A0A060D700_MAIZE Loading...

BZIP transcription factor

AlphaFold DB , UniProt , Accession A0A060D700, Species MAIZE (Zea mays, Maize), Gene bZIP48, Length 152 aa.

						>A0A060D700_MAIZE|A0A060D700|bZIP48
MSSSSLSPAGRTSGSDGDSAADTRRREKRRLSNRESARRSRLRKQQHLDELAQEAALLQAENARVAARAADVASQNARVEQENAVLRARAAELGARLRSVNEVLRVVEEFSGVAMDIQEEVPPADDPLLRPWQLPCYPAAAMPIGAPHMLRY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.3	Very low	49	Very low	239 Å²	239	132.3 Å²	132.3	100%	1.177	81%	0.805	S	S	*	*				0	121.8	0	-64.9	174.9	91.6	0	0	107.9
2	S	45.8	Very low	48.8	Very low	109 Å²	109	131.9 Å²	131.9	76%	0.762	80%	0.804	S	S	*	*			trans	46.6	97	158.6	-50.1	0	0	0	0	119.3	S4	S2-S4 PolarHBondContact O-N 2.77Å
3	S	49.3	Very low	49	Very low	117 Å²	117	130.8 Å²	130.8	82%	0.818	81%	0.805	S	S	*	*			trans	-44	116.8	147.4	45	0	0	0	0	111.7
4	S	49.8	Very low	49	Very low	101 Å²	101	126.4 Å²	126.4	71%	0.706	80%	0.799	S	S	*	*			trans	-112.9	82.1	156.9	-66	0	0	0	0	107.4	S2 L6	S2-S4 PolarHBondContact O-N 2.77Å; S4-L6 VanDerWaalsContact C-N 3.26Å; S4-L6 PolarHBondContact O-N 2.94Å
5	S	55.8	Low	49.6	Very low	100 Å²	100	123.6 Å²	123.6	70%	0.699	79%	0.785	S	S	*	*			trans	-62.5	92.3	161	50.5	0	0	0	0	107.5	S7	S5-S7 PolarHBondContact O-N 3.12Å
6	L	53.2	Low	49.8	Very low	159 Å²	159	125.5 Å²	125.5	83%	0.832	79%	0.787	S	S	*	*			trans	-68.8	86.2	159.9	-85.7	89.1	0	0	0	106.7	S4	S4-L6 VanDerWaalsContact C-N 3.26Å; S4-L6 PolarHBondContact O-N 2.94Å
7	S	52.3	Low	50.2	Low	94 Å²	94	120.9 Å²	120.9	66%	0.657	77%	0.77	S	S	*	*			trans	-55.4	131.4	159.9	-65.8	0	0	0	0	107.5	S5 A9	S5-S7 PolarHBondContact O-N 3.12Å; S7-A9 PolarHBondContact O-N 2.7Å
8	P	52.7	Low	50.9	Low	131 Å²	131	119.8 Å²	119.8	85%	0.851	76%	0.757	S	S	*	*			trans	-64.5	100.3	179.6	24.6	-30.7	0	0	0	108.3	G10	P8-G10 PolarHBondContact O-N 2.79Å; P8-G10 VanDerWaalsContact O-N 3.16Å
9	A	49.7	Very low	52.6	Low	100 Å²	100	117.2 Å²	117.2	83%	0.826	74%	0.743	S	S	*	*			trans	-56.6	120.2	175.2	0	0	0	0	0	108.7	S7	S7-A9 PolarHBondContact O-N 2.7Å
10	G	41.9	Very low	54.3	Low	58 Å²	58	115.4 Å²	115.4	60%	0.598	74%	0.739	S	S	*	*			trans	55.3	87.3	153.7	0	0	0	0	0	115.4	P8 T12	P8-G10 PolarHBondContact O-N 2.79Å; P8-G10 VanDerWaalsContact O-N 3.16Å; G10-T12 PolarHBondContact O-N 3.32Å
11	R	45.2	Very low	56.1	Low	247 Å²	247	113.3 Å²	113.3	93%	0.932	73%	0.733	S	S	*	*			trans	-65.1	75.9	139.3	-65	174.6	66.4	-128.2	0.8	106.7	S13	R11-S13 PolarHBondContact O-N 3.25Å
12	T	46.4	Very low	58.4	Low	128 Å²	128	105 Å²	105	79%	0.785	69%	0.693	S	S	*	*			trans	-61.7	112.2	159.2	47.7	0	0	0	0	104.4	G10 G14	G10-T12 PolarHBondContact O-N 3.32Å; T12-G14 PolarHBondContact O-N 2.92Å
13	S	52.3	Low	60.6	Low	118 Å²	118	101.9 Å²	101.9	83%	0.825	67%	0.669	S	S	*	*			trans	-64.2	76.5	164.2	-178.3	0	0	0	0	106.2	R11 S15	R11-S13 PolarHBondContact O-N 3.25Å; S13-S15 PolarHBondContact O-N 3.04Å
14	G	48.9	Very low	62.8	Low	69 Å²	69	104 Å²	104	71%	0.711	66%	0.659	S	S	*	*			trans	-67.1	75.6	165.7	0	0	0	0	0	107.3	T12	T12-G14 PolarHBondContact O-N 2.92Å
15	S	57.8	Low	64.9	Low	84 Å²	84	106.4 Å²	106.4	59%	0.587	65%	0.653	S	S	*	*			trans	-50.6	144.9	144.5	-168.3	0	0	0	0	106.7	S13	S13-S15 PolarHBondContact O-N 3.04Å
16	D	52.1	Low	66.8	Low	154 Å²	154	108.4 Å²	108.4	82%	0.824	65%	0.645	S	S	*	*	S	Bend	trans	89.4	83.5	167.4	-40.6	-24.9	0	0	0	113.8
17	G	56.6	Low	68.7	Low	48 Å²	48	105.9 Å²	105.9	50%	0.495	63%	0.629	S	S	.	*			trans	150.7	19.3	162	0	0	0	0	0	116.7	S19	G17-S19 PolarHBondContact O-N 3.17Å
18	D	64.2	Low	70.8	Confident	100 Å²	100	107.6 Å²	107.6	54%	0.535	63%	0.625	S	S	.	*			trans	-69.7	67.2	163.7	-137.6	26.5	0	0	0	108.1	T23 R26	D18-T23 HydrophobicContact CB-CG2 4.26Å; D18-T23 VanDerWaalsContact OD2-CG2 3.24Å; D18-T23 WeakPolarHBondContact OD2-CG2 3.41Å; D18-R26 IonicContact OD1-CZ 3.86Å; D18-R26 VanDerWaalsContact OD1-CZ 3.31Å; D18-R26 IonicContact OD1-NE 3.59Å; D18-R26 IonicContact OD1-NH1 3.31Å; D18-R26 PolarHBondContact OD1-NH1 2.9Å; D18-R26 IonicContact OD1-NH2 3.4Å
19	S	81.9	Confident	72.9	Confident	71 Å²	71	108.9 Å²	108.9	50%	0.497	61%	0.613	S	S	.	*			trans	-59.2	146.2	172.9	-64	0	0	0	0	107.1	G17 A21 D22 T23	G17-S19 PolarHBondContact O-N 3.17Å; S19-A21 PolarHBondContact O-N 2.99Å; S19-D22 WeakPolarHBondContact O-CA 3.43Å; S19-D22 WeakPolarHBondContact O-CB 3.44Å; S19-D22 PolarHBondContact O-N 2.92Å; S19-T23 PolarHBondContact O-N 2.89Å; S19-T23 VanDerWaalsContact O-N 3.12Å
20	A	87.6	Confident	75.2	Confident	81 Å²	81	112.5 Å²	112.5	67%	0.669	61%	0.605	S	S	*	*	H	α-helix	trans	-52.5	-25.7	174.5	0	0	0	0	0	112.9	T23 R24	A20-T23 WeakPolarHBondContact CA-OG1 3.42Å; A20-T23 PolarHBondContact O-OG1 3.15Å; A20-R24 WeakPolarHBondContact O-CB 3.49Å; A20-R24 PolarHBondContact O-N 3.02Å; A20-R24 VanDerWaalsContact O-N 3.17Å
21	A	90.8	Very high	77.8	Confident	72 Å²	72	114.7 Å²	114.7	60%	0.595	60%	0.602	S	S	*	*	H	α-helix	trans	-68.5	-40.1	171.9	0	0	0	0	0	113.4	S19 R25	S19-A21 PolarHBondContact O-N 2.99Å; A21-R25 WeakPolarHBondContact O-CB 3.28Å; A21-R25 PolarHBondContact O-N 3.16Å
22	D	92.3	Very high	80.3	Confident	63 Å²	63	106.4 Å²	106.4	34%	0.337	58%	0.582	S	S	.	*	H	α-helix	trans	-71.7	-44	-178.3	-120.2	42.2	0	0	0	111.2	S19 R25 R26	S19-D22 WeakPolarHBondContact O-CA 3.43Å; S19-D22 WeakPolarHBondContact O-CB 3.44Å; S19-D22 PolarHBondContact O-N 2.92Å; D22-R25 PolarHBondContact O-N 3.4Å; D22-R26 VanDerWaalsContact O-CG 3.28Å; D22-R26 WeakPolarHBondContact O-CG 3.38Å; D22-R26 PolarHBondContact O-N 3.28Å; D22-R26 IonicContact OD2-NH2 3.74Å
23	T	93	Very high	82.8	Confident	45 Å²	45	105.5 Å²	105.5	28%	0.276	57%	0.573	S	S	.	*	H	α-helix	trans	-59.2	-48.6	171.8	57.1	0	0	0	0	111	D18 S19 A20 R25 R26 E27	D18-T23 HydrophobicContact CB-CG2 4.26Å; D18-T23 VanDerWaalsContact OD2-CG2 3.24Å; D18-T23 WeakPolarHBondContact OD2-CG2 3.41Å; S19-T23 PolarHBondContact O-N 2.89Å; S19-T23 VanDerWaalsContact O-N 3.12Å; A20-T23 WeakPolarHBondContact CA-OG1 3.42Å; A20-T23 PolarHBondContact O-OG1 3.15Å; T23-R25 VanDerWaalsContact C-N 3.31Å; T23-R25 PolarHBondContact O-N 3.01Å; T23-R26 WeakPolarHBondContact O-CB 3.34Å; T23-R26 PolarHBondContact O-N 3.06Å; T23-R26 VanDerWaalsContact O-N 3.15Å; T23-E27 WeakPolarHBondContact O-CG 3.22Å; T23-E27 PolarHBondContact O-N 2.76Å
24	R	93.7	Very high	85	Confident	160 Å²	160	108.9 Å²	108.9	60%	0.604	57%	0.567	S	S	*	*	H	α-helix	trans	-59.6	-38.4	176.2	-171.9	177.3	-172.7	-172.5	2.7	112.7	A20 K28	A20-R24 WeakPolarHBondContact O-CB 3.49Å; A20-R24 PolarHBondContact O-N 3.02Å; A20-R24 VanDerWaalsContact O-N 3.17Å; R24-K28 WeakPolarHBondContact O-CG 3.24Å; R24-K28 PolarHBondContact O-N 2.85Å
25	R	95.2	Very high	87.3	Confident	152 Å²	152	109.1 Å²	109.1	57%	0.574	55%	0.55	S	S	*	.	H	α-helix	trans	-67	-42.8	175.8	-176.6	177.4	178.1	-118.5	2.9	111.5	A21 D22 T23 K28 R29	A21-R25 WeakPolarHBondContact O-CB 3.28Å; A21-R25 PolarHBondContact O-N 3.16Å; D22-R25 PolarHBondContact O-N 3.4Å; T23-R25 VanDerWaalsContact C-N 3.31Å; T23-R25 PolarHBondContact O-N 3.01Å; R25-K28 PolarHBondContact O-N 3.17Å; R25-R29 WeakPolarHBondContact O-CG 3.34Å; R25-R29 PolarHBondContact O-N 2.87Å
26	R	94.3	Very high	89.3	Confident	143 Å²	143	107.3 Å²	107.3	54%	0.54	54%	0.537	S	S	.	.	H	α-helix	trans	-62.4	-43.2	175.8	-70	169.8	-170.9	-169.3	3.3	111.3	D18 D22 T23 R29 R30	D18-R26 IonicContact OD1-CZ 3.86Å; D18-R26 VanDerWaalsContact OD1-CZ 3.31Å; D18-R26 IonicContact OD1-NE 3.59Å; D18-R26 IonicContact OD1-NH1 3.31Å; D18-R26 PolarHBondContact OD1-NH1 2.9Å; D18-R26 IonicContact OD1-NH2 3.4Å; D22-R26 VanDerWaalsContact O-CG 3.28Å; D22-R26 WeakPolarHBondContact O-CG 3.38Å; D22-R26 PolarHBondContact O-N 3.28Å; D22-R26 IonicContact OD2-NH2 3.74Å; T23-R26 WeakPolarHBondContact O-CB 3.34Å; T23-R26 PolarHBondContact O-N 3.06Å; T23-R26 VanDerWaalsContact O-N 3.15Å; R26-R29 PolarHBondContact O-N 2.96Å; R26-R30 WeakPolarHBondContact O-CB 3.38Å; R26-R30 PolarHBondContact O-N 3.45Å
27	E	94.8	Very high	91.5	Very high	106 Å²	106	101.7 Å²	101.7	50%	0.495	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-47.1	175.7	-73.3	178.7	170.7	0	0	112.5	T23 R29 R30 L31	T23-E27 WeakPolarHBondContact O-CG 3.22Å; T23-E27 PolarHBondContact O-N 2.76Å; E27-R29 VanDerWaalsContact C-N 3.32Å; E27-R29 PolarHBondContact O-N 3.32Å; E27-R30 WeakPolarHBondContact O-CB 3.46Å; E27-R30 PolarHBondContact O-N 3.44Å; E27-L31 WeakPolarHBondContact O-CG 3.49Å; E27-L31 PolarHBondContact O-N 2.97Å
28	K	96.5	Very high	93.5	Very high	130 Å²	130	107.2 Å²	107.2	57%	0.565	52%	0.518	S	S	*	.	H	α-helix	trans	-57.5	-43.8	174.4	-75.5	178.7	179.3	-174.8	0	111.9	R24 R25 L31 S32	R24-K28 WeakPolarHBondContact O-CG 3.24Å; R24-K28 PolarHBondContact O-N 2.85Å; R25-K28 PolarHBondContact O-N 3.17Å; K28-L31 PolarHBondContact O-N 2.87Å; K28-S32 WeakPolarHBondContact O-CB 3.33Å; K28-S32 PolarHBondContact O-N 2.84Å
29	R	96.3	Very high	95.1	Very high	158 Å²	158	108.8 Å²	108.8	60%	0.596	52%	0.517	S	S	*	.	H	α-helix	trans	-64.2	-40.5	176.3	-73.5	176.6	69.1	-170.9	1.7	112	R25 R26 E27 S32 N33	R25-R29 WeakPolarHBondContact O-CG 3.34Å; R25-R29 PolarHBondContact O-N 2.87Å; R26-R29 PolarHBondContact O-N 2.96Å; E27-R29 VanDerWaalsContact C-N 3.32Å; E27-R29 PolarHBondContact O-N 3.32Å; R29-S32 PolarHBondContact O-N 3.16Å; R29-N33 WeakPolarHBondContact O-CB 3.33Å; R29-N33 PolarHBondContact O-N 3.5Å
30	R	97.2	Very high	95.9	Very high	176 Å²	176	108.5 Å²	108.5	66%	0.664	51%	0.514	S	S	*	.	H	α-helix	trans	-61.3	-46.5	176.6	-172.2	-177.1	71.4	177.4	-0.2	111.4	R26 E27 N33 R34	R26-R30 WeakPolarHBondContact O-CB 3.38Å; R26-R30 PolarHBondContact O-N 3.45Å; E27-R30 WeakPolarHBondContact O-CB 3.46Å; E27-R30 PolarHBondContact O-N 3.44Å; R30-N33 PolarHBondContact O-N 2.95Å; R30-R34 WeakPolarHBondContact O-CB 3.48Å; R30-R34 PolarHBondContact O-N 2.98Å
31	L	97.4	Very high	96.4	Very high	104 Å²	104	113.9 Å²	113.9	55%	0.545	52%	0.517	S	S	.	.	H	α-helix	trans	-65.8	-45.2	177.1	-67.3	175.4	0	0	0	111.7	E27 K28 N33 R34 E35	E27-L31 WeakPolarHBondContact O-CG 3.49Å; E27-L31 PolarHBondContact O-N 2.97Å; K28-L31 PolarHBondContact O-N 2.87Å; L31-N33 PolarHBondContact O-N 2.85Å; L31-R34 WeakPolarHBondContact O-CB 3.47Å; L31-R34 PolarHBondContact O-N 2.82Å; L31-E35 PolarHBondContact O-N 3.39Å
32	S	98	Very high	96.8	Very high	73 Å²	73	114.9 Å²	114.9	51%	0.51	51%	0.512	S	S	.	.	H	α-helix	trans	-62	-41.4	176.6	-176.7	0	0	0	0	112.4	K28 R29 E35 S36	K28-S32 WeakPolarHBondContact O-CB 3.33Å; K28-S32 PolarHBondContact O-N 2.84Å; R29-S32 PolarHBondContact O-N 3.16Å; S32-E35 PolarHBondContact O-N 3.44Å; S32-S36 WeakPolarHBondContact O-CB 3.49Å; S32-S36 PolarHBondContact O-N 2.95Å; S32-S36 PolarHBondContact O-OG 3.45Å
33	N	98.3	Very high	97.1	Very high	109 Å²	109	119.8 Å²	119.8	58%	0.583	53%	0.526	S	S	*	.	H	α-helix	trans	-67.7	-40.9	178.1	-176.1	-85	0	0	0	111.3	R29 R30 L31 E35 S36 A37	R29-N33 WeakPolarHBondContact O-CB 3.33Å; R29-N33 PolarHBondContact O-N 3.5Å; R30-N33 PolarHBondContact O-N 2.95Å; L31-N33 PolarHBondContact O-N 2.85Å; N33-E35 VanDerWaalsContact C-N 3.31Å; N33-E35 PolarHBondContact O-N 2.92Å; N33-S36 WeakPolarHBondContact CA-OG 3.36Å; N33-S36 PolarHBondContact O-N 3.38Å; N33-S36 PolarHBondContact O-OG 2.94Å; N33-A37 WeakPolarHBondContact O-CB 3.48Å; N33-A37 PolarHBondContact O-N 3.36Å
34	R	98.2	Very high	97.3	Very high	188 Å²	188	124.5 Å²	124.5	71%	0.709	54%	0.543	S	S	*	.	H	α-helix	trans	-57.5	-46.6	173	-177.3	177.3	179.8	170	0.4	110.9	R30 L31 A37 R38	R30-R34 WeakPolarHBondContact O-CB 3.48Å; R30-R34 PolarHBondContact O-N 2.98Å; L31-R34 WeakPolarHBondContact O-CB 3.47Å; L31-R34 PolarHBondContact O-N 2.82Å; R34-A37 PolarHBondContact O-N 3.3Å; R34-R38 WeakPolarHBondContact O-CB 3.21Å; R34-R38 PolarHBondContact O-N 3.45Å
35	E	98.2	Very high	97.6	Very high	74 Å²	74	121.5 Å²	121.5	35%	0.346	54%	0.536	S	S	.	.	H	α-helix	trans	-70	-40.1	179.4	-170.6	54.6	-144.5	0	0	112.4	L31 S32 N33 R38 R39	L31-E35 PolarHBondContact O-N 3.39Å; S32-E35 PolarHBondContact O-N 3.44Å; N33-E35 VanDerWaalsContact C-N 3.31Å; N33-E35 PolarHBondContact O-N 2.92Å; E35-R38 PolarHBondContact O-N 3.47Å; E35-R38 IonicContact OE1-NH1 3.5Å; E35-R39 WeakPolarHBondContact O-CB 3.44Å; E35-R39 WeakPolarHBondContact O-CG 3.2Å; E35-R39 PolarHBondContact O-N 3.35Å
36	S	98.3	Very high	97.7	Very high	47 Å²	47	118.7 Å²	118.7	33%	0.329	53%	0.529	S	S	.	.	H	α-helix	trans	-66.1	-37.7	174.8	60.6	0	0	0	0	112.3	S32 N33 R39 S40	S32-S36 WeakPolarHBondContact O-CB 3.49Å; S32-S36 PolarHBondContact O-N 2.95Å; S32-S36 PolarHBondContact O-OG 3.45Å; N33-S36 WeakPolarHBondContact CA-OG 3.36Å; N33-S36 PolarHBondContact O-N 3.38Å; N33-S36 PolarHBondContact O-OG 2.94Å; S36-R39 PolarHBondContact O-N 2.8Å; S36-S40 VanDerWaalsContact O-CB 3.3Å; S36-S40 WeakPolarHBondContact O-CB 3.42Å; S36-S40 PolarHBondContact O-N 2.91Å
37	A	98.2	Very high	97.9	Very high	35 Å²	35	116.9 Å²	116.9	29%	0.289	53%	0.526	S	S	.	.	H	α-helix	trans	-65.3	-42.9	175	0	0	0	0	0	111	N33 R34 S40 R41	N33-A37 WeakPolarHBondContact O-CB 3.48Å; N33-A37 PolarHBondContact O-N 3.36Å; R34-A37 PolarHBondContact O-N 3.3Å; A37-S40 PolarHBondContact O-N 2.98Å; A37-R41 WeakPolarHBondContact O-CB 3.48Å; A37-R41 VanDerWaalsContact O-CG 3.3Å; A37-R41 WeakPolarHBondContact O-CG 3.49Å; A37-R41 PolarHBondContact O-N 3.26Å
38	R	98.3	Very high	98.1	Very high	164 Å²	164	116 Å²	116	62%	0.619	52%	0.524	S	S	*	.	H	α-helix	trans	-59.1	-50.8	173.7	-177.7	179.6	174.9	-118.3	-0.1	111.4	R34 E35 S40 R41 L42	R34-R38 WeakPolarHBondContact O-CB 3.21Å; R34-R38 PolarHBondContact O-N 3.45Å; E35-R38 PolarHBondContact O-N 3.47Å; E35-R38 IonicContact OE1-NH1 3.5Å; R38-S40 VanDerWaalsContact C-N 3.33Å; R38-S40 PolarHBondContact O-N 3.47Å; R38-R41 PolarHBondContact O-N 2.85Å; R38-L42 PolarHBondContact O-N 3.42Å
39	R	98.5	Very high	98.2	Very high	134 Å²	134	113.2 Å²	113.2	51%	0.506	52%	0.516	S	S	.	.	H	α-helix	trans	-60.5	-40.2	176.9	-72.2	-176.9	-67.4	179.4	-0.8	112.5	E35 S36 L42 R43	E35-R39 WeakPolarHBondContact O-CB 3.44Å; E35-R39 WeakPolarHBondContact O-CG 3.2Å; E35-R39 PolarHBondContact O-N 3.35Å; S36-R39 PolarHBondContact O-N 2.8Å; R39-L42 PolarHBondContact O-N 3.34Å; R39-R43 WeakPolarHBondContact O-CG 3.3Å; R39-R43 PolarHBondContact O-N 3.42Å
40	S	98.6	Very high	98.3	Very high	64 Å²	64	111.1 Å²	111.1	45%	0.448	51%	0.513	S	S	.	.	H	α-helix	trans	-64.8	-42.8	176.7	-165.6	0	0	0	0	112.1	S36 A37 R38 K44	S36-S40 VanDerWaalsContact O-CB 3.3Å; S36-S40 WeakPolarHBondContact O-CB 3.42Å; S36-S40 PolarHBondContact O-N 2.91Å; A37-S40 PolarHBondContact O-N 2.98Å; R38-S40 VanDerWaalsContact C-N 3.33Å; R38-S40 PolarHBondContact O-N 3.47Å; S40-K44 WeakPolarHBondContact O-CB 3.32Å; S40-K44 PolarHBondContact O-N 2.88Å
41	R	98.5	Very high	98.4	Very high	195 Å²	195	106.5 Å²	106.5	74%	0.736	50%	0.501	S	S	*	.	H	α-helix	trans	-63.5	-43.1	175.4	-72.4	173.7	-173.7	-178	1.1	111.3	A37 R38 K44 Q45	A37-R41 WeakPolarHBondContact O-CB 3.48Å; A37-R41 VanDerWaalsContact O-CG 3.3Å; A37-R41 WeakPolarHBondContact O-CG 3.49Å; A37-R41 PolarHBondContact O-N 3.26Å; R38-R41 PolarHBondContact O-N 2.85Å; R41-K44 PolarHBondContact O-N 3.16Å; R41-Q45 WeakPolarHBondContact O-CB 3.49Å; R41-Q45 PolarHBondContact O-N 3.39Å
42	L	98.5	Very high	98.4	Very high	93 Å²	93	104.5 Å²	104.5	49%	0.487	50%	0.499	S	S	.	.	H	α-helix	trans	-62.5	-48	178.2	-176.6	62.4	0	0	0	112	R38 R39 K44 Q45 Q46	R38-L42 PolarHBondContact O-N 3.42Å; R39-L42 PolarHBondContact O-N 3.34Å; L42-K44 VanDerWaalsContact C-N 3.31Å; L42-K44 PolarHBondContact O-N 3.07Å; L42-Q45 WeakPolarHBondContact O-CB 3.3Å; L42-Q45 PolarHBondContact O-N 3.47Å; L42-Q45 VanDerWaalsContact O-N 3.16Å; L42-Q46 HydrophobicContact CD1-CG 4.5Å; L42-Q46 WeakPolarHBondContact O-CG 3.49Å; L42-Q46 PolarHBondContact O-N 3.05Å
43	R	98.5	Very high	98.5	Very high	166 Å²	166	107 Å²	107	63%	0.626	50%	0.503	S	S	*	.	H	α-helix	trans	-59.9	-41	176.3	-72.9	-174.4	-65.4	-166.1	3.9	112.4	R39 Q46 H47	R39-R43 WeakPolarHBondContact O-CG 3.3Å; R39-R43 PolarHBondContact O-N 3.42Å; R43-Q46 PolarHBondContact O-N 2.91Å; R43-H47 PolarHBondContact O-N 3.38Å
44	K	98.5	Very high	98.5	Very high	144 Å²	144	107 Å²	107	63%	0.626	50%	0.499	S	S	*	.	H	α-helix	trans	-65.3	-40.4	176	-171.7	173.3	-178.1	176.6	0	111.6	S40 R41 L42 H47 L48	S40-K44 WeakPolarHBondContact O-CB 3.32Å; S40-K44 PolarHBondContact O-N 2.88Å; R41-K44 PolarHBondContact O-N 3.16Å; L42-K44 VanDerWaalsContact C-N 3.31Å; L42-K44 PolarHBondContact O-N 3.07Å; K44-H47 PolarHBondContact O-N 3.19Å; K44-L48 HydrophobicContact CG-CD1 4.42Å; K44-L48 VanDerWaalsContact O-CG 3.3Å; K44-L48 WeakPolarHBondContact O-CG 3.35Å; K44-L48 PolarHBondContact O-N 3.07Å; K44-L48 VanDerWaalsContact O-N 3.07Å
45	Q	98.5	Very high	98.5	Very high	97 Å²	97	100.2 Å²	100.2	45%	0.453	48%	0.484	S	S	.	.	H	α-helix	trans	-63.1	-47.9	175.6	-173.7	62.1	53.9	0	0	111.2	R41 L42 H47 L48 D49	R41-Q45 WeakPolarHBondContact O-CB 3.49Å; R41-Q45 PolarHBondContact O-N 3.39Å; L42-Q45 WeakPolarHBondContact O-CB 3.3Å; L42-Q45 PolarHBondContact O-N 3.47Å; L42-Q45 VanDerWaalsContact O-N 3.16Å; Q45-H47 VanDerWaalsContact C-N 3.32Å; Q45-H47 PolarHBondContact O-N 3.42Å; Q45-L48 WeakPolarHBondContact O-CB 3.31Å; Q45-L48 PolarHBondContact O-N 2.85Å; Q45-L48 VanDerWaalsContact O-N 3.1Å; Q45-D49 PolarHBondContact NE2-OD1 2.92Å; Q45-D49 PolarHBondContact O-N 3.02Å
46	Q	98.6	Very high	98.5	Very high	93 Å²	93	99.2 Å²	99.2	44%	0.435	49%	0.488	S	S	.	.	H	α-helix	trans	-55.8	-46.2	177	-72.8	171.9	-36.7	0	0	111.9	L42 R43 L48 D49 E50	L42-Q46 HydrophobicContact CD1-CG 4.5Å; L42-Q46 WeakPolarHBondContact O-CG 3.49Å; L42-Q46 PolarHBondContact O-N 3.05Å; R43-Q46 PolarHBondContact O-N 2.91Å; Q46-L48 VanDerWaalsContact C-N 3.34Å; Q46-L48 PolarHBondContact O-N 3.35Å; Q46-D49 PolarHBondContact O-N 3.49Å; Q46-E50 VanDerWaalsContact O-CG 3.32Å; Q46-E50 WeakPolarHBondContact O-CG 3.31Å; Q46-E50 PolarHBondContact O-N 2.87Å
47	H	98.5	Very high	98.5	Very high	104 Å²	104	103 Å²	103	48%	0.481	50%	0.504	S	S	.	.	H	α-helix	trans	-63.8	-38.2	177.7	-174.5	52.2	0	0	0	112.8	R43 K44 Q45 E50 L51	R43-H47 PolarHBondContact O-N 3.38Å; K44-H47 PolarHBondContact O-N 3.19Å; Q45-H47 VanDerWaalsContact C-N 3.32Å; Q45-H47 PolarHBondContact O-N 3.42Å; H47-E50 IonicContact ND1-OE2 3.91Å; H47-L51 WeakPolarHBondContact O-CB 3.5Å; H47-L51 VanDerWaalsContact O-CG 3.31Å; H47-L51 WeakPolarHBondContact O-CG 3.3Å; H47-L51 PolarHBondContact O-N 3.1Å
48	L	98.6	Very high	98.6	Very high	87 Å²	87	105.3 Å²	105.3	46%	0.455	51%	0.511	S	S	.	.	H	α-helix	trans	-66.6	-39.1	174.2	-70	172.7	0	0	0	111.7	K44 Q45 Q46 L51 A52	K44-L48 HydrophobicContact CG-CD1 4.42Å; K44-L48 VanDerWaalsContact O-CG 3.3Å; K44-L48 WeakPolarHBondContact O-CG 3.35Å; K44-L48 PolarHBondContact O-N 3.07Å; K44-L48 VanDerWaalsContact O-N 3.07Å; Q45-L48 WeakPolarHBondContact O-CB 3.31Å; Q45-L48 PolarHBondContact O-N 2.85Å; Q45-L48 VanDerWaalsContact O-N 3.1Å; Q46-L48 VanDerWaalsContact C-N 3.34Å; Q46-L48 PolarHBondContact O-N 3.35Å; L48-L51 PolarHBondContact O-N 3.4Å; L48-A52 VanDerWaalsContact O-CB 3.31Å; L48-A52 WeakPolarHBondContact O-CB 3.47Å; L48-A52 PolarHBondContact O-N 3.49Å
49	D	98.6	Very high	98.6	Very high	72 Å²	72	104 Å²	104	39%	0.385	51%	0.512	S	S	.	.	H	α-helix	trans	-66.9	-39.5	177.6	-62.8	-23.3	0	0	0	111.3	Q45 Q46 A52 Q53	Q45-D49 PolarHBondContact NE2-OD1 2.92Å; Q45-D49 PolarHBondContact O-N 3.02Å; Q46-D49 PolarHBondContact O-N 3.49Å; D49-A52 PolarHBondContact O-N 2.92Å; D49-Q53 WeakPolarHBondContact O-CB 3.25Å; D49-Q53 VanDerWaalsContact O-CG 3.25Å; D49-Q53 WeakPolarHBondContact O-CG 3.48Å; D49-Q53 PolarHBondContact O-N 2.88Å; D49-Q53 PolarHBondContact O-NE2 3.48Å
50	E	98.6	Very high	98.6	Very high	115 Å²	115	100.8 Å²	100.8	54%	0.537	51%	0.513	S	S	.	.	H	α-helix	trans	-62.4	-49.5	173.8	-74.5	165.5	-170.4	0	0	111.3	Q46 H47 A52 Q53 E54	Q46-E50 VanDerWaalsContact O-CG 3.32Å; Q46-E50 WeakPolarHBondContact O-CG 3.31Å; Q46-E50 PolarHBondContact O-N 2.87Å; H47-E50 IonicContact ND1-OE2 3.91Å; E50-A52 VanDerWaalsContact C-N 3.32Å; E50-A52 PolarHBondContact O-N 3Å; E50-Q53 WeakPolarHBondContact O-CB 3.5Å; E50-Q53 PolarHBondContact O-N 2.89Å; E50-E54 PolarHBondContact O-N 3.2Å
51	L	98.7	Very high	98.6	Very high	78 Å²	78	102.3 Å²	102.3	41%	0.408	51%	0.514	S	S	.	.	H	α-helix	trans	-62.2	-38.8	177.5	-73.1	173.8	0	0	0	112.2	H47 L48 Q53 E54 A55	H47-L51 WeakPolarHBondContact O-CB 3.5Å; H47-L51 VanDerWaalsContact O-CG 3.31Å; H47-L51 WeakPolarHBondContact O-CG 3.3Å; H47-L51 PolarHBondContact O-N 3.1Å; L48-L51 PolarHBondContact O-N 3.4Å; L51-Q53 VanDerWaalsContact C-N 3.35Å; L51-E54 PolarHBondContact O-N 3.02Å; L51-A55 VanDerWaalsContact O-CB 3.31Å; L51-A55 WeakPolarHBondContact O-CB 3.31Å; L51-A55 PolarHBondContact O-N 2.78Å
52	A	98.5	Very high	98.6	Very high	62 Å²	62	98.2 Å²	98.2	51%	0.512	51%	0.506	S	S	.	.	H	α-helix	trans	-65	-39.9	176.4	0	0	0	0	0	111.7	L48 D49 E50 A56	L48-A52 VanDerWaalsContact O-CB 3.31Å; L48-A52 WeakPolarHBondContact O-CB 3.47Å; L48-A52 PolarHBondContact O-N 3.49Å; D49-A52 PolarHBondContact O-N 2.92Å; E50-A52 VanDerWaalsContact C-N 3.32Å; E50-A52 PolarHBondContact O-N 3Å; A52-A56 WeakPolarHBondContact O-CB 3.35Å; A52-A56 PolarHBondContact O-N 3.28Å; A52-A56 VanDerWaalsContact O-N 3.07Å
53	Q	98.6	Very high	98.6	Very high	125 Å²	125	96.8 Å²	96.8	58%	0.584	51%	0.508	S	S	*	.	H	α-helix	trans	-65.3	-46.7	174.6	-74.6	166.8	66.3	0	0	111.5	D49 E50 L51 A55 A56 L57	D49-Q53 WeakPolarHBondContact O-CB 3.25Å; D49-Q53 VanDerWaalsContact O-CG 3.25Å; D49-Q53 WeakPolarHBondContact O-CG 3.48Å; D49-Q53 PolarHBondContact O-N 2.88Å; D49-Q53 PolarHBondContact O-NE2 3.48Å; E50-Q53 WeakPolarHBondContact O-CB 3.5Å; E50-Q53 PolarHBondContact O-N 2.89Å; L51-Q53 VanDerWaalsContact C-N 3.35Å; Q53-A55 PolarHBondContact O-N 2.86Å; Q53-A56 PolarHBondContact O-N 2.93Å; Q53-L57 WeakPolarHBondContact O-CG 3.43Å; Q53-L57 PolarHBondContact O-N 2.89Å
54	E	98.6	Very high	98.6	Very high	110 Å²	110	94.9 Å²	94.9	51%	0.514	50%	0.501	S	S	.	.	H	α-helix	trans	-61.4	-44.6	178.4	-173.1	177.7	-176.5	0	0	111.5	E50 L51 A56 L57 L58	E50-E54 PolarHBondContact O-N 3.2Å; L51-E54 PolarHBondContact O-N 3.02Å; E54-A56 VanDerWaalsContact C-N 3.33Å; E54-A56 PolarHBondContact O-N 2.85Å; E54-L57 PolarHBondContact O-N 3.24Å; E54-L58 HydrophobicContact CG-CD1 4.08Å; E54-L58 HydrophobicContact CG-CG 4.47Å; E54-L58 WeakPolarHBondContact O-CB 3.37Å; E54-L58 WeakPolarHBondContact O-CG 3.47Å; E54-L58 PolarHBondContact O-N 3.24Å
55	A	98.7	Very high	98.6	Very high	46 Å²	46	91.5 Å²	91.5	38%	0.38	49%	0.492	S	S	.	.	H	α-helix	trans	-60.3	-42.2	175.9	0	0	0	0	0	112	L51 Q53 L58 Q59	L51-A55 VanDerWaalsContact O-CB 3.31Å; L51-A55 WeakPolarHBondContact O-CB 3.31Å; L51-A55 PolarHBondContact O-N 2.78Å; Q53-A55 PolarHBondContact O-N 2.86Å; A55-L58 PolarHBondContact O-N 3.07Å; A55-Q59 WeakPolarHBondContact O-CB 3.49Å; A55-Q59 WeakPolarHBondContact O-CG 3.49Å; A55-Q59 PolarHBondContact O-N 3.48Å
56	A	98.5	Very high	98.6	Very high	53 Å²	53	89.8 Å²	89.8	44%	0.438	49%	0.494	S	S	.	.	H	α-helix	trans	-65.2	-40.7	176.9	0	0	0	0	0	112.2	A52 Q53 E54 Q59 A60	A52-A56 WeakPolarHBondContact O-CB 3.35Å; A52-A56 PolarHBondContact O-N 3.28Å; A52-A56 VanDerWaalsContact O-N 3.07Å; Q53-A56 PolarHBondContact O-N 2.93Å; E54-A56 VanDerWaalsContact C-N 3.33Å; E54-A56 PolarHBondContact O-N 2.85Å; A56-Q59 PolarHBondContact O-N 3.49Å; A56-A60 WeakPolarHBondContact O-CB 3.38Å; A56-A60 PolarHBondContact O-N 2.91Å
57	L	98.7	Very high	98.6	Very high	125 Å²	125	88.2 Å²	88.2	65%	0.654	50%	0.498	S	S	*	.	H	α-helix	trans	-63.4	-47.8	175.6	-71.6	173.7	0	0	0	111.6	Q53 E54 Q59 A60 E61	Q53-L57 WeakPolarHBondContact O-CG 3.43Å; Q53-L57 PolarHBondContact O-N 2.89Å; E54-L57 PolarHBondContact O-N 3.24Å; L57-Q59 VanDerWaalsContact C-N 3.32Å; L57-Q59 PolarHBondContact O-N 2.94Å; L57-A60 PolarHBondContact O-N 3.41Å; L57-E61 WeakPolarHBondContact O-CB 3.29Å; L57-E61 PolarHBondContact O-N 2.68Å
58	L	98.7	Very high	98.6	Very high	84 Å²	84	90.7 Å²	90.7	44%	0.44	50%	0.503	S	S	.	.	H	α-helix	trans	-63.7	-37.3	177.7	-71.1	173	0	0	0	112	E54 A55 E61 N62	E54-L58 HydrophobicContact CG-CD1 4.08Å; E54-L58 HydrophobicContact CG-CG 4.47Å; E54-L58 WeakPolarHBondContact O-CB 3.37Å; E54-L58 WeakPolarHBondContact O-CG 3.47Å; E54-L58 PolarHBondContact O-N 3.24Å; A55-L58 PolarHBondContact O-N 3.07Å; L58-E61 PolarHBondContact O-N 3.3Å; L58-N62 VanDerWaalsContact O-CB 3.29Å; L58-N62 WeakPolarHBondContact O-CB 3.21Å; L58-N62 VanDerWaalsContact O-CG 3.27Å; L58-N62 PolarHBondContact O-N 3.45Å; L58-N62 PolarHBondContact O-ND2 3.24Å; L58-N62 VanDerWaalsContact O-ND2 3.14Å
59	Q	98.7	Very high	98.6	Very high	138 Å²	138	89.3 Å²	89.3	65%	0.645	50%	0.504	S	S	*	.	H	α-helix	trans	-63.4	-45.1	173.7	-77.6	174.3	0.2	0	0	111.9	A55 A56 L57 N62 A63	A55-Q59 WeakPolarHBondContact O-CB 3.49Å; A55-Q59 WeakPolarHBondContact O-CG 3.49Å; A55-Q59 PolarHBondContact O-N 3.48Å; A56-Q59 PolarHBondContact O-N 3.49Å; L57-Q59 VanDerWaalsContact C-N 3.32Å; L57-Q59 PolarHBondContact O-N 2.94Å; Q59-N62 PolarHBondContact O-N 3.44Å; Q59-A63 WeakPolarHBondContact O-CB 3.37Å; Q59-A63 PolarHBondContact O-N 3Å
60	A	98.6	Very high	98.5	Very high	65 Å²	65	88.9 Å²	88.9	54%	0.537	51%	0.51	S	S	.	.	H	α-helix	trans	-64.2	-40.2	176.6	0	0	0	0	0	111.9	A56 L57 A63 R64	A56-A60 WeakPolarHBondContact O-CB 3.38Å; A56-A60 PolarHBondContact O-N 2.91Å; L57-A60 PolarHBondContact O-N 3.41Å; A60-A63 PolarHBondContact O-N 3.45Å; A60-R64 WeakPolarHBondContact O-CB 3.12Å; A60-R64 PolarHBondContact O-N 3.14Å
61	E	98.6	Very high	98.5	Very high	96 Å²	96	87.3 Å²	87.3	45%	0.449	51%	0.506	S	S	.	.	H	α-helix	trans	-66.1	-45.9	176	-179.1	162.7	-148.2	0	0	112.1	L57 L58 A63 R64 V65	L57-E61 WeakPolarHBondContact O-CB 3.29Å; L57-E61 PolarHBondContact O-N 2.68Å; L58-E61 PolarHBondContact O-N 3.3Å; E61-A63 VanDerWaalsContact C-N 3.31Å; E61-A63 PolarHBondContact O-N 2.87Å; E61-R64 WeakPolarHBondContact O-CB 3.42Å; E61-R64 PolarHBondContact O-N 2.86Å; E61-R64 VanDerWaalsContact O-N 3.1Å; E61-R64 IonicContact OE1-NH2 3.06Å; E61-V65 HydrophobicContact CG-CG2 4.28Å; E61-V65 WeakPolarHBondContact O-CG2 3.31Å; E61-V65 PolarHBondContact O-N 3.05Å
62	N	98.6	Very high	98.4	Very high	109 Å²	109	87.8 Å²	87.8	58%	0.583	51%	0.512	S	S	*	.	H	α-helix	trans	-58.3	-43.6	175.5	-80	-34.5	0	0	0	111.5	L58 Q59 R64 V65 A66	L58-N62 VanDerWaalsContact O-CB 3.29Å; L58-N62 WeakPolarHBondContact O-CB 3.21Å; L58-N62 VanDerWaalsContact O-CG 3.27Å; L58-N62 PolarHBondContact O-N 3.45Å; L58-N62 PolarHBondContact O-ND2 3.24Å; L58-N62 VanDerWaalsContact O-ND2 3.14Å; Q59-N62 PolarHBondContact O-N 3.44Å; N62-R64 VanDerWaalsContact C-N 3.34Å; N62-R64 PolarHBondContact O-N 3.46Å; N62-V65 PolarHBondContact O-N 3.49Å; N62-A66 VanDerWaalsContact O-CB 3.31Å; N62-A66 WeakPolarHBondContact O-CB 3.44Å; N62-A66 PolarHBondContact O-N 3.47Å
63	A	98.5	Very high	98.4	Very high	63 Å²	63	87.7 Å²	87.7	52%	0.521	51%	0.51	S	S	.	.	H	α-helix	trans	-61.8	-41.5	175.2	0	0	0	0	0	111.9	Q59 A60 E61 A66 A67	Q59-A63 WeakPolarHBondContact O-CB 3.37Å; Q59-A63 PolarHBondContact O-N 3Å; A60-A63 PolarHBondContact O-N 3.45Å; E61-A63 VanDerWaalsContact C-N 3.31Å; E61-A63 PolarHBondContact O-N 2.87Å; A63-A66 PolarHBondContact O-N 3.49Å; A63-A67 WeakPolarHBondContact O-CB 3.44Å; A63-A67 PolarHBondContact O-N 3.44Å
64	R	98.5	Very high	98.3	Very high	126 Å²	126	85 Å²	85	48%	0.475	51%	0.505	S	S	.	.	H	α-helix	trans	-64.2	-43.7	176.4	-173.1	-174	72.7	122.7	-0.5	112.2	A60 E61 N62 A67 R68	A60-R64 WeakPolarHBondContact O-CB 3.12Å; A60-R64 PolarHBondContact O-N 3.14Å; E61-R64 WeakPolarHBondContact O-CB 3.42Å; E61-R64 PolarHBondContact O-N 2.86Å; E61-R64 VanDerWaalsContact O-N 3.1Å; E61-R64 IonicContact OE1-NH2 3.06Å; N62-R64 VanDerWaalsContact C-N 3.34Å; N62-R64 PolarHBondContact O-N 3.46Å; R64-A67 PolarHBondContact O-N 2.92Å; R64-R68 WeakPolarHBondContact O-CG 3.4Å; R64-R68 PolarHBondContact O-N 3.06Å
65	V	98.5	Very high	98.2	Very high	73 Å²	73	83.9 Å²	83.9	44%	0.442	50%	0.5	S	S	.	.	H	α-helix	trans	-66.4	-43.5	178.4	172.3	0	0	0	0	110.3	E61 N62 A67 R68 A69	E61-V65 HydrophobicContact CG-CG2 4.28Å; E61-V65 WeakPolarHBondContact O-CG2 3.31Å; E61-V65 PolarHBondContact O-N 3.05Å; N62-V65 PolarHBondContact O-N 3.49Å; V65-A67 PolarHBondContact O-N 2.98Å; V65-R68 PolarHBondContact O-N 3.47Å; V65-A69 WeakPolarHBondContact O-CB 3.43Å; V65-A69 PolarHBondContact O-N 3.1Å
66	A	98.4	Very high	98.1	Very high	61 Å²	61	85.4 Å²	85.4	50%	0.504	50%	0.502	S	S	.	.	H	α-helix	trans	-60.4	-43.8	176.1	0	0	0	0	0	112.1	N62 A63 R68 A69 A70	N62-A66 VanDerWaalsContact O-CB 3.31Å; N62-A66 WeakPolarHBondContact O-CB 3.44Å; N62-A66 PolarHBondContact O-N 3.47Å; A63-A66 PolarHBondContact O-N 3.49Å; A66-R68 PolarHBondContact O-N 3.25Å; A66-A69 PolarHBondContact O-N 2.86Å; A66-A70 PolarHBondContact O-N 3.37Å
67	A	98.4	Very high	97.9	Very high	61 Å²	61	85.8 Å²	85.8	50%	0.504	51%	0.505	S	S	.	.	H	α-helix	trans	-62.1	-42.7	176	0	0	0	0	0	112.2	A63 R64 V65 A70 D71	A63-A67 WeakPolarHBondContact O-CB 3.44Å; A63-A67 PolarHBondContact O-N 3.44Å; R64-A67 PolarHBondContact O-N 2.92Å; V65-A67 PolarHBondContact O-N 2.98Å; A67-A70 PolarHBondContact O-N 3.39Å; A67-D71 PolarHBondContact O-N 2.89Å
68	R	98.5	Very high	97.7	Very high	156 Å²	156	87 Å²	87	59%	0.589	50%	0.501	S	S	*	.	H	α-helix	trans	-64.6	-41.1	175.2	-75.1	-179.1	178.7	-126.8	-1.9	112.5	R64 V65 A66 A70 D71 V72	R64-R68 WeakPolarHBondContact O-CG 3.4Å; R64-R68 PolarHBondContact O-N 3.06Å; V65-R68 PolarHBondContact O-N 3.47Å; A66-R68 PolarHBondContact O-N 3.25Å; R68-A70 VanDerWaalsContact C-N 3.32Å; R68-A70 PolarHBondContact O-N 2.98Å; R68-D71 PolarHBondContact O-N 3.46Å; R68-V72 WeakPolarHBondContact O-CG2 3.36Å; R68-V72 PolarHBondContact O-N 2.98Å
69	A	98.1	Very high	97.5	Very high	58 Å²	58	86 Å²	86	48%	0.479	50%	0.498	S	S	.	.	H	α-helix	trans	-63.1	-40.8	176.9	0	0	0	0	0	111.5	V65 A66 A73	V65-A69 WeakPolarHBondContact O-CB 3.43Å; V65-A69 PolarHBondContact O-N 3.1Å; A66-A69 PolarHBondContact O-N 2.86Å; A69-A73 VanDerWaalsContact O-CB 3.31Å; A69-A73 WeakPolarHBondContact O-CB 3.27Å; A69-A73 PolarHBondContact O-N 2.83Å
70	A	97.6	Very high	97.2	Very high	63 Å²	63	82.5 Å²	82.5	52%	0.521	48%	0.482	S	S	.	.	H	α-helix	trans	-64.8	-42.5	175.5	0	0	0	0	0	112.4	A66 A67 R68 A73 S74	A66-A70 PolarHBondContact O-N 3.37Å; A67-A70 PolarHBondContact O-N 3.39Å; R68-A70 VanDerWaalsContact C-N 3.32Å; R68-A70 PolarHBondContact O-N 2.98Å; A70-A73 PolarHBondContact O-N 3.11Å; A70-S74 PolarHBondContact O-N 2.96Å
71	D	98.2	Very high	97	Very high	82 Å²	82	85.9 Å²	85.9	44%	0.439	49%	0.487	S	S	.	.	H	α-helix	trans	-60.1	-51.1	174.6	177.3	46.3	0	0	0	111.3	A67 R68 A73 S74 Q75	A67-D71 PolarHBondContact O-N 2.89Å; R68-D71 PolarHBondContact O-N 3.46Å; D71-A73 VanDerWaalsContact C-N 3.32Å; D71-A73 PolarHBondContact O-N 2.77Å; D71-S74 PolarHBondContact O-N 3.5Å; D71-S74 VanDerWaalsContact O-N 3.1Å; D71-S74 PolarHBondContact O-OG 2.91Å; D71-Q75 WeakPolarHBondContact O-CG 3.38Å; D71-Q75 PolarHBondContact O-N 3.31Å; D71-Q75 PolarHBondContact OD1-NE2 3.01Å; D71-Q75 PolarHBondContact OD2-NE2 2.74Å
72	V	97.8	Very high	96.8	Very high	88 Å²	88	85.9 Å²	85.9	53%	0.533	49%	0.487	S	S	.	.	H	α-helix	trans	-60	-41.1	177.1	171.8	0	0	0	0	111.7	R68 S74 Q75 N76	R68-V72 WeakPolarHBondContact O-CG2 3.36Å; R68-V72 PolarHBondContact O-N 2.98Å; V72-S74 VanDerWaalsContact C-N 3.33Å; V72-S74 PolarHBondContact O-N 2.83Å; V72-Q75 PolarHBondContact O-N 3.36Å; V72-N76 WeakPolarHBondContact O-CB 3.42Å; V72-N76 PolarHBondContact O-N 2.93Å
73	A	96.7	Very high	96.5	Very high	59 Å²	59	83 Å²	83	49%	0.488	47%	0.471	S	S	.	.	H	α-helix	trans	-62	-40.6	175.9	0	0	0	0	0	111.9	A69 A70 D71 N76 A77	A69-A73 VanDerWaalsContact O-CB 3.31Å; A69-A73 WeakPolarHBondContact O-CB 3.27Å; A69-A73 PolarHBondContact O-N 2.83Å; A70-A73 PolarHBondContact O-N 3.11Å; D71-A73 VanDerWaalsContact C-N 3.32Å; D71-A73 PolarHBondContact O-N 2.77Å; A73-N76 PolarHBondContact O-N 2.95Å; A73-A77 WeakPolarHBondContact O-CB 3.31Å; A73-A77 PolarHBondContact O-N 2.89Å
74	S	97.2	Very high	96.1	Very high	68 Å²	68	82.5 Å²	82.5	48%	0.476	47%	0.467	S	S	.	.	H	α-helix	trans	-66.8	-40.1	176.8	79.9	0	0	0	0	112.5	A70 D71 V72 A77 R78	A70-S74 PolarHBondContact O-N 2.96Å; D71-S74 PolarHBondContact O-N 3.5Å; D71-S74 VanDerWaalsContact O-N 3.1Å; D71-S74 PolarHBondContact O-OG 2.91Å; V72-S74 VanDerWaalsContact C-N 3.33Å; V72-S74 PolarHBondContact O-N 2.83Å; S74-A77 PolarHBondContact O-N 3.38Å; S74-R78 PolarHBondContact O-N 2.97Å
75	Q	97.7	Very high	95.9	Very high	87 Å²	87	80 Å²	80	41%	0.407	47%	0.466	S	S	.	.	H	α-helix	trans	-65.2	-42.8	175.9	-69	173.3	17.6	0	0	110.9	D71 V72 R78 V79	D71-Q75 WeakPolarHBondContact O-CG 3.38Å; D71-Q75 PolarHBondContact O-N 3.31Å; D71-Q75 PolarHBondContact OD1-NE2 3.01Å; D71-Q75 PolarHBondContact OD2-NE2 2.74Å; V72-Q75 PolarHBondContact O-N 3.36Å; Q75-R78 WeakPolarHBondContact O-CB 3.38Å; Q75-R78 PolarHBondContact O-N 3.49Å; Q75-V79 WeakPolarHBondContact O-CG2 3.4Å; Q75-V79 PolarHBondContact O-N 2.7Å
76	N	95.1	Very high	95.7	Very high	78 Å²	78	81.7 Å²	81.7	42%	0.417	47%	0.472	S	S	.	.	H	α-helix	trans	-62.8	-43	176.2	-168.3	21	0	0	0	111.5	V72 A73 R78 V79 E80	V72-N76 WeakPolarHBondContact O-CB 3.42Å; V72-N76 PolarHBondContact O-N 2.93Å; A73-N76 PolarHBondContact O-N 2.95Å; N76-R78 VanDerWaalsContact C-N 3.29Å; N76-R78 PolarHBondContact O-N 2.89Å; N76-V79 PolarHBondContact O-N 3.1Å; N76-E80 PolarHBondContact O-N 3.39Å
77	A	93.7	Very high	95.3	Very high	62 Å²	62	80.7 Å²	80.7	51%	0.512	46%	0.455	S	S	.	.	H	α-helix	trans	-59.9	-39.1	175	0	0	0	0	0	112.3	A73 S74 Q81	A73-A77 WeakPolarHBondContact O-CB 3.31Å; A73-A77 PolarHBondContact O-N 2.89Å; S74-A77 PolarHBondContact O-N 3.38Å; A77-Q81 PolarHBondContact O-N 3.15Å
78	R	96.5	Very high	94.9	Very high	151 Å²	151	80.7 Å²	80.7	57%	0.57	46%	0.455	S	S	*	.	H	α-helix	trans	-64.4	-46.6	174.5	-168.1	-176.9	76.4	-167.1	-3.3	111.7	S74 Q75 N76 E80 Q81 E82	S74-R78 PolarHBondContact O-N 2.97Å; Q75-R78 WeakPolarHBondContact O-CB 3.38Å; Q75-R78 PolarHBondContact O-N 3.49Å; N76-R78 VanDerWaalsContact C-N 3.29Å; N76-R78 PolarHBondContact O-N 2.89Å; R78-E80 VanDerWaalsContact C-N 3.33Å; R78-E80 PolarHBondContact O-N 3.44Å; R78-Q81 WeakPolarHBondContact O-CB 3.48Å; R78-Q81 PolarHBondContact O-N 3.34Å; R78-E82 IonicContact NE-OE1 3.6Å; R78-E82 PolarHBondContact NE-OE1 3.46Å; R78-E82 WeakPolarHBondContact O-CG 3.19Å; R78-E82 PolarHBondContact O-N 2.93Å
79	V	94.4	Very high	94.7	Very high	61 Å²	61	80.9 Å²	80.9	37%	0.37	46%	0.456	S	S	.	.	H	α-helix	trans	-62.4	-40.3	178.1	170.7	0	0	0	0	111.3	Q75 N76 Q81 E82 N83	Q75-V79 WeakPolarHBondContact O-CG2 3.4Å; Q75-V79 PolarHBondContact O-N 2.7Å; N76-V79 PolarHBondContact O-N 3.1Å; V79-Q81 VanDerWaalsContact C-N 3.33Å; V79-Q81 PolarHBondContact O-N 3.08Å; V79-E82 PolarHBondContact O-N 2.97Å; V79-N83 WeakPolarHBondContact O-CB 3.42Å; V79-N83 VanDerWaalsContact O-CG 3.23Å; V79-N83 PolarHBondContact O-N 3.36Å; V79-N83 PolarHBondContact O-ND2 2.77Å
80	E	91.1	Very high	94.3	Very high	66 Å²	66	80.4 Å²	80.4	31%	0.308	45%	0.451	S	S	.	.	H	α-helix	trans	-64.8	-36.3	174.8	-79.2	-59.8	158.3	0	0	112.8	N76 R78 N83 A84 R87	N76-E80 PolarHBondContact O-N 3.39Å; R78-E80 VanDerWaalsContact C-N 3.33Å; R78-E80 PolarHBondContact O-N 3.44Å; E80-N83 PolarHBondContact O-N 2.96Å; E80-A84 WeakPolarHBondContact O-CB 3.47Å; E80-A84 PolarHBondContact O-N 3.48Å; E80-R87 IonicContact OE2-NH1 4Å; E80-R87 PolarHBondContact OE2-NH1 3.46Å
81	Q	94	Very high	93.8	Very high	136 Å²	136	79.4 Å²	79.4	64%	0.636	44%	0.444	S	S	*	.	H	α-helix	trans	-64.1	-46	172.9	-173.9	-178.8	30	0	0	111.7	A77 R78 V79 N83 A84 V85	A77-Q81 PolarHBondContact O-N 3.15Å; R78-Q81 WeakPolarHBondContact O-CB 3.48Å; R78-Q81 PolarHBondContact O-N 3.34Å; V79-Q81 VanDerWaalsContact C-N 3.33Å; V79-Q81 PolarHBondContact O-N 3.08Å; Q81-N83 VanDerWaalsContact C-N 3.34Å; Q81-N83 PolarHBondContact O-N 3.23Å; Q81-A84 WeakPolarHBondContact O-CB 3.42Å; Q81-A84 PolarHBondContact O-N 3.21Å; Q81-V85 WeakPolarHBondContact O-CG2 3.46Å; Q81-V85 PolarHBondContact O-N 2.96Å; Q81-V85 VanDerWaalsContact O-N 3.08Å
82	E	95.6	Very high	93.5	Very high	96 Å²	96	80 Å²	80	45%	0.449	44%	0.444	S	S	.	.	H	α-helix	trans	-60.6	-44.5	175.9	-70.8	171.6	-155.5	0	0	111	R78 V79 A84 V85 L86	R78-E82 IonicContact NE-OE1 3.6Å; R78-E82 PolarHBondContact NE-OE1 3.46Å; R78-E82 WeakPolarHBondContact O-CG 3.19Å; R78-E82 PolarHBondContact O-N 2.93Å; V79-E82 PolarHBondContact O-N 2.97Å; E82-A84 VanDerWaalsContact C-N 3.34Å; E82-A84 PolarHBondContact O-N 2.95Å; E82-V85 PolarHBondContact O-N 3.18Å; E82-L86 WeakPolarHBondContact O-CG 3.43Å; E82-L86 PolarHBondContact O-N 3.22Å
83	N	92.3	Very high	93.2	Very high	48 Å²	48	81.2 Å²	81.2	26%	0.257	45%	0.446	S	S	.	.	H	α-helix	trans	-61	-41	175.1	-74.3	-26.9	0	0	0	111.9	V79 E80 Q81 V85 L86 R87	V79-N83 WeakPolarHBondContact O-CB 3.42Å; V79-N83 VanDerWaalsContact O-CG 3.23Å; V79-N83 PolarHBondContact O-N 3.36Å; V79-N83 PolarHBondContact O-ND2 2.77Å; E80-N83 PolarHBondContact O-N 2.96Å; Q81-N83 VanDerWaalsContact C-N 3.34Å; Q81-N83 PolarHBondContact O-N 3.23Å; N83-V85 VanDerWaalsContact C-N 3.32Å; N83-V85 PolarHBondContact O-N 3.45Å; N83-L86 PolarHBondContact O-N 3.03Å; N83-R87 WeakPolarHBondContact O-CB 3.37Å; N83-R87 WeakPolarHBondContact O-CG 3.42Å; N83-R87 PolarHBondContact O-N 3.07Å
84	A	89.7	Confident	92.8	Very high	53 Å²	53	79.3 Å²	79.3	44%	0.438	43%	0.433	S	S	.	.	H	α-helix	trans	-60.9	-41.2	175.7	0	0	0	0	0	112	E80 Q81 E82 A88	E80-A84 WeakPolarHBondContact O-CB 3.47Å; E80-A84 PolarHBondContact O-N 3.48Å; Q81-A84 WeakPolarHBondContact O-CB 3.42Å; Q81-A84 PolarHBondContact O-N 3.21Å; E82-A84 VanDerWaalsContact C-N 3.34Å; E82-A84 PolarHBondContact O-N 2.95Å; A84-A88 WeakPolarHBondContact O-CB 3.25Å; A84-A88 PolarHBondContact O-N 2.87Å
85	V	94.6	Very high	92.5	Very high	74 Å²	74	78.4 Å²	78.4	45%	0.448	43%	0.429	S	S	.	.	H	α-helix	trans	-64.6	-44.9	174.8	174.1	0	0	0	0	111.2	Q81 E82 N83 A88 R89	Q81-V85 WeakPolarHBondContact O-CG2 3.46Å; Q81-V85 PolarHBondContact O-N 2.96Å; Q81-V85 VanDerWaalsContact O-N 3.08Å; E82-V85 PolarHBondContact O-N 3.18Å; N83-V85 VanDerWaalsContact C-N 3.32Å; N83-V85 PolarHBondContact O-N 3.45Å; V85-A88 PolarHBondContact O-N 3.4Å; V85-R89 WeakPolarHBondContact O-CG 3.22Å; V85-R89 PolarHBondContact O-N 3.31Å
86	L	93.7	Very high	92.3	Very high	108 Å²	108	81.4 Å²	81.4	57%	0.565	44%	0.437	S	S	*	.	H	α-helix	trans	-62.1	-43.7	178.2	-71.1	173.5	0	0	0	111.7	E82 N83 A88 R89 A90	E82-L86 WeakPolarHBondContact O-CG 3.43Å; E82-L86 PolarHBondContact O-N 3.22Å; N83-L86 PolarHBondContact O-N 3.03Å; L86-A88 PolarHBondContact O-N 3.38Å; L86-R89 PolarHBondContact O-N 3.31Å; L86-A90 WeakPolarHBondContact O-CB 3.44Å; L86-A90 PolarHBondContact O-N 3.47Å
87	R	90	Very high	92.1	Very high	39 Å²	39	81.5 Å²	81.5	15%	0.147	44%	0.437	C	S	.	.	H	α-helix	trans	-61.2	-42.8	175.6	-70	175.6	-169.6	122.2	0.4	111.9	E80 N83 A90 A91 L129	E80-R87 IonicContact OE2-NH1 4Å; E80-R87 PolarHBondContact OE2-NH1 3.46Å; N83-R87 WeakPolarHBondContact O-CB 3.37Å; N83-R87 WeakPolarHBondContact O-CG 3.42Å; N83-R87 PolarHBondContact O-N 3.07Å; R87-A90 PolarHBondContact O-N 2.87Å; R87-A91 WeakPolarHBondContact O-CB 3.39Å; R87-A91 PolarHBondContact O-N 2.88Å; R87-L129 HydrophobicContact CB-CD2 3.87Å; R87-L129 WeakPolarHBondContact CD-O 3.39Å; R87-L129 HydrophobicContact CG-CD2 4.03Å
88	A	90.3	Very high	92	Very high	61 Å²	61	82.2 Å²	82.2	50%	0.504	43%	0.426	S	S	.	.	H	α-helix	trans	-62.8	-43.1	176.5	0	0	0	0	0	112	A84 V85 L86 A91 E92	A84-A88 WeakPolarHBondContact O-CB 3.25Å; A84-A88 PolarHBondContact O-N 2.87Å; V85-A88 PolarHBondContact O-N 3.4Å; L86-A88 PolarHBondContact O-N 3.38Å; A88-A91 PolarHBondContact O-N 3.1Å; A88-E92 PolarHBondContact O-N 3.5Å
89	R	93.4	Very high	91.8	Very high	161 Å²	161	78.3 Å²	78.3	61%	0.608	42%	0.422	S	S	*	.	H	α-helix	trans	-66.1	-40.9	176.1	-72.7	-174.9	178.2	-159.3	0.6	112.6	V85 L86 A91 E92 L93	V85-R89 WeakPolarHBondContact O-CG 3.22Å; V85-R89 PolarHBondContact O-N 3.31Å; L86-R89 PolarHBondContact O-N 3.31Å; R89-A91 VanDerWaalsContact C-N 3.33Å; R89-E92 PolarHBondContact O-N 2.84Å; R89-L93 WeakPolarHBondContact O-CB 3.48Å; R89-L93 WeakPolarHBondContact O-CG 3.43Å; R89-L93 PolarHBondContact O-N 3.36Å
90	A	90.2	Very high	91.8	Very high	47 Å²	47	79.7 Å²	79.7	39%	0.388	43%	0.431	S	S	.	.	H	α-helix	trans	-61.5	-43.2	175	0	0	0	0	0	111.1	L86 R87 E92 L93 G94 L129	L86-A90 WeakPolarHBondContact O-CB 3.44Å; L86-A90 PolarHBondContact O-N 3.47Å; R87-A90 PolarHBondContact O-N 2.87Å; A90-E92 PolarHBondContact O-N 3.16Å; A90-L93 PolarHBondContact O-N 3.25Å; A90-G94 PolarHBondContact O-N 2.87Å; A90-L129 HydrophobicContact CB-CD2 3.98Å
91	A	87.3	Confident	91.9	Very high	43 Å²	43	77.2 Å²	77.2	36%	0.355	42%	0.42	S	S	.	.	H	α-helix	trans	-62.6	-40.9	175.1	0	0	0	0	0	112.6	R87 A88 R89 G94 A95	R87-A91 WeakPolarHBondContact O-CB 3.39Å; R87-A91 PolarHBondContact O-N 2.88Å; A88-A91 PolarHBondContact O-N 3.1Å; R89-A91 VanDerWaalsContact C-N 3.33Å; A91-G94 PolarHBondContact O-N 2.86Å; A91-A95 WeakPolarHBondContact O-CB 3.48Å; A91-A95 PolarHBondContact O-N 3.19Å
92	E	92	Very high	91.8	Very high	95 Å²	95	76.6 Å²	76.6	44%	0.444	42%	0.417	S	S	.	.	H	α-helix	trans	-63	-49.6	175.5	-178.5	-175.5	-179.1	0	0	112	A88 R89 A90 G94 A95 R96	A88-E92 PolarHBondContact O-N 3.5Å; R89-E92 PolarHBondContact O-N 2.84Å; A90-E92 PolarHBondContact O-N 3.16Å; E92-G94 VanDerWaalsContact C-N 3.31Å; E92-G94 PolarHBondContact O-N 3.29Å; E92-A95 PolarHBondContact O-N 3.08Å; E92-R96 WeakPolarHBondContact O-CG 3.5Å; E92-R96 PolarHBondContact O-N 3.43Å; E92-R96 IonicContact OE1-CZ 3.3Å; E92-R96 VanDerWaalsContact OE1-CZ 3.3Å; E92-R96 IonicContact OE1-NE 3.74Å; E92-R96 PolarHBondContact OE1-NE 3.5Å; E92-R96 IonicContact OE1-NH2 2.63Å; E92-R96 PolarHBondContact OE1-NH2 3.48Å
93	L	92.4	Very high	91.8	Very high	112 Å²	112	76.4 Å²	76.4	59%	0.586	42%	0.422	S	S	*	.	H	α-helix	trans	-62.8	-40.5	177.9	-70	174.1	0	0	0	111.3	R89 A90 A95 R96 L97	R89-L93 WeakPolarHBondContact O-CB 3.48Å; R89-L93 WeakPolarHBondContact O-CG 3.43Å; R89-L93 PolarHBondContact O-N 3.36Å; A90-L93 PolarHBondContact O-N 3.25Å; L93-A95 VanDerWaalsContact C-N 3.35Å; L93-A95 PolarHBondContact O-N 3.41Å; L93-R96 PolarHBondContact O-N 2.88Å; L93-L97 WeakPolarHBondContact O-CB 3.45Å; L93-L97 PolarHBondContact O-N 3.04Å
94	G	88.4	Confident	91.8	Very high	20 Å²	20	76.4 Å²	76.4	21%	0.206	42%	0.422	C	S	.	.	H	α-helix	trans	-59.5	-43.6	172.9	0	0	0	0	0	112.2	A90 A91 E92 R96 L97 R98	A90-G94 PolarHBondContact O-N 2.87Å; A91-G94 PolarHBondContact O-N 2.86Å; E92-G94 VanDerWaalsContact C-N 3.31Å; E92-G94 PolarHBondContact O-N 3.29Å; G94-R96 PolarHBondContact O-N 3.48Å; G94-L97 PolarHBondContact O-N 3.28Å; G94-R98 WeakPolarHBondContact O-CG 3.48Å; G94-R98 PolarHBondContact O-N 2.91Å; G94-R98 VanDerWaalsContact O-N 3.09Å; G94-R98 PolarHBondContact O-NH1 3.44Å
95	A	89.1	Confident	92	Very high	48 Å²	48	80.7 Å²	80.7	40%	0.397	43%	0.427	S	S	.	.	H	α-helix	trans	-63.1	-41.5	176.2	0	0	0	0	0	112.6	A91 E92 L93 L97 R98 S99	A91-A95 WeakPolarHBondContact O-CB 3.48Å; A91-A95 PolarHBondContact O-N 3.19Å; E92-A95 PolarHBondContact O-N 3.08Å; L93-A95 VanDerWaalsContact C-N 3.35Å; L93-A95 PolarHBondContact O-N 3.41Å; A95-L97 VanDerWaalsContact C-N 3.35Å; A95-R98 PolarHBondContact O-N 2.94Å; A95-S99 PolarHBondContact O-N 3.31Å; A95-S99 VanDerWaalsContact O-N 3.13Å
96	R	93.5	Very high	92	Very high	150 Å²	150	81.6 Å²	81.6	57%	0.566	43%	0.432	S	S	*	.	H	α-helix	trans	-63.8	-41	175.6	-68.6	173.7	-177.3	-146.9	2.3	111.5	E92 L93 G94 S99 V100	E92-R96 WeakPolarHBondContact O-CG 3.5Å; E92-R96 PolarHBondContact O-N 3.43Å; E92-R96 IonicContact OE1-CZ 3.3Å; E92-R96 VanDerWaalsContact OE1-CZ 3.3Å; E92-R96 IonicContact OE1-NE 3.74Å; E92-R96 PolarHBondContact OE1-NE 3.5Å; E92-R96 IonicContact OE1-NH2 2.63Å; E92-R96 PolarHBondContact OE1-NH2 3.48Å; L93-R96 PolarHBondContact O-N 2.88Å; G94-R96 PolarHBondContact O-N 3.48Å; R96-S99 PolarHBondContact O-N 3.24Å; R96-V100 WeakPolarHBondContact O-CG2 3.36Å; R96-V100 PolarHBondContact O-N 2.91Å; R96-V100 VanDerWaalsContact O-N 3.07Å
97	L	92.6	Very high	92.1	Very high	81 Å²	81	79.9 Å²	79.9	42%	0.424	43%	0.426	S	S	.	.	H	α-helix	trans	-60.9	-45.5	177	-177.3	60.9	0	0	0	111.3	L93 G94 A95 S99 V100 N101	L93-L97 WeakPolarHBondContact O-CB 3.45Å; L93-L97 PolarHBondContact O-N 3.04Å; G94-L97 PolarHBondContact O-N 3.28Å; A95-L97 VanDerWaalsContact C-N 3.35Å; L97-S99 VanDerWaalsContact C-N 3.33Å; L97-S99 PolarHBondContact O-N 3.03Å; L97-V100 PolarHBondContact O-N 2.99Å; L97-N101 WeakPolarHBondContact O-CB 3.47Å; L97-N101 VanDerWaalsContact O-CG 3.29Å; L97-N101 PolarHBondContact O-N 3.09Å; L97-N101 PolarHBondContact O-ND2 3.49Å
98	R	90.3	Very high	92.3	Very high	76 Å²	76	80.8 Å²	80.8	29%	0.287	43%	0.432	S	S	.	.	H	α-helix	trans	-63.5	-39.9	176.3	-7	-169.6	-150	-65.1	-15.7	113	G94 A95 V100 N101 E102 E120	G94-R98 WeakPolarHBondContact O-CG 3.48Å; G94-R98 PolarHBondContact O-N 2.91Å; G94-R98 VanDerWaalsContact O-N 3.09Å; G94-R98 PolarHBondContact O-NH1 3.44Å; A95-R98 PolarHBondContact O-N 2.94Å; R98-V100 PolarHBondContact O-N 3.31Å; R98-N101 CarbonylContact O-C 3.58Å; R98-N101 PolarHBondContact O-N 3.3Å; R98-N101 VanDerWaalsContact O-N 3.14Å; R98-E102 WeakPolarHBondContact O-CB 3.1Å; R98-E102 WeakPolarHBondContact O-CG 3.46Å; R98-E102 PolarHBondContact O-N 2.89Å; R98-E120 WeakPolarHBondContact CA-OE1 3.39Å; R98-E120 WeakPolarHBondContact CB-OE1 3.42Å; R98-E120 WeakPolarHBondContact CD-OE2 3.45Å; R98-E120 WeakPolarHBondContact CG-OE1 3.33Å; R98-E120 WeakPolarHBondContact CG-OE2 3.35Å; R98-E120 IonicContact CZ-OE2 3.05Å; R98-E120 PolarHBondContact N-OE1 3.39Å; R98-E120 IonicContact NE-OE2 3.35Å; R98-E120 IonicContact NH1-OE2 3.92Å; R98-E120 PolarHBondContact NH1-OE2 3.37Å
99	S	92.6	Very high	92.5	Very high	69 Å²	69	85.9 Å²	85.9	48%	0.483	45%	0.445	S	S	.	.	H	α-helix	trans	-59.2	-40.2	177.1	179.5	0	0	0	0	111.4	A95 R96 L97 V103	A95-S99 PolarHBondContact O-N 3.31Å; A95-S99 VanDerWaalsContact O-N 3.13Å; R96-S99 PolarHBondContact O-N 3.24Å; L97-S99 VanDerWaalsContact C-N 3.33Å; L97-S99 PolarHBondContact O-N 3.03Å; S99-V103 WeakPolarHBondContact O-CG2 3.19Å; S99-V103 PolarHBondContact O-N 3.29Å
100	V	93.8	Very high	92.6	Very high	90 Å²	90	87.3 Å²	87.3	55%	0.545	46%	0.456	S	S	.	.	H	α-helix	trans	-69	-42.3	174.2	174.5	0	0	0	0	111.4	R96 L97 R98 E102 V103 L104	R96-V100 WeakPolarHBondContact O-CG2 3.36Å; R96-V100 PolarHBondContact O-N 2.91Å; R96-V100 VanDerWaalsContact O-N 3.07Å; L97-V100 PolarHBondContact O-N 2.99Å; R98-V100 PolarHBondContact O-N 3.31Å; V100-E102 VanDerWaalsContact C-N 3.33Å; V100-E102 PolarHBondContact O-N 3.13Å; V100-V103 PolarHBondContact O-N 3.49Å; V100-L104 WeakPolarHBondContact O-CB 3.07Å; V100-L104 PolarHBondContact O-N 2.92Å
101	N	93.4	Very high	92.8	Very high	15 Å²	15	87.8 Å²	87.8	8%	0.08	46%	0.456	C	S	.	.	H	α-helix	trans	-61.7	-39.5	176.8	-72.9	-20.7	0	0	0	112	L97 R98 L104 R105 I117 E120	L97-N101 WeakPolarHBondContact O-CB 3.47Å; L97-N101 VanDerWaalsContact O-CG 3.29Å; L97-N101 PolarHBondContact O-N 3.09Å; L97-N101 PolarHBondContact O-ND2 3.49Å; R98-N101 CarbonylContact O-C 3.58Å; R98-N101 PolarHBondContact O-N 3.3Å; R98-N101 VanDerWaalsContact O-N 3.14Å; N101-L104 PolarHBondContact O-N 3.48Å; N101-R105 WeakPolarHBondContact O-CG 3.43Å; N101-R105 PolarHBondContact O-N 3.2Å; N101-I117 HydrophobicContact CB-CG2 3.95Å; N101-E120 PolarHBondContact ND2-OE1 3.43Å
102	E	92.8	Very high	93.1	Very high	122 Å²	122	89.1 Å²	89.1	57%	0.57	47%	0.474	S	S	*	.	H	α-helix	trans	-61	-45	174.4	-77.2	174.9	-168.2	0	0	111.4	R98 V100 L104 R105 V106	R98-E102 WeakPolarHBondContact O-CB 3.1Å; R98-E102 WeakPolarHBondContact O-CG 3.46Å; R98-E102 PolarHBondContact O-N 2.89Å; V100-E102 VanDerWaalsContact C-N 3.33Å; V100-E102 PolarHBondContact O-N 3.13Å; E102-L104 VanDerWaalsContact C-N 3.32Å; E102-L104 PolarHBondContact O-N 2.93Å; E102-R105 PolarHBondContact O-N 3.49Å; E102-V106 PolarHBondContact O-N 3.47Å
103	V	94.6	Very high	93.1	Very high	92 Å²	92	88.6 Å²	88.6	56%	0.558	48%	0.477	S	S	*	.	H	α-helix	trans	-62.5	-42	174.4	173.3	0	0	0	0	110.8	S99 V100 R105 V106 V107	S99-V103 WeakPolarHBondContact O-CG2 3.19Å; S99-V103 PolarHBondContact O-N 3.29Å; V100-V103 PolarHBondContact O-N 3.49Å; V103-R105 VanDerWaalsContact C-N 3.33Å; V103-R105 PolarHBondContact O-N 2.86Å; V103-V106 PolarHBondContact O-N 3.43Å; V103-V107 WeakPolarHBondContact O-CG2 3Å; V103-V107 PolarHBondContact O-N 2.96Å
104	L	94.1	Very high	93.1	Very high	48 Å²	48	87.3 Å²	87.3	25%	0.251	48%	0.483	S	S	.	.	H	α-helix	trans	-64.2	-37.6	-180	-171.4	55.8	0	0	0	112.1	V100 N101 E102 V106 V107 E108 M115 I117	V100-L104 WeakPolarHBondContact O-CB 3.07Å; V100-L104 PolarHBondContact O-N 2.92Å; N101-L104 PolarHBondContact O-N 3.48Å; E102-L104 VanDerWaalsContact C-N 3.32Å; E102-L104 PolarHBondContact O-N 2.93Å; L104-V106 VanDerWaalsContact C-N 3.35Å; L104-V106 PolarHBondContact O-N 3.48Å; L104-V107 PolarHBondContact O-N 3.37Å; L104-E108 WeakPolarHBondContact O-CB 3.27Å; L104-E108 PolarHBondContact O-N 3.05Å; L104-M115 HydrophobicContact CD1-CB 3.82Å; L104-M115 HydrophobicContact CD1-CG 3.51Å; L104-M115 HydrophobicContact CD1-SD 3.63Å; L104-M115 HydrophobicContact CD2-CB 4.09Å; L104-M115 HydrophobicContact CG-CB 3.74Å; L104-M115 HydrophobicContact CG-CG 3.96Å; L104-I117 HydrophobicContact CB-CD1 4.11Å; L104-I117 HydrophobicContact CD2-CD1 4.19Å; L104-I117 HydrophobicContact CD2-CG1 3.75Å; L104-I117 HydrophobicContact CG-CD1 3.88Å; L104-I117 HydrophobicContact CG-CG1 3.99Å
105	R	93.6	Very high	93.2	Very high	144 Å²	144	89.3 Å²	89.3	54%	0.543	49%	0.488	S	S	.	.	H	α-helix	trans	-60.7	-41.7	172.9	-72	174.7	-177.8	-174.2	-0.3	112.3	N101 E102 V103 V107 E108 E109 I117	N101-R105 WeakPolarHBondContact O-CG 3.43Å; N101-R105 PolarHBondContact O-N 3.2Å; E102-R105 PolarHBondContact O-N 3.49Å; V103-R105 VanDerWaalsContact C-N 3.33Å; V103-R105 PolarHBondContact O-N 2.86Å; R105-V107 VanDerWaalsContact C-N 3.33Å; R105-E108 PolarHBondContact O-N 3.35Å; R105-E109 PolarHBondContact O-N 3.32Å; R105-I117 HydrophobicContact CB-CD1 4.35Å; R105-I117 HydrophobicContact CG-CD1 3.45Å; R105-I117 VanDerWaalsContact CG-CD1 3.45Å
106	V	95	Very high	93.2	Very high	93 Å²	93	94.4 Å²	94.4	56%	0.564	51%	0.508	S	S	*	.	H	α-helix	trans	-64.8	-39.4	175.9	175.6	0	0	0	0	111.2	E102 V103 L104 F110	E102-V106 PolarHBondContact O-N 3.47Å; V103-V106 PolarHBondContact O-N 3.43Å; L104-V106 VanDerWaalsContact C-N 3.35Å; L104-V106 PolarHBondContact O-N 3.48Å; V106-F110 WeakPolarHBondContact O-CB 3.07Å; V106-F110 PolarHBondContact O-N 2.98Å
107	V	94.6	Very high	93	Very high	71 Å²	71	88.9 Å²	88.9	43%	0.43	49%	0.49	S	S	.	.	H	α-helix	trans	-69.3	-40	177.4	173.5	0	0	0	0	111.8	V103 L104 R105 F110 S111	V103-V107 WeakPolarHBondContact O-CG2 3Å; V103-V107 PolarHBondContact O-N 2.96Å; L104-V107 PolarHBondContact O-N 3.37Å; R105-V107 VanDerWaalsContact C-N 3.33Å; V107-F110 PolarHBondContact O-N 2.83Å; V107-S111 VanDerWaalsContact O-CB 3.24Å; V107-S111 WeakPolarHBondContact O-CB 3.33Å; V107-S111 PolarHBondContact O-N 3.14Å; V107-S111 PolarHBondContact O-OG 3.45Å
108	E	94.9	Very high	92.5	Very high	59 Å²	59	92 Å²	92	28%	0.276	50%	0.502	S	S	.	.	H	α-helix	trans	-58.5	-47.8	173.4	175.8	168.9	-143.6	0	0	111	L104 R105 F110 S111 G112 A114 M115	L104-E108 WeakPolarHBondContact O-CB 3.27Å; L104-E108 PolarHBondContact O-N 3.05Å; R105-E108 PolarHBondContact O-N 3.35Å; E108-F110 PolarHBondContact O-N 2.63Å; E108-S111 PolarHBondContact O-N 3.24Å; E108-G112 WeakPolarHBondContact O-CA 3.45Å; E108-G112 PolarHBondContact O-N 2.89Å; E108-A114 VanDerWaalsContact OE1-CA 3.27Å; E108-A114 WeakPolarHBondContact OE1-CA 3.47Å; E108-M115 HydrophobicContact CB-CB 4.2Å; E108-M115 HydrophobicContact CB-CG 3.76Å; E108-M115 HydrophobicContact CG-CG 4.36Å; E108-M115 PolarHBondContact OE1-N 3.41Å
109	E	94.6	Very high	91.9	Very high	168 Å²	168	97.4 Å²	97.4	79%	0.785	53%	0.53	S	S	*	.	H	α-helix	trans	-60.1	-44.3	176.4	-175.9	178.9	-178.6	0	0	112.1	R105	R105-E109 PolarHBondContact O-N 3.32Å
110	F	95.2	Very high	91	Very high	191 Å²	191	97.4 Å²	97.4	84%	0.838	52%	0.523	S	S	*	.	H	α-helix	trans	-72.7	-39	-178.5	-176.6	-99	0	0	0	113.5	V106 V107 E108	V106-F110 WeakPolarHBondContact O-CB 3.07Å; V106-F110 PolarHBondContact O-N 2.98Å; V107-F110 PolarHBondContact O-N 2.83Å; E108-F110 PolarHBondContact O-N 2.63Å
111	S	94.2	Very high	90	Very high	56 Å²	56	97.7 Å²	97.7	39%	0.392	53%	0.525	S	S	.	.	H	α-helix	trans	-85.3	-22.4	-175.9	65.4	0	0	0	0	113.4	V107 E108 V113	V107-S111 VanDerWaalsContact O-CB 3.24Å; V107-S111 WeakPolarHBondContact O-CB 3.33Å; V107-S111 PolarHBondContact O-N 3.14Å; V107-S111 PolarHBondContact O-OG 3.45Å; E108-S111 PolarHBondContact O-N 3.24Å; S111-V113 PolarHBondContact O-N 3.18Å; S111-V113 PolarHBondContact OG-N 3.35Å
112	G	92.7	Very high	89	Confident	71 Å²	71	100.2 Å²	100.2	73%	0.732	54%	0.542	S	S	*	.			trans	67.2	8.1	-170.3	0	0	0	0	0	113.8	E108	E108-G112 WeakPolarHBondContact O-CA 3.45Å; E108-G112 PolarHBondContact O-N 2.89Å
113	V	92.9	Very high	87.9	Confident	84 Å²	84	97.4 Å²	97.4	51%	0.509	53%	0.534	S	S	.	.			trans	-96.2	120.6	177.5	-176.5	0	0	0	0	108.1	S111 M115	S111-V113 PolarHBondContact O-N 3.18Å; S111-V113 PolarHBondContact OG-N 3.35Å; V113-M115 HydrophobicContact CB-CE 3.74Å; V113-M115 HydrophobicContact CG1-CE 3.4Å; V113-M115 WeakPolarHBondContact O-CE 3.48Å; V113-M115 PolarHBondContact O-N 3.07Å
114	A	91.3	Very high	86.7	Confident	85 Å²	85	96.3 Å²	96.3	70%	0.702	54%	0.535	S	S	*	.			trans	-59.5	126.7	177.7	0	0	0	0	0	111	E108	E108-A114 VanDerWaalsContact OE1-CA 3.27Å; E108-A114 WeakPolarHBondContact OE1-CA 3.47Å
115	M	91.2	Very high	85.5	Confident	63 Å²	63	98.4 Å²	98.4	31%	0.31	55%	0.546	S	S	.	.			trans	-104.3	144.1	179.8	-64.4	-70.8	106.4	0	0	110.1	L104 E108 V113 I117	L104-M115 HydrophobicContact CD1-CB 3.82Å; L104-M115 HydrophobicContact CD1-CG 3.51Å; L104-M115 HydrophobicContact CD1-SD 3.63Å; L104-M115 HydrophobicContact CD2-CB 4.09Å; L104-M115 HydrophobicContact CG-CB 3.74Å; L104-M115 HydrophobicContact CG-CG 3.96Å; E108-M115 HydrophobicContact CB-CB 4.2Å; E108-M115 HydrophobicContact CB-CG 3.76Å; E108-M115 HydrophobicContact CG-CG 4.36Å; E108-M115 PolarHBondContact OE1-N 3.41Å; V113-M115 HydrophobicContact CB-CE 3.74Å; V113-M115 HydrophobicContact CG1-CE 3.4Å; V113-M115 WeakPolarHBondContact O-CE 3.48Å; V113-M115 PolarHBondContact O-N 3.07Å; M115-I117 HydrophobicContact CB-CD1 4.35Å; M115-I117 HydrophobicContact CB-CG1 4.11Å; M115-I117 PolarHBondContact O-N 3.42Å; M115-I117 VanDerWaalsContact O-N 3.13Å
116	D	89.9	Confident	84.6	Confident	155 Å²	155	93.7 Å²	93.7	83%	0.829	53%	0.532	S	S	*	.			trans	-81.1	91.8	177.6	-174.8	16.2	0	0	0	110.4
117	I	89.2	Confident	83.5	Confident	34 Å²	34	94.1 Å²	94.1	17%	0.174	54%	0.537	C	S	.	.			trans	-107.7	113.5	-178.1	-49.3	-175	0	0	0	109.2	N101 L104 R105 M115	N101-I117 HydrophobicContact CB-CG2 3.95Å; L104-I117 HydrophobicContact CB-CD1 4.11Å; L104-I117 HydrophobicContact CD2-CD1 4.19Å; L104-I117 HydrophobicContact CD2-CG1 3.75Å; L104-I117 HydrophobicContact CG-CD1 3.88Å; L104-I117 HydrophobicContact CG-CG1 3.99Å; R105-I117 HydrophobicContact CB-CD1 4.35Å; R105-I117 HydrophobicContact CG-CD1 3.45Å; R105-I117 VanDerWaalsContact CG-CD1 3.45Å; M115-I117 HydrophobicContact CB-CD1 4.35Å; M115-I117 HydrophobicContact CB-CG1 4.11Å; M115-I117 PolarHBondContact O-N 3.42Å; M115-I117 VanDerWaalsContact O-N 3.13Å
118	Q	82.2	Confident	82.4	Confident	145 Å²	145	97.3 Å²	97.3	68%	0.678	55%	0.551	S	S	*	*	P	Polyproline II helix	trans	-68.5	136.9	177.1	-63.5	-174.2	-49.7	0	0	111.4
119	E	77.7	Confident	81.3	Confident	190 Å²	190	96.2 Å²	96.2	89%	0.888	55%	0.547	S	S	*	.	P	Polyproline II helix	trans	-68.9	133.8	169.5	-73.2	-163.7	162.8	0	0	110.8
120	E	72.9	Confident	80.3	Confident	69 Å²	69	95.2 Å²	95.2	32%	0.322	54%	0.536	S	S	.	.	P	Polyproline II helix	trans	-93.2	134.3	-177.7	-62.7	-175.9	-160.5	0	0	111.7	R98 N101	R98-E120 WeakPolarHBondContact CA-OE1 3.39Å; R98-E120 WeakPolarHBondContact CB-OE1 3.42Å; R98-E120 WeakPolarHBondContact CD-OE2 3.45Å; R98-E120 WeakPolarHBondContact CG-OE1 3.33Å; R98-E120 WeakPolarHBondContact CG-OE2 3.35Å; R98-E120 IonicContact CZ-OE2 3.05Å; R98-E120 PolarHBondContact N-OE1 3.39Å; R98-E120 IonicContact NE-OE2 3.35Å; R98-E120 IonicContact NH1-OE2 3.92Å; R98-E120 PolarHBondContact NH1-OE2 3.37Å; N101-E120 PolarHBondContact ND2-OE1 3.43Å
121	V	73.6	Confident	79.2	Confident	97 Å²	97	90.2 Å²	90.2	59%	0.588	52%	0.522	S	S	*	.	P	Polyproline II helix	trans	-74.4	127.6	166.3	-177.6	0	0	0	0	108.4	D125	V121-D125 HydrophobicContact CG1-CB 4.04Å
122	P	71.5	Confident	78.1	Confident	68 Å²	68	98 Å²	98	44%	0.442	54%	0.543	S	S	.	.	P	Polyproline II helix	trans	-54.8	140.4	175	-25.9	34.4	0	0	0	111.4	A124 D125 D126	P122-A124 PolarHBondContact O-N 3.31Å; P122-D125 PolarHBondContact O-N 2.97Å; P122-D126 PolarHBondContact O-N 3.45Å
123	P	70	Confident	77.1	Confident	62 Å²	62	103.5 Å²	103.5	40%	0.403	55%	0.55	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.3	-29.3	-179	-25.4	32.5	0	0	0	114.1	D125 D126 L129	P123-D125 PolarHBondContact O-N 2.92Å; P123-D126 PolarHBondContact O-N 3.37Å; P123-L129 HydrophobicContact CB-CD1 4.01Å
124	A	69.1	Low	75.8	Confident	70 Å²	70	106 Å²	106	58%	0.579	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.2	-26.7	177.5	0	0	0	0	0	112.9	P122 R130	P122-A124 PolarHBondContact O-N 3.31Å; A124-R130 PolarHBondContact O-NE 2.75Å; A124-R130 VanDerWaalsContact O-NE 3.08Å; A124-R130 PolarHBondContact O-NH2 3.48Å
125	D	70.1	Confident	74.6	Confident	92 Å²	92	106.7 Å²	106.7	49%	0.492	56%	0.557	S	S	.	*	T	Hydrogen-bonded Turn	trans	-101.1	-4.2	-176.7	-61.8	-40.4	0	0	0	112.5	V121 P122 P123 P127 R130	V121-D125 HydrophobicContact CG1-CB 4.04Å; P122-D125 PolarHBondContact O-N 2.97Å; P123-D125 PolarHBondContact O-N 2.92Å; D125-P127 WeakPolarHBondContact O-CD 3.24Å; D125-R130 IonicContact OD1-NH2 3.67Å
126	D	74.2	Confident	72.7	Confident	44 Å²	44	109.1 Å²	109.1	24%	0.235	58%	0.579	C	S	.	*			trans	-72.8	111.4	172.8	-172	-12.3	0	0	0	110.1	P122 P123 L128 L129	P122-D126 PolarHBondContact O-N 3.45Å; P123-D126 PolarHBondContact O-N 3.37Å; D126-L128 PolarHBondContact O-N 3.13Å; D126-L128 VanDerWaalsContact O-N 3.16Å; D126-L128 VanDerWaalsContact OD1-CB 3.25Å; D126-L128 WeakPolarHBondContact OD1-CB 3.43Å; D126-L128 WeakPolarHBondContact OD1-CG 3.45Å; D126-L128 PolarHBondContact OD1-N 3.25Å; D126-L129 HydrophobicContact CB-CB 4.3Å; D126-L129 HydrophobicContact CB-CD1 3.98Å; D126-L129 HydrophobicContact CB-CG 3.97Å; D126-L129 PolarHBondContact O-N 3.25Å; D126-L129 VanDerWaalsContact O-N 3.1Å
127	P	71.7	Confident	71.3	Confident	103 Å²	103	111.2 Å²	111.2	67%	0.669	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.5	-23.5	178.8	27.1	-35.4	0	0	0	112.7	D125 L129	D125-P127 WeakPolarHBondContact O-CD 3.24Å; P127-L129 VanDerWaalsContact C-N 3.29Å; P127-L129 PolarHBondContact O-N 2.77Å
128	L	71.2	Confident	69.5	Low	138 Å²	138	114.2 Å²	114.2	72%	0.723	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.8	-24.1	179.1	-56.6	178.2	0	0	0	112.3	D126	D126-L128 PolarHBondContact O-N 3.13Å; D126-L128 VanDerWaalsContact O-N 3.16Å; D126-L128 VanDerWaalsContact OD1-CB 3.25Å; D126-L128 WeakPolarHBondContact OD1-CB 3.43Å; D126-L128 WeakPolarHBondContact OD1-CG 3.45Å; D126-L128 PolarHBondContact OD1-N 3.25Å
129	L	71.4	Confident	68.1	Low	36 Å²	36	112.6 Å²	112.6	19%	0.188	61%	0.61	C	S	.	*	T	Hydrogen-bonded Turn	trans	-89.5	-12.3	-178.5	-63	-177.6	0	0	0	113.5	R87 A90 P123 D126 P127	R87-L129 HydrophobicContact CB-CD2 3.87Å; R87-L129 WeakPolarHBondContact CD-O 3.39Å; R87-L129 HydrophobicContact CG-CD2 4.03Å; A90-L129 HydrophobicContact CB-CD2 3.98Å; P123-L129 HydrophobicContact CB-CD1 4.01Å; D126-L129 HydrophobicContact CB-CB 4.3Å; D126-L129 HydrophobicContact CB-CD1 3.98Å; D126-L129 HydrophobicContact CB-CG 3.97Å; D126-L129 PolarHBondContact O-N 3.25Å; D126-L129 VanDerWaalsContact O-N 3.1Å; P127-L129 VanDerWaalsContact C-N 3.29Å; P127-L129 PolarHBondContact O-N 2.77Å
130	R	73.3	Confident	66.7	Low	147 Å²	147	107.4 Å²	107.4	56%	0.555	60%	0.599	S	S	*	*	S	Bend	trans	-80.7	128.9	177.3	-65.3	-174.6	-178.8	-179.4	3	110.7	A124 D125	A124-R130 PolarHBondContact O-NE 2.75Å; A124-R130 VanDerWaalsContact O-NE 3.08Å; A124-R130 PolarHBondContact O-NH2 3.48Å; D125-R130 IonicContact OD1-NH2 3.67Å
131	P	72.9	Confident	65.3	Low	86 Å²	86	108 Å²	108	56%	0.558	62%	0.616	S	S	*	*	P	Polyproline II helix	trans	-59.1	141.6	166	-22.3	33.8	0	0	0	110.7	Q133	P131-Q133 PolarHBondContact O-N 2.91Å
132	W	70.5	Confident	63.9	Low	218 Å²	218	112 Å²	112	83%	0.826	63%	0.63	S	S	*	*	P	Polyproline II helix	trans	-63.6	121.6	173.1	-78.5	88.8	0	0	0	109.4	L134	W132-L134 PolarHBondContact O-N 3.24Å; W132-L134 VanDerWaalsContact O-N 3.15Å
133	Q	73.2	Confident	62.8	Low	187 Å²	187	113.8 Å²	113.8	87%	0.874	64%	0.642	S	S	*	*			trans	-82	90.8	172.4	-65.9	-179	-6.3	0	0	108.2	P131	P131-Q133 PolarHBondContact O-N 2.91Å
134	L	65.8	Low	61.9	Low	136 Å²	136	119.2 Å²	119.2	71%	0.712	67%	0.666	S	S	*	*			trans	-59.5	132.7	165.2	-75.6	165.5	0	0	0	107.6	W132 C136	W132-L134 PolarHBondContact O-N 3.24Å; W132-L134 VanDerWaalsContact O-N 3.15Å; L134-C136 VanDerWaalsContact C-N 3.27Å; L134-C136 PolarHBondContact O-N 2.85Å
135	P	66.2	Low	60.9	Low	101 Å²	101	118.4 Å²	118.4	66%	0.656	66%	0.664	S	S	*	*			trans	-55.8	99.9	165.1	-21.9	32.8	0	0	0	107.3	Y137	P135-Y137 HydrophobicContact CB-CD2 4.38Å; P135-Y137 HydrophobicContact CB-CE2 4.15Å; P135-Y137 PolarHBondContact O-N 3.5Å
136	C	51	Low	59.6	Low	114 Å²	114	117.3 Å²	117.3	77%	0.77	67%	0.668	S	S	*	*			trans	-68.8	89.7	169.4	-173.7	0	0	0	0	104.8	L134 P138	L134-C136 VanDerWaalsContact C-N 3.27Å; L134-C136 PolarHBondContact O-N 2.85Å; C136-P138 VanDerWaalsContact O-CD 3.27Å; C136-P138 WeakPolarHBondContact O-CD 3.45Å; C136-P138 VanDerWaalsContact O-N 3.15Å
137	Y	60	Low	58.6	Low	198 Å²	198	121.2 Å²	121.2	78%	0.776	70%	0.696	S	S	*	*			trans	-61.2	115.9	160.7	-78.6	-81.4	0	0	0	104.9	P135 A139	P135-Y137 HydrophobicContact CB-CD2 4.38Å; P135-Y137 HydrophobicContact CB-CE2 4.15Å; P135-Y137 PolarHBondContact O-N 3.5Å; Y137-A139 PolarHBondContact O-N 3.45Å; Y137-A139 VanDerWaalsContact O-N 3.11Å
138	P	50.6	Low	57.3	Low	98 Å²	98	124.4 Å²	124.4	64%	0.636	70%	0.701	S	S	*	*			trans	-56.5	128.3	179.4	22.9	-31.5	0	0	0	107	C136 A140	C136-P138 VanDerWaalsContact O-CD 3.27Å; C136-P138 WeakPolarHBondContact O-CD 3.45Å; C136-P138 VanDerWaalsContact O-N 3.15Å; P138-A140 HydrophobicContact CB-CB 4.11Å; P138-A140 PolarHBondContact O-N 3.36Å
139	A	54.1	Low	56	Low	110 Å²	110	126 Å²	126	91%	0.909	71%	0.707	S	S	*	*			trans	-66.1	25.8	168.6	0	0	0	0	0	112	Y137 A141	Y137-A139 PolarHBondContact O-N 3.45Å; Y137-A139 VanDerWaalsContact O-N 3.11Å; A139-A141 VanDerWaalsContact C-N 3.33Å; A139-A141 PolarHBondContact O-N 3.03Å
140	A	47.7	Very low	55	Low	81 Å²	81	132.2 Å²	132.2	67%	0.669	74%	0.74	S	S	*	*			trans	-68.5	93.1	175.3	0	0	0	0	0	108.6	P138	P138-A140 HydrophobicContact CB-CB 4.11Å; P138-A140 PolarHBondContact O-N 3.36Å
141	A	44.6	Very low	53.2	Low	81 Å²	81	135.7 Å²	135.7	67%	0.669	75%	0.753	S	S	*	*			trans	56.3	72.5	146	0	0	0	0	0	115.6	A139 P143	A139-A141 VanDerWaalsContact C-N 3.33Å; A139-A141 PolarHBondContact O-N 3.03Å; A141-P143 VanDerWaalsContact C-CD 3.48Å; A141-P143 WeakPolarHBondContact O-CD 3.41Å
142	M	43.5	Very low	52.2	Low	181 Å²	181	146.2 Å²	146.2	89%	0.892	78%	0.784	S	S	*	*			trans	-81.6	99.4	132.6	-73.2	-102.9	-94	0	0	105.3	I144	M142-I144 PolarHBondContact O-N 3.02Å
143	P	47	Very low	51.3	Low	107 Å²	107	142.7 Å²	142.7	70%	0.695	78%	0.782	S	S	*	*			trans	-56.7	122.4	160.8	26.7	-30.4	0	0	0	104.3	A141 G145	A141-P143 VanDerWaalsContact C-CD 3.48Å; A141-P143 WeakPolarHBondContact O-CD 3.41Å; P143-G145 PolarHBondContact O-N 3.43Å
144	I	52.9	Low	50.1	Low	176 Å²	176	140.3 Å²	140.3	90%	0.903	78%	0.777	S	S	*	*			trans	-65.5	84.4	159.3	-62.7	174.9	0	0	0	103.3	M142 A146	M142-I144 PolarHBondContact O-N 3.02Å; I144-A146 PolarHBondContact O-N 2.84Å
145	G	46.9	Very low	49.2	Very low	52 Å²	52	140.6 Å²	140.6	54%	0.536	78%	0.78	S	S	.	*			trans	-66.7	122.6	-165.5	0	0	0	0	0	109	P143	P143-G145 PolarHBondContact O-N 3.43Å
146	A	44.1	Very low	48.3	Very low	70 Å²	70	142.9 Å²	142.9	58%	0.579	79%	0.788	S	S	*	*			trans	23.8	128.4	149.3	0	0	0	0	0	117.9	I144 H148	I144-A146 PolarHBondContact O-N 2.84Å; A146-H148 PolarHBondContact O-N 3.22Å; A146-H148 PolarHBondContact O-ND1 3.48Å
147	P	51.9	Low	48.1	Very low	126 Å²	126	144.7 Å²	144.7	82%	0.818	79%	0.789	S	S	*	*			trans	-56.9	114.3	174.5	26.9	-33.1	0	0	0	108.7	M149	P147-M149 VanDerWaalsContact C-N 3.3Å; P147-M149 PolarHBondContact O-N 3.2Å
148	H	45.4	Very low	47.3	Very low	169 Å²	169	141.1 Å²	141.1	78%	0.782	79%	0.79	S	S	*	*			trans	-64.4	98.9	170.4	-67.2	-14.3	0	0	0	107.4	A146 L150	A146-H148 PolarHBondContact O-N 3.22Å; A146-H148 PolarHBondContact O-ND1 3.48Å; H148-L150 VanDerWaalsContact C-N 3.26Å; H148-L150 PolarHBondContact O-N 3.04Å
149	M	42.5	Very low	47	Very low	172 Å²	172	144.2 Å²	144.2	85%	0.847	80%	0.8	S	S	*	*			trans	-54.1	90.9	162.5	-83.4	-110.7	-96	0	0	108.6	P147 R151	P147-M149 VanDerWaalsContact C-N 3.3Å; P147-M149 PolarHBondContact O-N 3.2Å; M149-R151 PolarHBondContact O-N 3.26Å
150	L	51.3	Low	46.5	Very low	166 Å²	166	146.8 Å²	146.8	87%	0.869	79%	0.792	S	S	*	*			trans	-69.5	89.3	160.1	-84.1	157.4	0	0	0	107.1	H148 Y152	H148-L150 VanDerWaalsContact C-N 3.26Å; H148-L150 PolarHBondContact O-N 3.04Å; L150-Y152 PolarHBondContact O-N 3.24Å
151	R	35.4	Very low	46.4	Very low	220 Å²	220	152.3 Å²	152.3	83%	0.83	80%	0.802	S	S	*	*			trans	-55.7	118.7	155.8	-76	-177.9	164.5	-146.8	-2.3	108.1	M149	M149-R151 PolarHBondContact O-N 3.26Å
152	Y	51.5	Low	46.6	Very low	308 Å²	308	158.8 Å²	158.8	100%	1.208	81%	0.814	S	S	*	*			trans	-159.1	0	136.7	-87.8	-67.6	0	0	0	109	L150	L150-Y152 PolarHBondContact O-N 3.24Å

Retrieved 152 of 152 residues in 78.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).