A0A060APE7_HUMAN Loading...

p5 protein

AlphaFold DB , UniProt , Accession A0A060APE7, Species HUMAN (Homo sapiens, Human), Gene p5, Length 55 aa.

						>A0A060APE7_HUMAN|A0A060APE7|p5
MGYARPGPPRVRACARGGRGGAREDFGARRKHVRGLGALAVCAEVGRAAGGGVGG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.1	Low	63.2	Low	253 Å²	253	146.3 Å²	146.3	100%	1.246	81%	0.813	S	S	*	*				0	100.5	0	-142.5	144.5	169	0	0	107
2	G	66.1	Low	62.4	Low	79 Å²	79	153 Å²	153	81%	0.814	82%	0.816	S	S	*	*	P	Polyproline II helix	trans	-91.5	130.6	-175	0	0	0	0	0	110.6
3	Y	61.6	Low	61.9	Low	195 Å²	195	148.4 Å²	148.4	77%	0.765	81%	0.813	S	S	*	*	P	Polyproline II helix	trans	-70.9	139	172	57.4	-87.6	0	0	0	109.4	R5	Y3-R5 PolarHBondContact O-N 3.21Å
4	A	65.7	Low	60.9	Low	93 Å²	93	145.6 Å²	145.6	77%	0.769	81%	0.808	S	S	*	*	P	Polyproline II helix	trans	-63.6	120.9	172.5	0	0	0	0	0	108.5
5	R	65.3	Low	60.7	Low	210 Å²	210	143.1 Å²	143.1	79%	0.792	81%	0.813	S	S	*	*	P	Polyproline II helix	trans	-56.2	132.9	170.6	-76.4	-177.5	-179.7	-108.7	0.5	107.8	Y3 G7	Y3-R5 PolarHBondContact O-N 3.21Å; R5-G7 PolarHBondContact O-N 3Å
6	P	66.4	Low	60.3	Low	124 Å²	124	149.6 Å²	149.6	81%	0.805	82%	0.821	S	S	*	*	P	Polyproline II helix	trans	-54.9	118.2	173.1	-20.5	30.5	0	0	0	108
7	G	67.8	Low	59.9	Low	57 Å²	57	145.5 Å²	145.5	59%	0.588	82%	0.821	S	S	*	*	P	Polyproline II helix	trans	-57.9	151.1	172.1	0	0	0	0	0	109.1	R5	R5-G7 PolarHBondContact O-N 3Å
8	P	65.9	Low	59.7	Low	114 Å²	114	141.6 Å²	141.6	74%	0.74	82%	0.818	S	S	*	*	P	Polyproline II helix	trans	-50.8	145.6	177.3	22	-32.3	0	0	0	109.7	R10	P8-R10 PolarHBondContact O-N 3.03Å
9	P	65.9	Low	59	Low	115 Å²	115	147.2 Å²	147.2	75%	0.747	83%	0.825	S	S	*	*	P	Polyproline II helix	trans	-53.5	122.4	-176.9	22.2	-32.1	0	0	0	108	V11	P9-V11 PolarHBondContact O-N 2.74Å
10	R	62	Low	58.4	Low	246 Å²	246	144.1 Å²	144.1	93%	0.928	83%	0.827	S	S	*	*			trans	-68.8	84.8	171.9	-61.9	-162.8	-168.3	-134	5.8	106.1	P8 R12	P8-R10 PolarHBondContact O-N 3.03Å; R10-R12 VanDerWaalsContact C-N 3.28Å; R10-R12 PolarHBondContact O-N 2.89Å
11	V	54.8	Low	57.7	Low	123 Å²	123	140 Å²	140	75%	0.745	82%	0.816	S	S	*	*			trans	-53.4	105.4	162.2	179.1	0	0	0	0	103.6	P9 A13	P9-V11 PolarHBondContact O-N 2.74Å; V11-A13 VanDerWaalsContact C-N 3.33Å; V11-A13 PolarHBondContact O-N 2.85Å
12	R	53.6	Low	57.7	Low	227 Å²	227	132.8 Å²	132.8	86%	0.857	80%	0.797	S	S	*	*			trans	-51.7	113.2	163.6	-85.9	-178.6	168.9	-130.6	-0.6	103	R10 C14	R10-R12 VanDerWaalsContact C-N 3.28Å; R10-R12 PolarHBondContact O-N 2.89Å; R12-C14 PolarHBondContact O-N 2.67Å
13	A	55.4	Low	57	Low	93 Å²	93	138.8 Å²	138.8	77%	0.769	80%	0.795	S	S	*	*			trans	-54.2	97.8	166.8	0	0	0	0	0	104.4	V11 A15	V11-A13 VanDerWaalsContact C-N 3.33Å; V11-A13 PolarHBondContact O-N 2.85Å; A13-A15 PolarHBondContact O-N 2.6Å
14	C	48.6	Very low	56.2	Low	110 Å²	110	138.9 Å²	138.9	74%	0.743	80%	0.802	S	S	*	*			trans	-47.2	117.6	160.8	-65.2	0	0	0	0	102.6	R12 R16	R12-C14 PolarHBondContact O-N 2.67Å; C14-R16 PolarHBondContact O-N 2.96Å
15	A	56.9	Low	55.7	Low	108 Å²	108	140.3 Å²	140.3	89%	0.893	80%	0.797	S	S	*	*			trans	-56.8	86.8	-178.7	0	0	0	0	0	108.4	A13	A13-A15 PolarHBondContact O-N 2.6Å
16	R	54.9	Low	54.9	Low	246 Å²	246	136.8 Å²	136.8	93%	0.928	79%	0.788	S	S	*	*			trans	-112.6	83.2	177.1	178.8	170.6	-88.9	-145	-4.7	104.5	C14	C14-R16 PolarHBondContact O-N 2.96Å
17	G	52.5	Low	54.1	Low	81 Å²	81	134.2 Å²	134.2	84%	0.835	78%	0.783	S	S	*	*	S	Bend	trans	143.8	63.7	176.9	0	0	0	0	0	111.1
18	G	56.3	Low	53.3	Low	74 Å²	74	134.4 Å²	134.4	76%	0.763	78%	0.78	S	S	*	*			trans	-179	34.7	179.1	0	0	0	0	0	116.3
19	R	47.2	Very low	52.7	Low	249 Å²	249	139.3 Å²	139.3	94%	0.94	78%	0.783	S	S	*	*			trans	-145.9	104.2	157.3	-111.4	174.3	-176.1	-154.5	-1.1	108.4
20	G	47.8	Very low	52.3	Low	84 Å²	84	142.6 Å²	142.6	87%	0.866	78%	0.781	S	S	*	*			trans	-59.3	158.5	172.1	0	0	0	0	0	111.7
21	G	43.7	Very low	52	Low	58 Å²	58	139.2 Å²	139.2	60%	0.598	77%	0.773	S	S	*	*			trans	159.5	53.7	169.9	0	0	0	0	0	115.4	R23	G21-R23 WeakPolarHBondContact O-CB 3.5Å; G21-R23 PolarHBondContact O-N 3.07Å; G21-R23 WeakPolarHBondContact O-CG 3.49Å; G21-R23 VanDerWaalsContact C-N 3.29Å
22	A	53	Low	52.1	Low	103 Å²	103	141.5 Å²	141.5	85%	0.851	78%	0.775	S	S	*	*	S	Bend	trans	46.4	26.1	137.2	0	0	0	0	0	120.5
23	R	51.6	Low	52.2	Low	205 Å²	205	136 Å²	136	77%	0.774	77%	0.767	S	S	*	*			trans	-142.7	-9	-171	-58.5	-179	-167.2	-94.8	-0.6	116.4	G21 F26	G21-R23 WeakPolarHBondContact O-CB 3.5Å; G21-R23 PolarHBondContact O-N 3.07Å; G21-R23 WeakPolarHBondContact O-CG 3.49Å; G21-R23 VanDerWaalsContact C-N 3.29Å; R23-F26 WeakPolarHBondContact O-CB 3.37Å
24	E	45.3	Very low	52.1	Low	197 Å²	197	143.8 Å²	143.8	92%	0.921	78%	0.776	S	S	*	*	G	3₁₀ helix	trans	-87.4	-12.4	177.2	-61.1	-164.4	100.2	0	0	113.2	F26	E24-F26 PolarHBondContact O-N 3.25Å
25	D	54.1	Low	52.5	Low	123 Å²	123	140.7 Å²	140.7	66%	0.658	76%	0.763	S	S	*	*	G	3₁₀ helix	trans	-76.2	3.2	166.1	-78.1	-74.5	0	0	0	114.2	G27 A28 R29	D25-G27 PolarHBondContact O-N 3.29Å; D25-A28 PolarHBondContact O-N 3.23Å; D25-A28 VanDerWaalsContact O-N 3.07Å; D25-R29 PolarHBondContact O-N 2.77Å
26	F	49.4	Very low	52.4	Low	136 Å²	136	142.3 Å²	142.3	60%	0.596	76%	0.756	S	S	*	*	G	3₁₀ helix	trans	-69.2	-14.3	175.2	-130.2	-109	0	0	0	113.1	R23 E24	R23-F26 WeakPolarHBondContact O-CB 3.37Å; E24-F26 PolarHBondContact O-N 3.25Å
27	G	49.5	Very low	52.3	Low	69 Å²	69	133.6 Å²	133.6	71%	0.711	74%	0.742	S	S	*	*	G	3₁₀ helix	trans	-85.2	-20.4	169	0	0	0	0	0	114.2	D25	D25-G27 PolarHBondContact O-N 3.29Å
28	A	51.8	Low	52.2	Low	62 Å²	62	133.3 Å²	133.3	51%	0.512	73%	0.732	S	S	.	*	T	Hydrogen-bonded Turn	trans	-96.9	-23.3	-174.7	0	0	0	0	0	113.5	D25	D25-A28 PolarHBondContact O-N 3.23Å; D25-A28 VanDerWaalsContact O-N 3.07Å
29	R	52.1	Low	51.9	Low	216 Å²	216	136.5 Å²	136.5	82%	0.815	73%	0.731	S	S	*	*	S	Bend	trans	-105.6	19.4	-176.4	-149.9	-177.2	-178.4	-87.1	2.5	115.5	D25	D25-R29 PolarHBondContact O-N 2.77Å
30	R	57.3	Low	52	Low	184 Å²	184	127.7 Å²	127.7	69%	0.694	71%	0.712	S	S	*	*			trans	-117	51.9	172.5	-71.6	-176.7	173.1	-159.3	-7.4	112
31	K	55.7	Low	52.1	Low	175 Å²	175	128.7 Å²	128.7	76%	0.761	70%	0.701	S	S	*	*	S	Bend	trans	-103.8	-8.3	162.3	-41.8	-158.8	-171.9	-167.8	0	112.2
32	H	57.8	Low	52.3	Low	171 Å²	171	130.5 Å²	130.5	79%	0.792	70%	0.703	S	S	*	*	S	Bend	trans	-111.6	90.6	173.9	-56.7	135.7	0	0	0	108.5
33	V	54.8	Low	52.1	Low	112 Å²	112	129 Å²	129	68%	0.679	69%	0.69	S	S	*	*				171.8	74.5	127.5	-179.1	0	0	0	0	105.1
34	R	54	Low	51.7	Low	257 Å²	257	127.1 Å²	127.1	97%	0.97	69%	0.69	S	S	*	*	S	Bend	trans	-105.3	51.6	139.8	-73.5	-173.2	-178.6	-177.7	0.3	106.8
35	G	55.9	Low	51.8	Low	45 Å²	45	123.1 Å²	123.1	46%	0.464	68%	0.679	S	S	.	*			trans	-126.1	20.5	-170	0	0	0	0	0	113.3
36	L	55.7	Low	51.5	Low	142 Å²	142	119.8 Å²	119.8	74%	0.743	67%	0.674	S	S	*	*	S	Bend	trans	-143.9	17.4	173.1	-87	169.5	0	0	0	112.7
37	G	52.5	Low	51.1	Low	62 Å²	62	124.3 Å²	124.3	64%	0.639	69%	0.687	S	S	*	*	S	Bend	trans	-108.6	-21.8	175.9	0	0	0	0	0	114.5
38	A	51.8	Low	50.9	Low	76 Å²	76	125.4 Å²	125.4	63%	0.628	69%	0.689	S	S	*	*	S	Bend	trans	-115.3	-8.2	-176.7	0	0	0	0	0	114
39	L	49.1	Very low	50.9	Low	140 Å²	140	126.7 Å²	126.7	73%	0.733	70%	0.7	S	S	*	*	S	Bend	trans	-100.7	-9.2	175.8	-75.4	170.3	0	0	0	113.7
40	A	49.8	Very low	50.9	Low	65 Å²	65	119.7 Å²	119.7	54%	0.537	70%	0.695	S	S	.	*	S	Bend	trans	-86.7	-5.8	171.3	0	0	0	0	0	113.2
41	V	49.5	Very low	50.3	Low	105 Å²	105	114.5 Å²	114.5	64%	0.636	70%	0.699	S	S	*	*	S	Bend	trans	-107	9.4	-177	-172.1	0	0	0	0	112.6
42	C	48.4	Very low	49.9	Very low	96 Å²	96	109.6 Å²	109.6	65%	0.649	70%	0.698	S	S	*	*	S	Bend	trans	-112.6	-17	169.9	-63.8	0	0	0	0	113.3
43	A	48.8	Very low	49.4	Very low	71 Å²	71	108.6 Å²	108.6	59%	0.587	70%	0.703	S	S	*	*	H	α-helix	trans	-84.4	-20	-179.9	0	0	0	0	0	113.5	R47	A43-R47 PolarHBondContact O-N 3.34Å
44	E	43	Very low	49	Very low	165 Å²	165	107.4 Å²	107.4	77%	0.771	71%	0.714	S	S	*	*	H	α-helix	trans	-79.7	-28.1	177.7	-159.4	167.9	98.9	0	0	112.4
45	V	46.8	Very low	48.4	Very low	114 Å²	114	102.6 Å²	102.6	69%	0.691	74%	0.744	S	S	*	*	H	α-helix	trans	-75.3	-31.5	177.8	-176.7	0	0	0	0	111.9
46	G	46.8	Very low	48	Very low	53 Å²	53	105.5 Å²	105.5	55%	0.546	76%	0.758	S	S	.	*	H	α-helix	trans	-80.9	-26.6	177.7	0	0	0	0	0	114.5	A48 A49	G46-A48 VanDerWaalsContact C-N 3.29Å; G46-A49 PolarHBondContact O-N 3.43Å
47	R	42.3	Very low	47.6	Very low	231 Å²	231	103.5 Å²	103.5	87%	0.872	76%	0.759	S	S	*	*	H	α-helix	trans	-81.4	-6.9	175.6	-168.1	155.8	175.9	123.6	-2.8	113.4	A43	A43-R47 PolarHBondContact O-N 3.34Å
48	A	45.6	Very low	47.3	Very low	91 Å²	91	105.8 Å²	105.8	75%	0.752	77%	0.765	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.6	-11.1	166.7	0	0	0	0	0	113.4	G46	G46-A48 VanDerWaalsContact C-N 3.29Å
49	A	51.8	Low	47	Very low	89 Å²	89	107.6 Å²	107.6	74%	0.736	77%	0.774	S	S	*	*	S	Bend	trans	-102.5	14.5	-173.2	0	0	0	0	0	114.5	G46	G46-A49 PolarHBondContact O-N 3.43Å
50	G	52.3	Low	46.9	Very low	70 Å²	70	105.6 Å²	105.6	72%	0.722	78%	0.776	S	S	*	*	S	Bend	trans	-146.7	73.6	-177	0	0	0	0	0	112.7
51	G	43.4	Very low	46.7	Very low	74 Å²	74	108.3 Å²	108.3	76%	0.763	79%	0.792	S	S	*	*	S	Bend	trans	160.2	89.1	165.4	0	0	0	0	0	115.4
52	G	47.6	Very low	46.5	Very low	72 Å²	72	108.5 Å²	108.5	74%	0.742	80%	0.803	S	S	*	*			trans	66.8	152.6	162.8	0	0	0	0	0	114.7
53	V	47.9	Very low	46.4	Very low	150 Å²	150	109.5 Å²	109.5	91%	0.909	82%	0.815	S	S	*	*			cis	-170.5	146.1	20.7	-106.5	0	0	0	0	106.3
54	G	46.4	Very low	46.2	Very low	88 Å²	88	112.7 Å²	112.7	91%	0.907	83%	0.834	S	S	*	*			trans	83.8	104.9	141.6	0	0	0	0	0	118.2
55	G	40.2	Very low	46.5	Very low	155 Å²	155	107.9 Å²	107.9	100%	1.598	84%	0.84	S	S	*	*			trans	-155.9	0	154.3	0	0	0	0	0	107.9

Retrieved 55 of 55 residues in 16.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).