A0A059XMR3_HUMAN Loading...

Rhesus blood group D antigen

AlphaFold DB , UniProt , Accession A0A059XMR3, Species HUMAN (Homo sapiens, Human), Gene RHD, Length 46 aa.

						>A0A059XMR3_HUMAN|A0A059XMR3|RHD
TYVHSAVLAGGVTVGTSCHLIPSPWLAMVLGLVAGLISVGGAKYLP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	T	53.1	Low	54	Low	180 Å²	180	119.3 Å²	119.3	100%	1.104	72%	0.722	S	S	*	*				0	70.3	0	43.9	0	0	0	109.9	V3	T1-V3 PolarHBondContact O-N 3.26Å
2	Y	56.9	Low	53.9	Low	233 Å²	233	118.9 Å²	118.9	91%	0.914	72%	0.72	S	S	*	*			trans	-80.3	30.9	-169.4	-99.6	-92.7	0	0	114.6
3	V	56.1	Low	53.9	Low	118 Å²	118	116.8 Å²	116.8	72%	0.715	71%	0.707	S	S	*	*			trans	-107.6	6.8	-167.2	-161.2	0	0	0	113.3	T1 S5	T1-V3 PolarHBondContact O-N 3.26Å; V3-S5 VanDerWaalsContact C-N 3.25Å; V3-S5 PolarHBondContact O-N 2.85Å
4	H	51.1	Low	53.9	Low	177 Å²	177	114.2 Å²	114.2	82%	0.819	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.4	-18.4	176.2	-157.9	104.5	0	0	113
5	S	53.4	Low	54.1	Low	87 Å²	87	108.5 Å²	108.5	61%	0.608	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.4	1	-173.9	-54.6	0	0	0	115	V3 V7	V3-S5 VanDerWaalsContact C-N 3.25Å; V3-S5 PolarHBondContact O-N 2.85Å; S5-V7 PolarHBondContact O-N 3.29Å
6	A	53	Low	54	Low	67 Å²	67	108.9 Å²	108.9	55%	0.554	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.1	-30.5	-171.1	0	0	0	0	114.2
7	V	53.7	Low	53.9	Low	132 Å²	132	108.2 Å²	108.2	80%	0.8	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.9	-32.5	-176.5	159	0	0	0	112.9	S5 A9 G10	S5-V7 PolarHBondContact O-N 3.29Å; V7-A9 VanDerWaalsContact C-N 3.27Å; V7-A9 PolarHBondContact O-N 3.12Å; V7-G10 PolarHBondContact O-N 3.45Å
8	L	49.3	Very low	53.7	Low	148 Å²	148	108.4 Å²	108.4	78%	0.775	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.8	-18.2	179.4	-65.5	172.2	0	0	113
9	A	53.9	Low	53.8	Low	49 Å²	49	112.4 Å²	112.4	41%	0.405	68%	0.683	S	S	.	*	T	Hydrogen-bonded Turn	trans	-84	-11.1	176	0	0	0	0	113.8	V7 T13	V7-A9 VanDerWaalsContact C-N 3.27Å; V7-A9 PolarHBondContact O-N 3.12Å; A9-T13 WeakPolarHBondContact O-CG2 3.07Å; A9-T13 PolarHBondContact O-OG1 3.08Å; A9-T13 VanDerWaalsContact O-OG1 3.12Å
10	G	56.6	Low	53.5	Low	52 Å²	52	114.6 Å²	114.6	54%	0.536	69%	0.689	S	S	.	*	T	Hydrogen-bonded Turn	trans	-74.8	-26.3	-173.1	0	0	0	0	115.1	V7	V7-G10 PolarHBondContact O-N 3.45Å
11	G	56.8	Low	53.4	Low	69 Å²	69	115 Å²	115	71%	0.711	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.2	-23.6	-174.5	0	0	0	0	115.5
12	V	52.5	Low	53.4	Low	115 Å²	115	112 Å²	112	70%	0.697	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.7	-29.1	-170.8	165.7	0	0	0	112.9	V14 G15	V12-V14 PolarHBondContact O-N 2.9Å; V12-G15 PolarHBondContact O-N 3.31Å
13	T	53.9	Low	53.6	Low	91 Å²	91	105.2 Å²	105.2	56%	0.558	66%	0.657	S	S	*	*	G	3₁₀ helix	trans	-73.8	-12.8	-176.5	58.2	0	0	0	113.9	A9 G15	A9-T13 WeakPolarHBondContact O-CG2 3.07Å; A9-T13 PolarHBondContact O-OG1 3.08Å; A9-T13 VanDerWaalsContact O-OG1 3.12Å; T13-G15 VanDerWaalsContact C-N 3.26Å
14	V	54.3	Low	53.5	Low	81 Å²	81	103.3 Å²	103.3	49%	0.491	65%	0.647	S	S	.	*	G	3₁₀ helix	trans	-79.7	-12.2	175.7	-173.7	0	0	0	111.8	V12 M28	V12-V14 PolarHBondContact O-N 2.9Å; V14-M28 HydrophobicContact CG1-CE 3.82Å; V14-M28 HydrophobicContact CG1-SD 3.24Å; V14-M28 WeakPolarHBondContact CG1-SD 3.24Å
15	G	57.4	Low	54.1	Low	28 Å²	28	102 Å²	102	29%	0.289	64%	0.635	S	S	.	*	G	3₁₀ helix	trans	-86.5	-5.4	-179.3	0	0	0	0	115.5	V12 T13 W25	V12-G15 PolarHBondContact O-N 3.31Å; T13-G15 VanDerWaalsContact C-N 3.26Å; G15-W25 VanDerWaalsContact O-CH2 3.24Å; G15-W25 WeakPolarHBondContact O-CH2 3.24Å; G15-W25 WeakPolarHBondContact O-CZ3 2.9Å
16	T	51.1	Low	54.5	Low	115 Å²	115	102.7 Å²	102.7	71%	0.706	63%	0.631	S	S	*	*			trans	-106.4	52	179.1	67.5	0	0	0	111.3
17	S	52.4	Low	55.2	Low	98 Å²	98	102.6 Å²	102.6	69%	0.685	63%	0.631	S	S	*	*			trans	-95.2	98.2	163.7	-126.6	0	0	0	108.4	H19	S17-H19 PolarHBondContact O-N 2.92Å
18	C	50.4	Low	55.8	Low	112 Å²	112	102 Å²	102	76%	0.757	62%	0.62	S	S	*	*			trans	-52.6	121.3	176.1	-63	0	0	0	110.9	L20	C18-L20 PolarHBondContact O-N 3.21Å
19	H	55.7	Low	56.8	Low	183 Å²	183	97.8 Å²	97.8	85%	0.847	60%	0.601	S	S	*	*	S	Bend	trans	39.2	72.5	135.6	-165.8	-136	0	0	116.1	S17	S17-H19 PolarHBondContact O-N 2.92Å
20	L	48.1	Very low	57.8	Low	156 Å²	156	100.9 Å²	100.9	82%	0.817	61%	0.61	S	S	*	*	S	Bend	trans	-151.4	-29.5	158.9	-108.2	137.1	0	0	118.8	C18	C18-L20 PolarHBondContact O-N 3.21Å
21	I	51.4	Low	58.7	Low	125 Å²	125	100.5 Å²	100.5	64%	0.641	61%	0.607	S	S	*	*			trans	-151.2	130.2	173.6	-75.9	97.6	0	0	109.8	S23 P24	I21-S23 PolarHBondContact O-N 3.26Å; I21-P24 WeakPolarHBondContact O-CD 3.36Å
22	P	53.9	Low	59.6	Low	117 Å²	117	102.6 Å²	102.6	76%	0.76	60%	0.601	S	S	*	*	S	Bend	trans	-76.9	45.4	-168.5	33.6	-38.7	0	0	114.8
23	S	59.5	Low	60.7	Low	89 Å²	89	100.2 Å²	100.2	62%	0.622	59%	0.586	S	S	*	*	S	Bend	trans	-150.9	15.9	-177.2	-140.2	0	0	0	119.9	I21	I21-S23 PolarHBondContact O-N 3.26Å
24	P	55.1	Low	61.9	Low	79 Å²	79	98.6 Å²	98.6	51%	0.513	58%	0.582	S	S	.	*	S	Bend	trans	-103.5	-34.3	165.2	31.2	-28.5	0	0	113.1	I21	I21-P24 WeakPolarHBondContact O-CD 3.36Å
25	W	63.9	Low	63	Low	148 Å²	148	96.3 Å²	96.3	56%	0.561	58%	0.575	S	S	*	*	H	α-helix	trans	-68.3	-48	178.9	-175	-47.9	0	0	111.6	G15 A27 M28 V29	G15-W25 VanDerWaalsContact O-CH2 3.24Å; G15-W25 WeakPolarHBondContact O-CH2 3.24Å; G15-W25 WeakPolarHBondContact O-CZ3 2.9Å; W25-A27 VanDerWaalsContact C-N 3.29Å; W25-A27 PolarHBondContact O-N 3.41Å; W25-M28 PolarHBondContact O-N 3.05Å; W25-M28 VanDerWaalsContact O-N 3.08Å; W25-V29 PolarHBondContact O-N 3.46Å
26	L	62	Low	63.7	Low	102 Å²	102	100.6 Å²	100.6	53%	0.534	59%	0.591	S	S	.	*	H	α-helix	trans	-59.4	-40.9	-174.6	-80.7	166.3	0	0	111.7	M28 V29 L30	L26-M28 VanDerWaalsContact C-N 3.34Å; L26-M28 PolarHBondContact O-N 2.9Å; L26-V29 PolarHBondContact O-N 3.38Å; L26-L30 WeakPolarHBondContact O-CG 3.34Å; L26-L30 PolarHBondContact O-N 2.93Å; L26-L30 WeakPolarHBondContact O-CB 3.22Å
27	A	66.6	Low	65	Low	65 Å²	65	100.4 Å²	100.4	54%	0.537	58%	0.584	S	S	.	*	H	α-helix	trans	-62.6	-39.9	176.8	0	0	0	0	112.4	W25 G31	W25-A27 VanDerWaalsContact C-N 3.29Å; W25-A27 PolarHBondContact O-N 3.41Å; A27-G31 PolarHBondContact O-N 3.37Å
28	M	66.3	Low	65.9	Low	119 Å²	119	99.8 Å²	99.8	59%	0.586	58%	0.58	S	S	*	*	H	α-helix	trans	-70.4	-41.2	177.6	-71.9	-178.6	177.3	0	112.6	V14 W25 L26 G31 L32	V14-M28 HydrophobicContact CG1-CE 3.82Å; V14-M28 HydrophobicContact CG1-SD 3.24Å; V14-M28 WeakPolarHBondContact CG1-SD 3.24Å; W25-M28 PolarHBondContact O-N 3.05Å; W25-M28 VanDerWaalsContact O-N 3.08Å; L26-M28 VanDerWaalsContact C-N 3.34Å; L26-M28 PolarHBondContact O-N 2.9Å; M28-G31 PolarHBondContact O-N 3.45Å; M28-L32 WeakPolarHBondContact O-CB 3.17Å; M28-L32 PolarHBondContact O-N 3.41Å
29	V	71.4	Confident	66.8	Low	61 Å²	61	99.5 Å²	99.5	37%	0.37	57%	0.574	S	S	.	*	H	α-helix	trans	-66.8	-43.8	174.9	169.2	0	0	0	111.1	W25 L26 G31 L32 V33	W25-V29 PolarHBondContact O-N 3.46Å; L26-V29 PolarHBondContact O-N 3.38Å; V29-G31 VanDerWaalsContact C-N 3.33Å; V29-G31 PolarHBondContact O-N 2.77Å; V29-L32 PolarHBondContact O-N 2.8Å; V29-V33 PolarHBondContact O-N 3.28Å; V29-V33 WeakPolarHBondContact O-CG2 3.1Å; V29-V33 VanDerWaalsContact O-CB 3.29Å; V29-V33 WeakPolarHBondContact O-CB 3.26Å; V29-V33 HydrophobicContact CG1-CG2 4.04Å
30	L	73.5	Confident	67.4	Low	113 Å²	113	92 Å²	92	59%	0.592	55%	0.546	S	S	*	.	H	α-helix	trans	-62.9	-40.2	176.5	-71.4	171.2	0	0	111.4	L26 A34	L26-L30 WeakPolarHBondContact O-CG 3.34Å; L26-L30 PolarHBondContact O-N 2.93Å; L26-L30 WeakPolarHBondContact O-CB 3.22Å; L30-A34 WeakPolarHBondContact O-CB 3.12Å; L30-A34 PolarHBondContact O-N 3.47Å
31	G	75.4	Confident	68.2	Low	45 Å²	45	86.2 Å²	86.2	46%	0.464	53%	0.525	S	S	.	.	H	α-helix	trans	-65	-39.9	174.4	0	0	0	0	113.1	A27 M28 V29 G35	A27-G31 PolarHBondContact O-N 3.37Å; M28-G31 PolarHBondContact O-N 3.45Å; V29-G31 VanDerWaalsContact C-N 3.33Å; V29-G31 PolarHBondContact O-N 2.77Å; G31-G35 PolarHBondContact O-N 2.81Å
32	L	75.9	Confident	68.5	Low	113 Å²	113	84 Å²	84	59%	0.592	53%	0.525	S	S	*	.	H	α-helix	trans	-68	-45.8	176	-164.3	157	0	0	111	M28 V29 G35 L36	M28-L32 WeakPolarHBondContact O-CB 3.17Å; M28-L32 PolarHBondContact O-N 3.41Å; V29-L32 PolarHBondContact O-N 2.8Å; L32-G35 PolarHBondContact O-N 3.21Å; L32-L36 HydrophobicContact CD2-CD1 3.51Å; L32-L36 HydrophobicContact CD2-CG 4Å; L32-L36 WeakPolarHBondContact O-CG 3.29Å; L32-L36 PolarHBondContact O-N 3.44Å
33	V	76.8	Confident	68.6	Low	65 Å²	65	86.9 Å²	86.9	39%	0.394	53%	0.526	S	S	.	.	H	α-helix	trans	-64.1	-43.8	176.8	171.8	0	0	0	110.7	V29 G35 L36 I37	V29-V33 PolarHBondContact O-N 3.28Å; V29-V33 WeakPolarHBondContact O-CG2 3.1Å; V29-V33 VanDerWaalsContact O-CB 3.29Å; V29-V33 WeakPolarHBondContact O-CB 3.26Å; V29-V33 HydrophobicContact CG1-CG2 4.04Å; V33-G35 PolarHBondContact O-N 3.48Å; V33-L36 PolarHBondContact O-N 2.84Å; V33-I37 HydrophobicContact CG1-CD1 3.53Å; V33-I37 PolarHBondContact O-N 2.88Å; V33-I37 WeakPolarHBondContact O-CG1 3.4Å; V33-I37 WeakPolarHBondContact O-CD1 3.13Å; V33-I37 WeakPolarHBondContact O-CB 3.35Å; V33-I37 HydrophobicContact CG1-CG1 4.33Å
34	A	79.4	Confident	68.3	Low	56 Å²	56	92.4 Å²	92.4	46%	0.463	53%	0.534	S	S	.	.	H	α-helix	trans	-63.2	-39	174.9	0	0	0	0	112.2	L30 I37 S38	L30-A34 WeakPolarHBondContact O-CB 3.12Å; L30-A34 PolarHBondContact O-N 3.47Å; A34-I37 PolarHBondContact O-N 3.35Å; A34-S38 VanDerWaalsContact O-CB 3.26Å; A34-S38 WeakPolarHBondContact O-CB 3.44Å; A34-S38 PolarHBondContact O-N 2.9Å
35	G	75.9	Confident	67.9	Low	34 Å²	34	95.7 Å²	95.7	35%	0.351	55%	0.547	S	S	.	.	H	α-helix	trans	-65.2	-44.8	174.1	0	0	0	0	112.6	G31 L32 V33 I37 S38 V39	G31-G35 PolarHBondContact O-N 2.81Å; L32-G35 PolarHBondContact O-N 3.21Å; V33-G35 PolarHBondContact O-N 3.48Å; G35-I37 PolarHBondContact O-N 3.3Å; G35-I37 VanDerWaalsContact C-N 3.34Å; G35-S38 PolarHBondContact O-N 3.47Å; G35-V39 WeakPolarHBondContact O-CG2 3.35Å; G35-V39 PolarHBondContact O-N 2.77Å
36	L	73.6	Confident	67.4	Low	117 Å²	117	97.3 Å²	97.3	61%	0.613	58%	0.576	S	S	*	*	H	α-helix	trans	-62.4	-41	174.2	-72.8	177.8	0	0	111.8	L32 V33 V39 G40	L32-L36 HydrophobicContact CD2-CD1 3.51Å; L32-L36 HydrophobicContact CD2-CG 4Å; L32-L36 WeakPolarHBondContact O-CG 3.29Å; L32-L36 PolarHBondContact O-N 3.44Å; V33-L36 PolarHBondContact O-N 2.84Å; L36-V39 PolarHBondContact O-N 2.81Å; L36-G40 PolarHBondContact O-N 2.72Å
37	I	77.3	Confident	67.7	Low	112 Å²	112	97.1 Å²	97.1	57%	0.574	58%	0.578	S	S	*	*	H	α-helix	trans	-68.1	-36.1	174.9	-67.2	164.4	0	0	110.9	V33 A34 G35 G41	V33-I37 HydrophobicContact CG1-CD1 3.53Å; V33-I37 PolarHBondContact O-N 2.88Å; V33-I37 WeakPolarHBondContact O-CG1 3.4Å; V33-I37 WeakPolarHBondContact O-CD1 3.13Å; V33-I37 WeakPolarHBondContact O-CB 3.35Å; V33-I37 HydrophobicContact CG1-CG1 4.33Å; A34-I37 PolarHBondContact O-N 3.35Å; G35-I37 PolarHBondContact O-N 3.3Å; G35-I37 VanDerWaalsContact C-N 3.34Å; I37-G41 WeakPolarHBondContact O-CA 3.37Å; I37-G41 PolarHBondContact O-N 3.42Å
38	S	71.7	Confident	67.8	Low	85 Å²	85	98.7 Å²	98.7	59%	0.594	58%	0.581	S	S	*	*	H	α-helix	trans	-68.2	-39	176.7	-173.7	0	0	0	112	A34 G35 A42	A34-S38 VanDerWaalsContact O-CB 3.26Å; A34-S38 WeakPolarHBondContact O-CB 3.44Å; A34-S38 PolarHBondContact O-N 2.9Å; G35-S38 PolarHBondContact O-N 3.47Å; S38-A42 PolarHBondContact O-N 3.27Å
39	V	70.4	Confident	67.9	Low	105 Å²	105	97.6 Å²	97.6	64%	0.636	58%	0.58	S	S	*	*	H	α-helix	trans	-74	-39.5	175.9	173.9	0	0	0	110.9	G35 L36 K43	G35-V39 WeakPolarHBondContact O-CG2 3.35Å; G35-V39 PolarHBondContact O-N 2.77Å; L36-V39 PolarHBondContact O-N 2.81Å; V39-K43 PolarHBondContact O-N 3.49Å
40	G	67.7	Low	67.7	Low	25 Å²	25	99.8 Å²	99.8	26%	0.258	59%	0.593	S	S	.	*	H	α-helix	trans	-64.6	-46.2	174	0	0	0	0	112	L36 A42 K43 Y44	L36-G40 PolarHBondContact O-N 2.72Å; G40-A42 VanDerWaalsContact C-N 3.3Å; G40-A42 PolarHBondContact O-N 3.33Å; G40-K43 CarbonylContact O-C 3.54Å; G40-K43 PolarHBondContact O-N 2.91Å; G40-K43 WeakPolarHBondContact O-CA 3.45Å; G40-Y44 VanDerWaalsContact O-CD2 3.31Å; G40-Y44 WeakPolarHBondContact O-CD2 3.31Å; G40-Y44 PolarHBondContact O-N 3.09Å
41	G	64.4	Low	67.3	Low	35 Å²	35	98.9 Å²	98.9	36%	0.361	59%	0.593	S	S	.	*	H	α-helix	trans	-60.1	-37.3	178.4	0	0	0	0	112.9	I37 K43 Y44 L45	I37-G41 WeakPolarHBondContact O-CA 3.37Å; I37-G41 PolarHBondContact O-N 3.42Å; G41-K43 PolarHBondContact O-N 3.38Å; G41-Y44 PolarHBondContact O-N 3.36Å; G41-L45 PolarHBondContact O-N 2.94Å; G41-L45 VanDerWaalsContact O-N 3.09Å
42	A	58.7	Low	66.7	Low	79 Å²	79	102.5 Å²	102.5	65%	0.653	60%	0.601	S	S	*	*	H	α-helix	trans	-69.9	-18.8	173.9	0	0	0	0	113.8	S38 G40	S38-A42 PolarHBondContact O-N 3.27Å; G40-A42 VanDerWaalsContact C-N 3.3Å; G40-A42 PolarHBondContact O-N 3.33Å
43	K	55.7	Low	66.1	Low	178 Å²	178	101.8 Å²	101.8	77%	0.774	60%	0.602	S	S	*	*	H	α-helix	trans	-96.2	-19.4	175.2	-76.9	-72.1	-175.6	179.1	113.7	V39 G40 G41	V39-K43 PolarHBondContact O-N 3.49Å; G40-K43 CarbonylContact O-C 3.54Å; G40-K43 PolarHBondContact O-N 2.91Å; G40-K43 WeakPolarHBondContact O-CA 3.45Å; G41-K43 PolarHBondContact O-N 3.38Å
44	Y	52.3	Low	65.3	Low	204 Å²	204	104.6 Å²	104.6	80%	0.8	62%	0.618	S	S	*	*	H	α-helix	trans	-103.8	4.8	178.3	-81.2	-86.5	0	0	113.7	G40 G41 P46	G40-Y44 VanDerWaalsContact O-CD2 3.31Å; G40-Y44 WeakPolarHBondContact O-CD2 3.31Å; G40-Y44 PolarHBondContact O-N 3.09Å; G41-Y44 PolarHBondContact O-N 3.36Å; Y44-P46 VanDerWaalsContact C-CD 3.45Å; Y44-P46 WeakPolarHBondContact O-CD 3.44Å
45	L	48	Very low	64.1	Low	148 Å²	148	108.7 Å²	108.7	78%	0.775	63%	0.631	S	S	*	*			trans	-95.9	91.5	160.9	-121.1	86.3	0	0	109.2	G41	G41-L45 PolarHBondContact O-N 2.94Å; G41-L45 VanDerWaalsContact O-N 3.09Å
46	P	53.4	Low	63	Low	182 Å²	182	115.5 Å²	115.5	100%	1.182	66%	0.656	S	S	*	*				-85.8	0	119.5	28.2	-32.5	0	0	110.8	Y44	Y44-P46 VanDerWaalsContact C-CD 3.45Å; Y44-P46 WeakPolarHBondContact O-CD 3.44Å

Retrieved 46 of 46 residues in 26.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).