CB 3.31Å; A22-L26 WeakPolarHBondContact O-CG 3.3Å; A22-L26 PolarHBondContact O-N 2.86Å
23	A	95.4	Very high	87.8	Confident	54 Å²	54	105.2 Å²	105.2	45%	0.446	54%	0.544	S	S	.	.	H	α-helix	trans	-64.3	-40.5	176.9	0	0	0	0	0	112.2	T19 L20 E21 L26 L27	T19-A23 VanDerWaalsContact O-CB 3.29Å; T19-A23 WeakPolarHBondContact O-CB 3.45Å; T19-A23 PolarHBondContact O-N 2.72Å; L20-A23 PolarHBondContact O-N 3.49Å; E21-A23 VanDerWaalsContact C-N 3.33Å; E21-A23 PolarHBondContact O-N 3.39Å; A23-L26 PolarHBondContact O-N 3.44Å; A23-L27 VanDerWaalsContact O-CB 3.24Å; A23-L27 WeakPolarHBondContact O-CB 3.39Å; A23-L27 PolarHBondContact O-N 2.86Å
24	L	93.7	Very high	88.3	Confident	102 Å²	102	106.6 Å²	106.6	53%	0.534	54%	0.542	S	S	.	.	H	α-helix	trans	-68.2	-40.6	177.1	-74.3	170.9	0	0	0	111.7	L20 E21 L27 F28	L20-L24 WeakPolarHBondContact O-CB 3.19Å; L20-L24 VanDerWaalsContact O-CG 3.23Å; L20-L24 WeakPolarHBondContact O-CG 3.23Å; L20-L24 PolarHBondContact O-N 3.37Å; E21-L24 PolarHBondContact O-N 3.11Å; L24-L27 PolarHBondContact O-N 2.79Å; L24-F28 WeakPolarHBondContact O-CB 3.46Å; L24-F28 PolarHBondContact O-N 2.99Å
25	I	93.6	Very high	88.3	Confident	107 Å²	107	108.1 Å²	108.1	55%	0.549	55%	0.547	S	S	.	.	H	α-helix	trans	-62.5	-46.3	175.4	-67.4	163.5	0	0	0	110.2	E21 A22 F28 Y29	E21-I25 HydrophobicContact CG-CD1 4.04Å; E21-I25 VanDerWaalsContact O-CG1 3.25Å; E21-I25 WeakPolarHBondContact O-CG1 3.35Å; E21-I25 PolarHBondContact O-N 3.41Å; A22-I25 PolarHBondContact O-N 3.39Å; I25-F28 PolarHBondContact O-N 3.44Å; I25-Y29 VanDerWaalsContact O-CB 3.3Å; I25-Y29 WeakPolarHBondContact O-CB 3.29Å; I25-Y29 PolarHBondContact O-N 3.3Å
26	L	93.9	Very high	88	Confident	120 Å²	120	105.7 Å²	105.7	63%	0.628	54%	0.543	S	S	*	.	H	α-helix	trans	-62	-45.8	176.3	-76.9	169.8	0	0	0	111.5	A22 A23 F28 Y29 F30	A22-L26 WeakPolarHBondContact O-CB 3.31Å; A22-L26 WeakPolarHBondContact O-CG 3.3Å; A22-L26 PolarHBondContact O-N 2.86Å; A23-L26 PolarHBondContact O-N 3.44Å; L26-F28 VanDerWaalsContact C-N 3.34Å; L26-F28 PolarHBondContact O-N 2.81Å; L26-Y29 PolarHBondContact O-N 2.96Å; L26-F30 VanDerWaalsContact O-CB 3.3Å; L26-F30 WeakPolarHBondContact O-CB 3.13Å; L26-F30 PolarHBondContact O-N 3Å
27	L	93.8	Very high	87.5	Confident	111 Å²	111	100 Å²	100	58%	0.581	53%	0.531	S	S	*	.	H	α-helix	trans	-61.9	-43.5	177.6	-175.8	67	0	0	0	111.1	A23 L24 F30 L31	A23-L27 VanDerWaalsContact O-CB 3.24Å; A23-L27 WeakPolarHBondContact O-CB 3.39Å; A23-L27 PolarHBondContact O-N 2.86Å; L24-L27 PolarHBondContact O-N 2.79Å; L27-F30 PolarHBondContact O-N 3.49Å; L27-L31 WeakPolarHBondContact O-CB 3.19Å; L27-L31 PolarHBondContact O-N 2.75Å
28	F	90.9	Very high	86.8	Confident	146 Å²	146	100.8 Å²	100.8	64%	0.64	53%	0.527	S	S	*	.	H	α-helix	trans	-67.5	-42.2	180	-166.9	-91.4	0	0	0	111.6	L24 I25 L26 L31 T32	L24-F28 WeakPolarHBondContact O-CB 3.46Å; L24-F28 PolarHBondContact O-N 2.99Å; I25-F28 PolarHBondContact O-N 3.44Å; L26-F28 VanDerWaalsContact C-N 3.34Å; L26-F28 PolarHBondContact O-N 2.81Å; F28-L31 PolarHBondContact O-N 3.47Å; F28-T32 VanDerWaalsContact O-CB 3.31Å; F28-T32 WeakPolarHBondContact O-CB 3.24Å; F28-T32 PolarHBondContact O-N 3.43Å; F28-T32 PolarHBondContact O-OG1 3.44Å
29	Y	89.9	Confident	85.9	Confident	159 Å²	159	101.6 Å²	101.6	62%	0.624	53%	0.528	S	S	*	.	H	α-helix	trans	-59.9	-48	173.4	178.3	-97	0	0	0	110.9	I25 L26 T32 H33	I25-Y29 VanDerWaalsContact O-CB 3.3Å; I25-Y29 WeakPolarHBondContact O-CB 3.29Å; I25-Y29 PolarHBondContact O-N 3.3Å; L26-Y29 PolarHBondContact O-N 2.96Å; Y29-T32 PolarHBondContact O-N 2.78Å; Y29-H33 WeakPolarHBondContact O-CB 3.33Å; Y29-H33 PolarHBondContact O-N 3.38Å
30	F	88.3	Confident	84.9	Confident	131 Å²	131	102 Å²	102	58%	0.575	53%	0.527	S	S	*	.	H	α-helix	trans	-64	-45.2	179.5	-149.7	-91.2	0	0	0	111.1	L26 L27 H33 Y34	L26-F30 VanDerWaalsContact O-CB 3.3Å; L26-F30 WeakPolarHBondContact O-CB 3.13Å; L26-F30 PolarHBondContact O-N 3Å; L27-F30 PolarHBondContact O-N 3.49Å; F30-H33 PolarHBondContact O-N 2.81Å; F30-Y34 HydrophobicContact CD1-CD2 4.27Å; F30-Y34 AromaticContact CE1-CD2 3.81Å; F30-Y34 HydrophobicContact CE1-CD2 3.81Å; F30-Y34 HydrophobicContact CE1-CE2 4.23Å; F30-Y34 VanDerWaalsContact O-CB 3.26Å; F30-Y34 WeakPolarHBondContact O-CB 3.36Å; F30-Y34 PolarHBondContact O-N 3.33Å
31	L	85.2	Confident	83.7	Confident	110 Å²	110	103.8 Å²	103.8	58%	0.576	53%	0.533	S	S	*	.	H	α-helix	trans	-64.2	-44.5	179.4	-164.9	73.4	0	0	0	111.2	L27 F28 H33 Y34 D35	L27-L31 WeakPolarHBondContact O-CB 3.19Å; L27-L31 PolarHBondContact O-N 2.75Å; F28-L31 PolarHBondContact O-N 3.47Å; L31-H33 VanDerWaalsContact C-N 3.32Å; L31-H33 PolarHBondContact O-N 2.85Å; L31-Y34 PolarHBondContact O-N 3.29Å; L31-D35 WeakPolarHBondContact O-CB 3.3Å; L31-D35 PolarHBondContact O-N 2.87Å
32	T	87.2	Confident	82.5	Confident	72 Å²	72	104.5 Å²	104.5	44%	0.442	53%	0.534	S	S	.	.	H	α-helix	trans	-62.1	-41.9	176.9	-54.1	0	0	0	0	111.1	F28 Y29 A36	F28-T32 VanDerWaalsContact O-CB 3.31Å; F28-T32 WeakPolarHBondContact O-CB 3.24Å; F28-T32 PolarHBondContact O-N 3.43Å; F28-T32 PolarHBondContact O-OG1 3.44Å; Y29-T32 PolarHBondContact O-N 2.78Å; T32-A36 WeakPolarHBondContact O-CB 3.5Å; T32-A36 PolarHBondContact O-N 2.91Å
33	H	81.5	Confident	81.1	Confident	119 Å²	119	104.1 Å²	104.1	55%	0.551	54%	0.535	S	S	*	.	H	α-helix	trans	-69.1	-39.3	178	-168.7	26.6	0	0	0	112.2	Y29 F30 L31 S37	Y29-H33 WeakPolarHBondContact O-CB 3.33Å; Y29-H33 PolarHBondContact O-N 3.38Å; F30-H33 PolarHBondContact O-N 2.81Å; L31-H33 VanDerWaalsContact C-N 3.32Å; L31-H33 PolarHBondContact O-N 2.85Å; H33-S37 VanDerWaalsContact O-CB 3.27Å; H33-S37 WeakPolarHBondContact O-CB 3.28Å; H33-S37 PolarHBondContact O-N 3.27Å
34	Y	77.5	Confident	79.5	Confident	142 Å²	142	106 Å²	106	56%	0.557	54%	0.537	S	S	*	.	H	α-helix	trans	-70.7	-37.9	177.4	-141.1	-87.2	0	0	0	111.9	F30 L31 S37 L38	F30-Y34 HydrophobicContact CD1-CD2 4.27Å; F30-Y34 AromaticContact CE1-CD2 3.81Å; F30-Y34 HydrophobicContact CE1-CD2 3.81Å; F30-Y34 HydrophobicContact CE1-CE2 4.23Å; F30-Y34 VanDerWaalsContact O-CB 3.26Å; F30-Y34 WeakPolarHBondContact O-CB 3.36Å; F30-Y34 PolarHBondContact O-N 3.33Å; L31-Y34 PolarHBondContact O-N 3.29Å; Y34-S37 CarbonylContact O-C 3.55Å; Y34-S37 PolarHBondContact O-N 2.97Å; Y34-L38 WeakPolarHBondContact O-CB 3.26Å; Y34-L38 PolarHBondContact O-N 2.8Å
35	D	74.1	Confident	78.2	Confident	95 Å²	95	105.8 Å²	105.8	51%	0.508	54%	0.54	S	S	.	.	H	α-helix	trans	-66.8	-44.8	177	-162.9	-99.2	0	0	0	110.5	L31 S37 L38 E39	L31-D35 WeakPolarHBondContact O-CB 3.3Å; L31-D35 PolarHBondContact O-N 2.87Å; D35-S37 VanDerWaalsContact C-N 3.33Å; D35-S37 PolarHBondContact O-N 3.09Å; D35-L38 PolarHBondContact O-N 3.42Å; D35-L38 VanDerWaalsContact O-N 3.13Å; D35-E39 WeakPolarHBondContact O-CB 3.27Å; D35-E39 PolarHBondContact O-N 2.84Å
36	A	74.4	Confident	76.8	Confident	60 Å²	60	104 Å²	104	50%	0.496	54%	0.541	S	S	.	.	H	α-helix	trans	-60.4	-41.2	171.6	0	0	0	0	0	112.4	T32 L38 D40	T32-A36 WeakPolarHBondContact O-CB 3.5Å; T32-A36 PolarHBondContact O-N 2.91Å; A36-L38 VanDerWaalsContact C-N 3.34Å; A36-D40 WeakPolarHBondContact O-CB 3.14Å; A36-D40 PolarHBondContact O-N 2.98Å; A36-D40 VanDerWaalsContact O-N 3.09Å
37	S	71.9	Confident	75.2	Confident	61 Å²	61	103 Å²	103	43%	0.427	54%	0.544	S	S	.	.	H	α-helix	trans	-68.3	-33	175	-176.3	0	0	0	0	112.4	H33 Y34 D35 Q41	H33-S37 VanDerWaalsContact O-CB 3.27Å; H33-S37 WeakPolarHBondContact O-CB 3.28Å; H33-S37 PolarHBondContact O-N 3.27Å; Y34-S37 CarbonylContact O-C 3.55Å; Y34-S37 PolarHBondContact O-N 2.97Å; D35-S37 VanDerWaalsContact C-N 3.33Å; D35-S37 PolarHBondContact O-N 3.09Å; S37-Q41 VanDerWaalsContact O-CB 3.28Å; S37-Q41 WeakPolarHBondContact O-CB 3.44Å; S37-Q41 PolarHBondContact O-N 2.83Å
38	L	72.3	Confident	73.7	Confident	68 Å²	68	107.7 Å²	107.7	36%	0.356	56%	0.555	S	S	.	*	H	α-helix	trans	-77.3	-36.5	179.6	-174.4	128.5	0	0	0	112	Y34 D35 A36 Q41 K42	Y34-L38 WeakPolarHBondContact O-CB 3.26Å; Y34-L38 PolarHBondContact O-N 2.8Å; D35-L38 PolarHBondContact O-N 3.42Å; D35-L38 VanDerWaalsContact O-N 3.13Å; A36-L38 VanDerWaalsContact C-N 3.34Å; L38-Q41 PolarHBondContact O-N 3.13Å; L38-K42 HydrophobicContact CD2-CD 4.25Å; L38-K42 WeakPolarHBondContact O-CB 3.42Å; L38-K42 WeakPolarHBondContact O-CG 3.29Å; L38-K42 PolarHBondContact O-N 2.74Å
39	E	68.7	Low	71.9	Confident	127 Å²	127	111.9 Å²	111.9	59%	0.593	58%	0.577	S	S	*	*	H	α-helix	trans	-61	-44.8	167.8	-78.7	-95.4	104.3	0	0	110.7	D35 K42 G43	D35-E39 WeakPolarHBondContact O-CB 3.27Å; D35-E39 PolarHBondContact O-N 2.84Å; E39-K42 PolarHBondContact O-N 3.41Å; E39-G43 PolarHBondContact O-N 3.34Å
40	D	69.5	Low	71	Confident	108 Å²	108	109.5 Å²	109.5	58%	0.578	57%	0.574	S	S	*	*	H	α-helix	trans	-63.4	-42.2	175.3	-166.4	29.3	0	0	0	111.4	A36 K42 G43 L44	A36-D40 WeakPolarHBondContact O-CB 3.14Å; A36-D40 PolarHBondContact O-N 2.98Å; A36-D40 VanDerWaalsContact O-N 3.09Å; D40-K42 PolarHBondContact O-N 2.87Å; D40-G43 PolarHBondContact O-N 3.48Å; D40-L44 WeakPolarHBondContact O-CG 3.24Å; D40-L44 PolarHBondContact O-N 3.46Å
41	Q	66.2	Low	70.1	Confident	121 Å²	121	108.4 Å²	108.4	57%	0.565	57%	0.574	S	S	*	*	H	α-helix	trans	-64.8	-39.3	174.9	-164.5	-175.1	118	0	0	112.2	S37 L38 L44 V45	S37-Q41 VanDerWaalsContact O-CB 3.28Å; S37-Q41 WeakPolarHBondContact O-CB 3.44Å; S37-Q41 PolarHBondContact O-N 2.83Å; L38-Q41 PolarHBondContact O-N 3.13Å; Q41-L44 PolarHBondContact O-N 3.01Å; Q41-V45 WeakPolarHBondContact O-CB 3.36Å; Q41-V45 VanDerWaalsContact O-CG2 3.29Å; Q41-V45 WeakPolarHBondContact O-CG2 3.45Å; Q41-V45 PolarHBondContact O-N 3.13Å
42	K	68.4	Low	69.2	Low	130 Å²	130	108.3 Å²	108.3	57%	0.565	57%	0.574	S	S	*	*	H	α-helix	trans	-64.8	-39.9	174.5	-87.9	179.4	172.8	179.8	0	111.7	L38 E39 D40 V45 A46	L38-K42 HydrophobicContact CD2-CD 4.25Å; L38-K42 WeakPolarHBondContact O-CB 3.42Å; L38-K42 WeakPolarHBondContact O-CG 3.29Å; L38-K42 PolarHBondContact O-N 2.74Å; E39-K42 PolarHBondContact O-N 3.41Å; D40-K42 PolarHBondContact O-N 2.87Å; K42-V45 PolarHBondContact O-N 3.43Å; K42-A46 VanDerWaalsContact O-CB 3.24Å; K42-A46 WeakPolarHBondContact O-CB 3.43Å; K42-A46 PolarHBondContact O-N 2.95Å
43	G	66.6	Low	68.2	Low	43 Å²	43	110.4 Å²	110.4	44%	0.443	58%	0.582	S	S	.	*	H	α-helix	trans	-62.8	-42	174.4	0	0	0	0	0	112.3	E39 D40 A46 S47	E39-G43 PolarHBondContact O-N 3.34Å; D40-G43 PolarHBondContact O-N 3.48Å; G43-A46 PolarHBondContact O-N 3.28Å; G43-S47 WeakPolarHBondContact O-CB 3.47Å; G43-S47 PolarHBondContact O-N 3.35Å
44	L	62.7	Low	67.3	Low	95 Å²	95	109.9 Å²	109.9	50%	0.497	58%	0.584	S	S	.	*	H	α-helix	trans	-66.2	-46.1	174.6	-75.2	166.2	0	0	0	112.2	D40 Q41 A46 S47 Y48	D40-L44 WeakPolarHBondContact O-CG 3.24Å; D40-L44 PolarHBondContact O-N 3.46Å; Q41-L44 PolarHBondContact O-N 3.01Å; L44-A46 VanDerWaalsContact C-N 3.31Å; L44-A46 PolarHBondContact O-N 3.48Å; L44-S47 PolarHBondContact O-N 3.47Å; L44-S47 VanDerWaalsContact O-N 3.13Å; L44-Y48 WeakPolarHBondContact O-CD2 3.41Å; L44-Y48 PolarHBondContact O-N 3.14Å; L44-Y48 VanDerWaalsContact O-N 3.14Å
45	V	64.7	Low	66.7	Low	97 Å²	97	107.7 Å²	107.7	59%	0.588	59%	0.586	S	S	*	*	H	α-helix	trans	-62.1	-39.4	176.4	168.2	0	0	0	0	111.3	Q41 K42 S47 Y48	Q41-V45 WeakPolarHBondContact O-CB 3.36Å; Q41-V45 VanDerWaalsContact O-CG2 3.29Å; Q41-V45 WeakPolarHBondContact O-CG2 3.45Å; Q41-V45 PolarHBondContact O-N 3.13Å; K42-V45 PolarHBondContact O-N 3.43Å; V45-S47 VanDerWaalsContact C-N 3.3Å; V45-S47 PolarHBondContact O-N 2.86Å; V45-Y48 PolarHBondContact O-N 3.38Å
46	A	64.1	Low	66.1	Low	69 Å²	69	108.6 Å²	108.6	57%	0.57	59%	0.591	S	S	*	*	H	α-helix	trans	-67.4	-29.6	175.1	0	0	0	0	0	113	K42 G43 L44	K42-A46 VanDerWaalsContact O-CB 3.24Å; K42-A46 WeakPolarHBondContact O-CB 3.43Å; K42-A46 PolarHBondContact O-N 2.95Å; G43-A46 PolarHBondContact O-N 3.28Å; L44-A46 VanDerWaalsContact C-N 3.31Å; L44-A46 PolarHBondContact O-N 3.48Å
47	S	61.8	Low	65.5	Low	98 Å²	98	112.4 Å²	112.4	69%	0.685	60%	0.599	S	S	*	*	H	α-helix	trans	-81.1	-14.9	177.5	-170.5	0	0	0	0	113.8	G43 L44 V45	G43-S47 WeakPolarHBondContact O-CB 3.47Å; G43-S47 PolarHBondContact O-N 3.35Å; L44-S47 PolarHBondContact O-N 3.47Å; L44-S47 VanDerWaalsContact O-N 3.13Å; V45-S47 VanDerWaalsContact C-N 3.3Å; V45-S47 PolarHBondContact O-N 2.86Å
48	Y	62.7	Low	64.9	Low	211 Å²	211	116.7 Å²	116.7	83%	0.827	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.6	-7.7	175.9	-97.8	-87.1	0	0	0	113.4	L44 V45	L44-Y48 WeakPolarHBondContact O-CD2 3.41Å; L44-Y48 PolarHBondContact O-N 3.14Å; L44-Y48 VanDerWaalsContact O-N 3.14Å; V45-Y48 PolarHBondContact O-N 3.38Å
49	Q	51.7	Low	64.3	Low	233 Å²	233	121.1 Å²	121.1	100%	1.089	64%	0.637	S	S	*	*			trans	-100.1	0	177.6	-163.2	-177.6	-86.6	0	0	111.3

Retrieved 49 of 49 residues in 36.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).