A0A060D918_MAIZE Loading...

BZIP transcription factor

AlphaFold DB , UniProt , Accession A0A060D918, Species MAIZE (Zea mays, Maize), Gene bZIP21, Length 142 aa.

						>A0A060D918_MAIZE|A0A060D918|bZIP21
MMASPPTPSTVSTTVTTSPSSTGGSELGPDPQLAAERKRKRKESNRLSAQRSRARKQRQLDDLTAQVAALRARNGAMDAAARDAARRCVAVQAENAMLHARTVELSARLQSLVDLIQCMQAGDAMYQYQQLPLVDATIYNYY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.1	Low	56.6	Low	243 Å²	243	134.5 Å²	134.5	100%	1.197	83%	0.825	S	S	*	*				0	96.2	0	-73.8	171.8	160.5	0	0	107.9
2	M	49.2	Very low	56.4	Low	189 Å²	189	131.3 Å²	131.3	93%	0.931	81%	0.812	S	S	*	*			trans	-103	103.9	178.9	-74.2	-71	168.9	0	0	107.6	S4	M2-S4 PolarHBondContact O-N 3.36Å
3	A	58.3	Low	55.7	Low	102 Å²	102	129 Å²	129	84%	0.843	80%	0.798	S	S	*	*			trans	-75.1	102.9	176	0	0	0	0	0	108.8
4	S	61.3	Low	55.2	Low	111 Å²	111	127.9 Å²	127.9	78%	0.776	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-65.1	133.7	168	-65.5	0	0	0	0	109.7	M2	M2-S4 PolarHBondContact O-N 3.36Å
5	P	65.4	Low	55.2	Low	113 Å²	113	126.7 Å²	126.7	73%	0.734	78%	0.782	S	S	*	*	P	Polyproline II helix	trans	-73.1	147.2	179.1	29	-32.7	0	0	0	111.3
6	P	57.9	Low	54.7	Low	125 Å²	125	125.7 Å²	125.7	81%	0.812	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-72.1	138.4	-177.3	29.3	-33.5	0	0	0	111.6
7	T	56.7	Low	54.6	Low	127 Å²	127	125 Å²	125	78%	0.779	77%	0.771	S	S	*	*	P	Polyproline II helix	trans	-73.8	125.3	168.4	44.9	0	0	0	0	109.5	S9	T7-S9 PolarHBondContact O-N 2.69Å
8	P	63.3	Low	54.1	Low	121 Å²	121	123.2 Å²	123.2	79%	0.786	76%	0.764	S	S	*	*			trans	-74	112.1	170.6	26.6	-29.2	0	0	0	109.4	T10	P8-T10 PolarHBondContact O-N 2.97Å
9	S	50.1	Low	54.2	Low	104 Å²	104	123.3 Å²	123.3	73%	0.727	77%	0.767	S	S	*	*			trans	-49.6	124.1	164.4	-62.5	0	0	0	0	110.3	T7 V11	T7-S9 PolarHBondContact O-N 2.69Å; S9-V11 VanDerWaalsContact C-N 3.31Å; S9-V11 PolarHBondContact O-N 3.03Å
10	T	55.8	Low	53.9	Low	130 Å²	130	122 Å²	122	80%	0.798	76%	0.762	S	S	*	*			trans	-62.5	88.6	171.7	-55.5	0	0	0	0	109.7	P8 S12	P8-T10 PolarHBondContact O-N 2.97Å; T10-S12 VanDerWaalsContact C-N 3.28Å; T10-S12 PolarHBondContact O-N 2.82Å; T10-S12 VanDerWaalsContact O-N 3.13Å
11	V	51.4	Low	53.4	Low	115 Å²	115	121.9 Å²	121.9	70%	0.697	77%	0.766	S	S	*	*			trans	-81.3	83.7	164.7	-179.7	0	0	0	0	107	S9 T13	S9-V11 VanDerWaalsContact C-N 3.31Å; S9-V11 PolarHBondContact O-N 3.03Å; V11-T13 WeakPolarHBondContact CG1-OG1 3.33Å; V11-T13 PolarHBondContact O-N 3.2Å
12	S	54.8	Low	53.1	Low	95 Å²	95	115.9 Å²	115.9	66%	0.664	74%	0.743	S	S	*	*			trans	-74.5	77.9	160.9	-87.2	0	0	0	0	108.1	T10 T14	T10-S12 VanDerWaalsContact C-N 3.28Å; T10-S12 PolarHBondContact O-N 2.82Å; T10-S12 VanDerWaalsContact O-N 3.13Å; S12-T14 PolarHBondContact O-N 3.34Å
13	T	47.2	Very low	52.8	Low	102 Å²	102	110.7 Å²	110.7	63%	0.626	74%	0.738	S	S	*	*			trans	-77.3	85.8	160.6	-49.5	0	0	0	0	107.3	V11 V15	V11-T13 WeakPolarHBondContact CG1-OG1 3.33Å; V11-T13 PolarHBondContact O-N 3.2Å; T13-V15 HydrophobicContact CG2-CG2 3.46Å; T13-V15 VanDerWaalsContact CG2-CG2 3.46Å; T13-V15 PolarHBondContact O-N 3.38Å
14	T	47.9	Very low	52.1	Low	114 Å²	114	109 Å²	109	70%	0.699	73%	0.73	S	S	*	*			trans	-70.8	84.7	158.7	46.6	0	0	0	0	107.3	S12 T16	S12-T14 PolarHBondContact O-N 3.34Å; T14-T16 PolarHBondContact O-N 2.9Å
15	V	55.2	Low	51.4	Low	109 Å²	109	109.2 Å²	109.2	66%	0.661	73%	0.732	S	S	*	*			trans	-73.4	80.6	157.8	-151.7	0	0	0	0	105.7	T13 T17	T13-V15 HydrophobicContact CG2-CG2 3.46Å; T13-V15 VanDerWaalsContact CG2-CG2 3.46Å; T13-V15 PolarHBondContact O-N 3.38Å; V15-T17 HydrophobicContact CG1-CG2 3.92Å; V15-T17 PolarHBondContact O-N 3.24Å
16	T	47	Very low	50.6	Low	111 Å²	111	113.3 Å²	113.3	68%	0.681	74%	0.741	S	S	*	*			trans	-70	81.5	163.7	-56	0	0	0	0	105.7	T14 S18	T14-T16 PolarHBondContact O-N 2.9Å; T16-S18 PolarHBondContact O-N 2.69Å
17	T	53	Low	50.4	Low	114 Å²	114	115.1 Å²	115.1	70%	0.699	74%	0.744	S	S	*	*			trans	-70.6	90.3	161.4	51.6	0	0	0	0	106.2	V15	V15-T17 HydrophobicContact CG1-CG2 3.92Å; V15-T17 PolarHBondContact O-N 3.24Å
18	S	46.2	Very low	50.7	Low	93 Å²	93	112 Å²	112	65%	0.65	74%	0.737	S	S	*	*			trans	-46.6	124	160.4	-53.1	0	0	0	0	107.5	T16 S20	T16-S18 PolarHBondContact O-N 2.69Å; S18-S20 PolarHBondContact O-N 2.98Å
19	P	56.6	Low	51.1	Low	124 Å²	124	110.6 Å²	110.6	81%	0.805	73%	0.728	S	S	*	*			trans	-61.6	114.8	173.7	24	-29.9	0	0	0	106.9	S21	P19-S21 PolarHBondContact O-N 3.45Å
20	S	47	Very low	52.7	Low	97 Å²	97	108.9 Å²	108.9	68%	0.678	71%	0.71	S	S	*	*			trans	-54.5	116.4	168	62	0	0	0	0	106.8	S18 T22	S18-S20 PolarHBondContact O-N 2.98Å; S20-T22 PolarHBondContact O-N 3.21Å
21	S	44.7	Very low	54.3	Low	121 Å²	121	107.6 Å²	107.6	85%	0.846	70%	0.704	S	S	*	*			trans	-67.5	72	170.2	56.2	0	0	0	0	108.6	P19 G23	P19-S21 PolarHBondContact O-N 3.45Å; S21-G23 VanDerWaalsContact C-N 3.27Å; S21-G23 PolarHBondContact O-N 3.47Å; S21-G23 VanDerWaalsContact O-N 3.1Å
22	T	47.1	Very low	56.2	Low	116 Å²	116	109.3 Å²	109.3	71%	0.712	71%	0.705	S	S	*	*			trans	-80.5	89.4	166.5	-52	0	0	0	0	105.9	S20 G24	S20-T22 PolarHBondContact O-N 3.21Å; T22-G24 PolarHBondContact O-N 3.38Å
23	G	41.4	Very low	58	Low	80 Å²	80	108.6 Å²	108.6	83%	0.825	69%	0.693	S	S	*	*			trans	-52.6	121.1	158.4	0	0	0	0	0	108.1	S21	S21-G23 VanDerWaalsContact C-N 3.27Å; S21-G23 PolarHBondContact O-N 3.47Å; S21-G23 VanDerWaalsContact O-N 3.1Å
24	G	44	Very low	60.2	Low	66 Å²	66	105.8 Å²	105.8	68%	0.68	68%	0.68	S	S	*	*			trans	-162.3	88.4	-175.6	0	0	0	0	0	109	T22	T22-G24 PolarHBondContact O-N 3.38Å
25	S	46.8	Very low	62.4	Low	117 Å²	117	103.2 Å²	103.2	82%	0.818	67%	0.67	S	S	*	*			trans	40.8	122.3	153.1	-55.6	0	0	0	0	119.4	L27	S25-L27 VanDerWaalsContact C-N 3.33Å; S25-L27 PolarHBondContact O-N 3.5Å
26	E	49.4	Very low	64.3	Low	198 Å²	198	101.7 Å²	101.7	93%	0.925	66%	0.656	S	S	*	*			trans	-41	81.2	166.9	-61	178.7	137.2	0	0	114.4
27	L	53.7	Low	66.6	Low	164 Å²	164	103.8 Å²	103.8	86%	0.859	65%	0.651	S	S	*	*			trans	-123.1	90.5	145.3	-72.3	171.2	0	0	0	104.2	S25	S25-L27 VanDerWaalsContact C-N 3.33Å; S25-L27 PolarHBondContact O-N 3.5Å
28	G	63.2	Low	68.7	Low	62 Å²	62	104.7 Å²	104.7	64%	0.639	65%	0.646	S	S	*	*			trans	-44.8	137.3	172.1	0	0	0	0	0	108.6	D30	G28-D30 PolarHBondContact O-N 3.39Å; G28-D30 VanDerWaalsContact O-N 3.07Å
29	P	70.3	Confident	71.1	Confident	91 Å²	91	107 Å²	107	59%	0.591	64%	0.64	S	S	*	*			trans	-51.1	126	-176.5	21.1	-32.1	0	0	0	108.4	P31	P29-P31 VanDerWaalsContact O-N 3.08Å
30	D	84.9	Confident	73.1	Confident	67 Å²	67	106.3 Å²	106.3	36%	0.358	62%	0.624	S	S	.	*			trans	-41.3	121.7	178.6	168.9	0.8	0	0	0	108.5	G28 Q32 L33 A34	G28-D30 PolarHBondContact O-N 3.39Å; G28-D30 VanDerWaalsContact O-N 3.07Å; D30-Q32 PolarHBondContact O-N 3.13Å; D30-Q32 WeakPolarHBondContact OD1-CB 3.35Å; D30-Q32 PolarHBondContact OD1-N 3.13Å; D30-L33 HydrophobicContact CB-CB 4.16Å; D30-L33 HydrophobicContact CB-CD1 3.94Å; D30-L33 HydrophobicContact CB-CG 3.91Å; D30-L33 WeakPolarHBondContact O-CA 3.27Å; D30-L33 WeakPolarHBondContact O-CB 3.47Å; D30-L33 PolarHBondContact O-N 2.99Å; D30-A34 PolarHBondContact O-N 3.17Å
31	P	88.3	Confident	75.4	Confident	103 Å²	103	111 Å²	111	67%	0.669	63%	0.627	S	S	*	*	H	α-helix	trans	-52.9	-30.3	-176.3	20.6	-33.3	0	0	0	112.3	P29 A35	P29-P31 VanDerWaalsContact O-N 3.08Å; P31-A35 VanDerWaalsContact O-CB 3.29Å; P31-A35 WeakPolarHBondContact O-CB 3.49Å; P31-A35 PolarHBondContact O-N 2.93Å
32	Q	91.1	Very high	78	Confident	152 Å²	152	112 Å²	112	71%	0.71	62%	0.616	S	S	*	*	H	α-helix	trans	-67.9	-47.2	174.8	-59.7	-170.4	-68	0	0	111.8	D30 A34 A35 E36	D30-Q32 PolarHBondContact O-N 3.13Å; D30-Q32 WeakPolarHBondContact OD1-CB 3.35Å; D30-Q32 PolarHBondContact OD1-N 3.13Å; Q32-A34 VanDerWaalsContact C-N 3.32Å; Q32-A34 PolarHBondContact O-N 3.27Å; Q32-A35 PolarHBondContact O-N 3.06Å; Q32-E36 WeakPolarHBondContact O-CB 3.05Å; Q32-E36 PolarHBondContact O-N 2.96Å
33	L	92.9	Very high	80.4	Confident	80 Å²	80	110.3 Å²	110.3	42%	0.419	60%	0.6	S	S	.	*	H	α-helix	trans	-62.4	-39.6	175.1	-65.1	-179.4	0	0	0	111.8	D30 E36 R37	D30-L33 HydrophobicContact CB-CB 4.16Å; D30-L33 HydrophobicContact CB-CD1 3.94Å; D30-L33 HydrophobicContact CB-CG 3.91Å; D30-L33 WeakPolarHBondContact O-CA 3.27Å; D30-L33 WeakPolarHBondContact O-CB 3.47Å; D30-L33 PolarHBondContact O-N 2.99Å; L33-E36 PolarHBondContact O-N 3.48Å; L33-R37 WeakPolarHBondContact O-CB 3.32Å; L33-R37 VanDerWaalsContact O-CG 3.27Å; L33-R37 WeakPolarHBondContact O-CG 3.07Å; L33-R37 PolarHBondContact O-N 3.33Å
34	A	93	Very high	83.1	Confident	42 Å²	42	110.1 Å²	110.1	35%	0.347	59%	0.586	S	S	.	*	H	α-helix	trans	-64.3	-43.8	176.1	0	0	0	0	0	111.7	D30 Q32 R37 K38	D30-A34 PolarHBondContact O-N 3.17Å; Q32-A34 VanDerWaalsContact C-N 3.32Å; Q32-A34 PolarHBondContact O-N 3.27Å; A34-R37 PolarHBondContact O-N 3.36Å; A34-K38 WeakPolarHBondContact O-CB 3.48Å; A34-K38 PolarHBondContact O-N 2.97Å
35	A	94.3	Very high	85.7	Confident	61 Å²	61	112 Å²	112	50%	0.504	58%	0.581	S	S	.	*	H	α-helix	trans	-62.5	-42.6	175.3	0	0	0	0	0	111.8	P31 Q32 K38 R39	P31-A35 VanDerWaalsContact O-CB 3.29Å; P31-A35 WeakPolarHBondContact O-CB 3.49Å; P31-A35 PolarHBondContact O-N 2.93Å; Q32-A35 PolarHBondContact O-N 3.06Å; A35-K38 PolarHBondContact O-N 3.44Å; A35-R39 PolarHBondContact O-N 3.01Å
36	E	95.9	Very high	88.1	Confident	76 Å²	76	114 Å²	114	36%	0.355	57%	0.571	S	S	.	*	H	α-helix	trans	-65.1	-45.1	177.8	-162	-162.1	164.1	0	0	111.9	Q32 L33 K38 R39 K40	Q32-E36 WeakPolarHBondContact O-CB 3.05Å; Q32-E36 PolarHBondContact O-N 2.96Å; L33-E36 PolarHBondContact O-N 3.48Å; E36-K38 VanDerWaalsContact C-N 3.32Å; E36-K38 PolarHBondContact O-N 3.36Å; E36-R39 WeakPolarHBondContact O-CB 3.44Å; E36-R39 PolarHBondContact O-N 3.44Å; E36-K40 HydrophobicContact CG-CD 4.48Å; E36-K40 WeakPolarHBondContact O-CG 3.26Å; E36-K40 PolarHBondContact O-N 3.07Å; E36-K40 WeakPolarHBondContact OE1-CE 3.39Å; E36-K40 IonicContact OE1-NZ 2.67Å; E36-K40 PolarHBondContact OE1-NZ 2.99Å
37	R	95.9	Very high	90.5	Very high	155 Å²	155	107.9 Å²	107.9	59%	0.585	54%	0.544	S	S	*	.	H	α-helix	trans	-58.8	-42.6	173.9	-74.1	173.8	-176.6	-179.3	2.5	111.3	L33 A34 K40 R41	L33-R37 WeakPolarHBondContact O-CB 3.32Å; L33-R37 VanDerWaalsContact O-CG 3.27Å; L33-R37 WeakPolarHBondContact O-CG 3.07Å; L33-R37 PolarHBondContact O-N 3.33Å; A34-R37 PolarHBondContact O-N 3.36Å; R37-K40 PolarHBondContact O-N 2.62Å; R37-R41 WeakPolarHBondContact O-CB 3.42Å; R37-R41 VanDerWaalsContact O-CG 3.32Å; R37-R41 WeakPolarHBondContact O-CG 3.41Å; R37-R41 PolarHBondContact O-N 3.22Å
38	K	96.1	Very high	92.6	Very high	134 Å²	134	102.8 Å²	102.8	58%	0.583	52%	0.522	S	S	*	.	H	α-helix	trans	-64	-41.7	175.9	-173.6	176	-177.9	178.3	0	111.6	A34 A35 E36 R41 K42	A34-K38 WeakPolarHBondContact O-CB 3.48Å; A34-K38 PolarHBondContact O-N 2.97Å; A35-K38 PolarHBondContact O-N 3.44Å; E36-K38 VanDerWaalsContact C-N 3.32Å; E36-K38 PolarHBondContact O-N 3.36Å; K38-R41 PolarHBondContact O-N 3.5Å; K38-K42 WeakPolarHBondContact O-CG 3.29Å; K38-K42 PolarHBondContact O-N 3.29Å
39	R	96.6	Very high	94.3	Very high	140 Å²	140	101.3 Å²	101.3	53%	0.528	50%	0.503	S	S	.	.	H	α-helix	trans	-59.7	-51	174.7	-171	-173.5	69.7	79.4	-3.2	111.2	A35 E36 R41 K42 E43	A35-R39 PolarHBondContact O-N 3.01Å; E36-R39 WeakPolarHBondContact O-CB 3.44Å; E36-R39 PolarHBondContact O-N 3.44Å; R39-R41 PolarHBondContact O-N 2.91Å; R39-K42 PolarHBondContact O-N 2.95Å; R39-E43 IonicContact NH1-OE2 3.55Å; R39-E43 PolarHBondContact O-N 3.42Å; R39-E43 VanDerWaalsContact O-N 3.07Å
40	K	97.6	Very high	95.6	Very high	111 Å²	111	102.9 Å²	102.9	48%	0.483	50%	0.503	S	S	.	.	H	α-helix	trans	-59	-41.7	177.1	-74.7	172.6	167.3	164.8	0	112.3	E36 R37 E43 S44	E36-K40 HydrophobicContact CG-CD 4.48Å; E36-K40 WeakPolarHBondContact O-CG 3.26Å; E36-K40 PolarHBondContact O-N 3.07Å; E36-K40 WeakPolarHBondContact OE1-CE 3.39Å; E36-K40 IonicContact OE1-NZ 2.67Å; E36-K40 PolarHBondContact OE1-NZ 2.99Å; R37-K40 PolarHBondContact O-N 2.62Å; K40-E43 PolarHBondContact O-N 3.31Å; K40-S44 WeakPolarHBondContact O-CB 3.45Å; K40-S44 PolarHBondContact O-N 3.02Å
41	R	96.9	Very high	96.3	Very high	195 Å²	195	107.9 Å²	107.9	74%	0.736	52%	0.517	S	S	*	.	H	α-helix	trans	-63.8	-42.9	176	-76.7	178.7	-179	-171.3	1.1	112.8	R37 K38 R39 E43 S44 N45	R37-R41 WeakPolarHBondContact O-CB 3.42Å; R37-R41 VanDerWaalsContact O-CG 3.32Å; R37-R41 WeakPolarHBondContact O-CG 3.41Å; R37-R41 PolarHBondContact O-N 3.22Å; K38-R41 PolarHBondContact O-N 3.5Å; R39-R41 PolarHBondContact O-N 2.91Å; R41-E43 VanDerWaalsContact C-N 3.35Å; R41-S44 PolarHBondContact O-N 3.39Å; R41-N45 VanDerWaalsContact O-CB 3.27Å; R41-N45 WeakPolarHBondContact O-CB 3.34Å; R41-N45 PolarHBondContact O-N 3.46Å
42	K	97.9	Very high	96.8	Very high	141 Å²	141	105.1 Å²	105.1	61%	0.613	50%	0.5	S	S	*	.	H	α-helix	trans	-61.8	-43.5	176.5	-75.3	-179.8	175.1	-171.4	0	111.5	K38 R39 R46	K38-K42 WeakPolarHBondContact O-CG 3.29Å; K38-K42 PolarHBondContact O-N 3.29Å; R39-K42 PolarHBondContact O-N 2.95Å; K42-R46 WeakPolarHBondContact O-CB 3.45Å; K42-R46 PolarHBondContact O-N 2.84Å
43	E	97.9	Very high	97.2	Very high	82 Å²	82	107 Å²	107	38%	0.383	50%	0.5	S	S	.	.	H	α-helix	trans	-65.6	-46.3	177.5	-175.2	172.2	-170.6	0	0	112.1	R39 K40 R41 N45 R46 L47	R39-E43 IonicContact NH1-OE2 3.55Å; R39-E43 PolarHBondContact O-N 3.42Å; R39-E43 VanDerWaalsContact O-N 3.07Å; K40-E43 PolarHBondContact O-N 3.31Å; R41-E43 VanDerWaalsContact C-N 3.35Å; E43-N45 PolarHBondContact O-N 3.09Å; E43-R46 WeakPolarHBondContact O-CB 3.38Å; E43-R46 PolarHBondContact O-N 3.2Å; E43-L47 HydrophobicContact CG-CD1 4.35Å; E43-L47 WeakPolarHBondContact O-CG 3.42Å; E43-L47 PolarHBondContact O-N 3.04Å
44	S	98.4	Very high	97.4	Very high	75 Å²	75	105.1 Å²	105.1	52%	0.524	50%	0.496	S	S	.	.	H	α-helix	trans	-61.2	-44.2	175.9	178.9	0	0	0	0	112.3	K40 R41 R46 L47 S48	K40-S44 WeakPolarHBondContact O-CB 3.45Å; K40-S44 PolarHBondContact O-N 3.02Å; R41-S44 PolarHBondContact O-N 3.39Å; S44-R46 PolarHBondContact O-N 3.1Å; S44-L47 PolarHBondContact O-N 3.46Å; S44-S48 WeakPolarHBondContact O-CB 3.37Å; S44-S48 PolarHBondContact O-N 3.42Å; S44-S48 PolarHBondContact O-OG 3.26Å
45	N	98.5	Very high	97.7	Very high	107 Å²	107	109.7 Å²	109.7	57%	0.572	51%	0.505	S	S	*	.	H	α-helix	trans	-63.9	-40.1	176	-177.5	-92.6	0	0	0	112.1	R41 E43 S48 A49	R41-N45 VanDerWaalsContact O-CB 3.27Å; R41-N45 WeakPolarHBondContact O-CB 3.34Å; R41-N45 PolarHBondContact O-N 3.46Å; E43-N45 PolarHBondContact O-N 3.09Å; N45-S48 WeakPolarHBondContact CA-OG 3.33Å; N45-S48 PolarHBondContact O-N 3.34Å; N45-S48 PolarHBondContact O-OG 2.96Å; N45-S48 VanDerWaalsContact O-OG 3.11Å; N45-A49 WeakPolarHBondContact O-CB 3.45Å; N45-A49 PolarHBondContact O-N 3Å
46	R	98.5	Very high	97.9	Very high	159 Å²	159	113.1 Å²	113.1	60%	0.6	51%	0.508	S	S	*	.	H	α-helix	trans	-59.2	-49.8	174.5	-178.3	-179.6	69.5	175.5	0.8	111	K42 E43 S44 A49 Q50	K42-R46 WeakPolarHBondContact O-CB 3.45Å; K42-R46 PolarHBondContact O-N 2.84Å; E43-R46 WeakPolarHBondContact O-CB 3.38Å; E43-R46 PolarHBondContact O-N 3.2Å; S44-R46 PolarHBondContact O-N 3.1Å; R46-A49 PolarHBondContact O-N 3.44Å; R46-Q50 WeakPolarHBondContact O-CB 3.28Å; R46-Q50 PolarHBondContact O-N 3.23Å
47	L	98.4	Very high	98	Very high	69 Å²	69	114.3 Å²	114.3	36%	0.361	51%	0.514	S	S	.	.	H	α-helix	trans	-66.5	-39.4	179.6	-67.9	173.5	0	0	0	111.9	E43 S44 Q50 R51	E43-L47 HydrophobicContact CG-CD1 4.35Å; E43-L47 WeakPolarHBondContact O-CG 3.42Å; E43-L47 PolarHBondContact O-N 3.04Å; S44-L47 PolarHBondContact O-N 3.46Å; L47-Q50 PolarHBondContact O-N 2.79Å; L47-R51 WeakPolarHBondContact O-CB 3.32Å; L47-R51 VanDerWaalsContact O-CG 3.25Å; L47-R51 WeakPolarHBondContact O-CG 3.44Å; L47-R51 PolarHBondContact O-N 3.23Å
48	S	98.5	Very high	98.2	Very high	57 Å²	57	115.5 Å²	115.5	40%	0.399	52%	0.518	S	S	.	.	H	α-helix	trans	-70.6	-36.9	178.6	71.6	0	0	0	0	112.3	S44 N45 R51 S52	S44-S48 WeakPolarHBondContact O-CB 3.37Å; S44-S48 PolarHBondContact O-N 3.42Å; S44-S48 PolarHBondContact O-OG 3.26Å; N45-S48 WeakPolarHBondContact CA-OG 3.33Å; N45-S48 PolarHBondContact O-N 3.34Å; N45-S48 PolarHBondContact O-OG 2.96Å; N45-S48 VanDerWaalsContact O-OG 3.11Å; S48-R51 PolarHBondContact O-N 2.97Å; S48-S52 VanDerWaalsContact O-CB 3.28Å; S48-S52 WeakPolarHBondContact O-CB 3.43Å; S48-S52 PolarHBondContact O-N 3.39Å
49	A	98.4	Very high	98.3	Very high	30 Å²	30	115.1 Å²	115.1	25%	0.248	52%	0.519	C	S	.	.	H	α-helix	trans	-63.6	-44.5	171.1	0	0	0	0	0	111.3	N45 R46 S52 R53	N45-A49 WeakPolarHBondContact O-CB 3.45Å; N45-A49 PolarHBondContact O-N 3Å; R46-A49 PolarHBondContact O-N 3.44Å; A49-S52 PolarHBondContact O-N 2.94Å; A49-R53 WeakPolarHBondContact O-CB 3.49Å; A49-R53 VanDerWaalsContact O-CG 3.31Å; A49-R53 WeakPolarHBondContact O-CG 3.41Å; A49-R53 PolarHBondContact O-N 3.37Å
50	Q	98.6	Very high	98.4	Very high	124 Å²	124	113.2 Å²	113.2	58%	0.579	52%	0.519	S	S	*	.	H	α-helix	trans	-60.4	-47.6	174.8	-173.2	-176.3	15.9	0	0	111.4	R46 L47 S52 R53 A54	R46-Q50 WeakPolarHBondContact O-CB 3.28Å; R46-Q50 PolarHBondContact O-N 3.23Å; L47-Q50 PolarHBondContact O-N 2.79Å; Q50-S52 VanDerWaalsContact C-N 3.33Å; Q50-S52 PolarHBondContact O-N 2.73Å; Q50-R53 PolarHBondContact O-N 3.01Å; Q50-A54 WeakPolarHBondContact O-CB 3.35Å; Q50-A54 PolarHBondContact O-N 3.31Å
51	R	98.7	Very high	98.5	Very high	173 Å²	173	111.7 Å²	111.7	65%	0.653	52%	0.516	S	S	*	.	H	α-helix	trans	-60.6	-41.3	176	-72.9	174.5	-178.7	-162	0.9	112	L47 S48 A54 R55	L47-R51 WeakPolarHBondContact O-CB 3.32Å; L47-R51 VanDerWaalsContact O-CG 3.25Å; L47-R51 WeakPolarHBondContact O-CG 3.44Å; L47-R51 PolarHBondContact O-N 3.23Å; S48-R51 PolarHBondContact O-N 2.97Å; R51-A54 PolarHBondContact O-N 2.93Å; R51-R55 WeakPolarHBondContact O-CG 3.32Å; R51-R55 PolarHBondContact O-N 3.5Å
52	S	98.8	Very high	98.5	Very high	45 Å²	45	106.7 Å²	106.7	32%	0.315	50%	0.503	S	S	.	.	H	α-helix	trans	-64.2	-46.7	177.7	-171.7	0	0	0	0	111.5	S48 A49 Q50 R55 K56	S48-S52 VanDerWaalsContact O-CB 3.28Å; S48-S52 WeakPolarHBondContact O-CB 3.43Å; S48-S52 PolarHBondContact O-N 3.39Å; A49-S52 PolarHBondContact O-N 2.94Å; Q50-S52 VanDerWaalsContact C-N 3.33Å; Q50-S52 PolarHBondContact O-N 2.73Å; S52-R55 PolarHBondContact O-N 2.99Å; S52-K56 PolarHBondContact O-N 2.96Å
53	R	98.6	Very high	98.6	Very high	190 Å²	190	104.5 Å²	104.5	72%	0.717	50%	0.498	S	S	*	.	H	α-helix	trans	-60.2	-45.3	174.4	-70.8	173.6	-174.3	177.5	1.1	111.5	A49 Q50 R55 K56 Q57	A49-R53 WeakPolarHBondContact O-CB 3.49Å; A49-R53 VanDerWaalsContact O-CG 3.31Å; A49-R53 WeakPolarHBondContact O-CG 3.41Å; A49-R53 PolarHBondContact O-N 3.37Å; Q50-R53 PolarHBondContact O-N 3.01Å; R53-R55 PolarHBondContact O-N 2.92Å; R53-K56 PolarHBondContact O-N 3.35Å; R53-Q57 WeakPolarHBondContact O-CB 3.38Å; R53-Q57 PolarHBondContact O-N 3.21Å
54	A	98.6	Very high	98.6	Very high	41 Å²	41	105.1 Å²	105.1	34%	0.339	51%	0.507	S	S	.	.	H	α-helix	trans	-62.8	-40.2	178.3	0	0	0	0	0	112.8	Q50 R51 Q57 R58	Q50-A54 WeakPolarHBondContact O-CB 3.35Å; Q50-A54 PolarHBondContact O-N 3.31Å; R51-A54 PolarHBondContact O-N 2.93Å; A54-Q57 PolarHBondContact O-N 3.36Å; A54-R58 WeakPolarHBondContact O-CG 3.47Å; A54-R58 PolarHBondContact O-N 3.43Å
55	R	98.7	Very high	98.6	Very high	138 Å²	138	104.3 Å²	104.3	52%	0.521	51%	0.506	S	S	.	.	H	α-helix	trans	-63.3	-46.7	174.2	-75.3	-170	-59.3	-93.8	1.8	111.8	R51 S52 R53 Q57 R58 Q59	R51-R55 WeakPolarHBondContact O-CG 3.32Å; R51-R55 PolarHBondContact O-N 3.5Å; S52-R55 PolarHBondContact O-N 2.99Å; R53-R55 PolarHBondContact O-N 2.92Å; R55-Q57 VanDerWaalsContact C-N 3.33Å; R55-Q57 PolarHBondContact O-N 2.84Å; R55-R58 PolarHBondContact O-N 3.21Å; R55-Q59 WeakPolarHBondContact O-CG 3.4Å; R55-Q59 PolarHBondContact O-N 3.37Å
56	K	98.6	Very high	98.7	Very high	134 Å²	134	103.6 Å²	103.6	58%	0.583	50%	0.499	S	S	*	.	H	α-helix	trans	-61.4	-41.5	177	-72.4	-174.7	177.6	-171.1	0	111.8	S52 R53 Q59 L60	S52-K56 PolarHBondContact O-N 2.96Å; R53-K56 PolarHBondContact O-N 3.35Å; K56-Q59 PolarHBondContact O-N 2.95Å; K56-L60 WeakPolarHBondContact O-CG 3.47Å; K56-L60 PolarHBondContact O-N 3.3Å
57	Q	98.6	Very high	98.7	Very high	101 Å²	101	98.8 Å²	98.8	47%	0.472	49%	0.487	S	S	.	.	H	α-helix	trans	-60.3	-48.2	175.9	-172.5	60.3	48.4	0	0	111.3	R53 A54 R55 Q59 L60 D61	R53-Q57 WeakPolarHBondContact O-CB 3.38Å; R53-Q57 PolarHBondContact O-N 3.21Å; A54-Q57 PolarHBondContact O-N 3.36Å; R55-Q57 VanDerWaalsContact C-N 3.33Å; R55-Q57 PolarHBondContact O-N 2.84Å; Q57-Q59 VanDerWaalsContact C-N 3.29Å; Q57-Q59 PolarHBondContact O-N 3.43Å; Q57-L60 WeakPolarHBondContact O-CB 3.37Å; Q57-L60 PolarHBondContact O-N 2.88Å; Q57-D61 PolarHBondContact NE2-OD1 3.47Å; Q57-D61 PolarHBondContact O-N 3.33Å
58	R	98.7	Very high	98.7	Very high	179 Å²	179	98.2 Å²	98.2	68%	0.675	49%	0.492	S	S	*	.	H	α-helix	trans	-58.7	-39.2	176.6	-71.4	172.9	-173.8	176.9	-0.3	113	A54 R55 L60 D61 D62	A54-R58 WeakPolarHBondContact O-CG 3.47Å; A54-R58 PolarHBondContact O-N 3.43Å; R55-R58 PolarHBondContact O-N 3.21Å; R58-L60 VanDerWaalsContact C-N 3.35Å; R58-D61 PolarHBondContact O-N 2.96Å; R58-D62 VanDerWaalsContact O-CB 3.3Å; R58-D62 WeakPolarHBondContact O-CB 3.41Å; R58-D62 PolarHBondContact O-N 3.45Å
59	Q	98.7	Very high	98.7	Very high	126 Å²	126	98.5 Å²	98.5	59%	0.589	50%	0.498	S	S	*	.	H	α-helix	trans	-65.4	-39.2	175.9	-71.6	178.1	-56.9	0	0	111.8	R55 K56 Q57 L63	R55-Q59 WeakPolarHBondContact O-CG 3.4Å; R55-Q59 PolarHBondContact O-N 3.37Å; K56-Q59 PolarHBondContact O-N 2.95Å; Q57-Q59 VanDerWaalsContact C-N 3.29Å; Q57-Q59 PolarHBondContact O-N 3.43Å; Q59-L63 WeakPolarHBondContact O-CB 3.43Å; Q59-L63 VanDerWaalsContact O-CG 3.25Å; Q59-L63 WeakPolarHBondContact O-CG 3.26Å; Q59-L63 PolarHBondContact O-N 3.38Å
60	L	98.8	Very high	98.7	Very high	101 Å²	101	101.7 Å²	101.7	53%	0.529	51%	0.51	S	S	.	.	H	α-helix	trans	-65.2	-47	174.3	-68.5	174.1	0	0	0	110.9	K56 Q57 R58 D62 L63 T64	K56-L60 WeakPolarHBondContact O-CG 3.47Å; K56-L60 PolarHBondContact O-N 3.3Å; Q57-L60 WeakPolarHBondContact O-CB 3.37Å; Q57-L60 PolarHBondContact O-N 2.88Å; R58-L60 VanDerWaalsContact C-N 3.35Å; L60-D62 VanDerWaalsContact C-N 3.34Å; L60-D62 PolarHBondContact O-N 3Å; L60-L63 PolarHBondContact O-N 3.04Å; L60-T64 WeakPolarHBondContact O-CG2 3.41Å; L60-T64 PolarHBondContact O-N 3Å; L60-T64 PolarHBondContact O-OG1 3.38Å
61	D	98.7	Very high	98.7	Very high	79 Å²	79	104.3 Å²	104.3	42%	0.422	52%	0.515	S	S	.	.	H	α-helix	trans	-58.4	-46.8	178.7	-59.4	-23.4	0	0	0	110.7	Q57 R58 T64 A65	Q57-D61 PolarHBondContact NE2-OD1 3.47Å; Q57-D61 PolarHBondContact O-N 3.33Å; R58-D61 PolarHBondContact O-N 2.96Å; D61-T64 WeakPolarHBondContact CA-OG1 3.32Å; D61-T64 PolarHBondContact O-N 3.5Å; D61-T64 PolarHBondContact O-OG1 3.31Å; D61-A65 PolarHBondContact O-N 2.96Å
62	D	98.8	Very high	98.7	Very high	89 Å²	89	99.3 Å²	99.3	48%	0.476	51%	0.51	S	S	.	.	H	α-helix	trans	-61.4	-46.5	176.7	-177.5	60.8	0	0	0	112.3	R58 L60 T64 A65 Q66	R58-D62 VanDerWaalsContact O-CB 3.3Å; R58-D62 WeakPolarHBondContact O-CB 3.41Å; R58-D62 PolarHBondContact O-N 3.45Å; L60-D62 VanDerWaalsContact C-N 3.34Å; L60-D62 PolarHBondContact O-N 3Å; D62-T64 VanDerWaalsContact C-N 3.32Å; D62-T64 PolarHBondContact O-N 3.14Å; D62-A65 PolarHBondContact O-N 3.45Å; D62-Q66 WeakPolarHBondContact O-CG 3.42Å; D62-Q66 PolarHBondContact O-N 2.67Å; D62-Q66 PolarHBondContact OD2-NE2 3.37Å
63	L	98.8	Very high	98.7	Very high	96 Å²	96	105.2 Å²	105.2	50%	0.503	53%	0.526	S	S	.	.	H	α-helix	trans	-60.8	-40.2	175.3	-75.1	170.4	0	0	0	111.9	Q59 L60 Q66 V67	Q59-L63 WeakPolarHBondContact O-CB 3.43Å; Q59-L63 VanDerWaalsContact O-CG 3.25Å; Q59-L63 WeakPolarHBondContact O-CG 3.26Å; Q59-L63 PolarHBondContact O-N 3.38Å; L60-L63 PolarHBondContact O-N 3.04Å; L63-Q66 PolarHBondContact O-N 3.25Å; L63-V67 WeakPolarHBondContact O-CB 3.46Å; L63-V67 VanDerWaalsContact O-CG2 3.27Å; L63-V67 WeakPolarHBondContact O-CG2 3.44Å; L63-V67 PolarHBondContact O-N 3.02Å
64	T	98.8	Very high	98.7	Very high	94 Å²	94	100.4 Å²	100.4	58%	0.577	51%	0.514	S	S	*	.	H	α-helix	trans	-65.2	-39.8	176.3	59.9	0	0	0	0	112.3	L60 D61 D62 V67 A68	L60-T64 WeakPolarHBondContact O-CG2 3.41Å; L60-T64 PolarHBondContact O-N 3Å; L60-T64 PolarHBondContact O-OG1 3.38Å; D61-T64 WeakPolarHBondContact CA-OG1 3.32Å; D61-T64 PolarHBondContact O-N 3.5Å; D61-T64 PolarHBondContact O-OG1 3.31Å; D62-T64 VanDerWaalsContact C-N 3.32Å; D62-T64 PolarHBondContact O-N 3.14Å; T64-V67 PolarHBondContact O-N 3.02Å; T64-A68 PolarHBondContact O-N 3.48Å
65	A	98.7	Very high	98.7	Very high	59 Å²	59	100.2 Å²	100.2	49%	0.488	52%	0.516	S	S	.	.	H	α-helix	trans	-65.3	-44.3	175.7	0	0	0	0	0	111.7	D61 D62 V67 A68 A69	D61-A65 PolarHBondContact O-N 2.96Å; D62-A65 PolarHBondContact O-N 3.45Å; A65-V67 PolarHBondContact O-N 2.89Å; A65-A68 PolarHBondContact O-N 2.85Å; A65-A69 WeakPolarHBondContact O-CB 3.37Å; A65-A69 PolarHBondContact O-N 3.33Å
66	Q	98.8	Very high	98.7	Very high	92 Å²	92	96.6 Å²	96.6	43%	0.43	52%	0.516	S	S	.	.	H	α-helix	trans	-60.1	-45.1	175.5	-72.7	-175.8	56.9	0	0	111.7	D62 L63 A68 A69 L70	D62-Q66 WeakPolarHBondContact O-CG 3.42Å; D62-Q66 PolarHBondContact O-N 2.67Å; D62-Q66 PolarHBondContact OD2-NE2 3.37Å; L63-Q66 PolarHBondContact O-N 3.25Å; Q66-A68 VanDerWaalsContact C-N 3.34Å; Q66-A68 PolarHBondContact O-N 3.34Å; Q66-A69 PolarHBondContact O-N 3.05Å; Q66-L70 WeakPolarHBondContact O-CB 3.45Å; Q66-L70 VanDerWaalsContact O-CG 3.31Å; Q66-L70 WeakPolarHBondContact O-CG 3.41Å; Q66-L70 PolarHBondContact O-N 3.39Å
67	V	98.8	Very high	98.8	Very high	58 Å²	58	95.4 Å²	95.4	35%	0.352	51%	0.514	S	S	.	.	H	α-helix	trans	-62.5	-41.5	177.1	169.4	0	0	0	0	111.3	L63 T64 A65 L70 R71	L63-V67 WeakPolarHBondContact O-CB 3.46Å; L63-V67 VanDerWaalsContact O-CG2 3.27Å; L63-V67 WeakPolarHBondContact O-CG2 3.44Å; L63-V67 PolarHBondContact O-N 3.02Å; T64-V67 PolarHBondContact O-N 3.02Å; A65-V67 PolarHBondContact O-N 2.89Å; V67-L70 PolarHBondContact O-N 2.85Å; V67-R71 WeakPolarHBondContact O-CG 3.41Å; V67-R71 PolarHBondContact O-N 3.47Å
68	A	98.7	Very high	98.8	Very high	57 Å²	57	95.1 Å²	95.1	47%	0.471	52%	0.516	S	S	.	.	H	α-helix	trans	-62.9	-44.5	175.9	0	0	0	0	0	111.8	T64 A65 Q66 R71 A72	T64-A68 PolarHBondContact O-N 3.48Å; A65-A68 PolarHBondContact O-N 2.85Å; Q66-A68 VanDerWaalsContact C-N 3.34Å; Q66-A68 PolarHBondContact O-N 3.34Å; A68-R71 PolarHBondContact O-N 3.06Å; A68-A72 PolarHBondContact O-N 3.32Å
69	A	98.8	Very high	98.8	Very high	62 Å²	62	89 Å²	89	51%	0.512	50%	0.503	S	S	.	.	H	α-helix	trans	-62.7	-42.7	176.8	0	0	0	0	0	112.2	A65 Q66 A72 R73	A65-A69 WeakPolarHBondContact O-CB 3.37Å; A65-A69 PolarHBondContact O-N 3.33Å; Q66-A69 PolarHBondContact O-N 3.05Å; A69-A72 PolarHBondContact O-N 3.46Å; A69-R73 WeakPolarHBondContact O-CB 3.35Å; A69-R73 PolarHBondContact O-N 2.97Å
70	L	98.8	Very high	98.8	Very high	98 Å²	98	85.9 Å²	85.9	51%	0.513	50%	0.499	S	S	.	.	H	α-helix	trans	-64.2	-41.5	176.1	-73.2	172.3	0	0	0	111.9	Q66 V67 R73 N74	Q66-L70 WeakPolarHBondContact O-CB 3.45Å; Q66-L70 VanDerWaalsContact O-CG 3.31Å; Q66-L70 WeakPolarHBondContact O-CG 3.41Å; Q66-L70 PolarHBondContact O-N 3.39Å; V67-L70 PolarHBondContact O-N 2.85Å; L70-R73 PolarHBondContact O-N 3.38Å; L70-N74 WeakPolarHBondContact O-CB 3.41Å; L70-N74 VanDerWaalsContact O-CG 3.24Å; L70-N74 PolarHBondContact O-N 2.91Å; L70-N74 PolarHBondContact O-OD1 2.74Å
71	R	98.8	Very high	98.8	Very high	178 Å²	178	84 Å²	84	67%	0.672	50%	0.497	S	S	*	.	H	α-helix	trans	-62.2	-44.3	174.9	-75.7	178.4	-179.1	136.1	3.3	112.2	V67 A68 N74 G75	V67-R71 WeakPolarHBondContact O-CG 3.41Å; V67-R71 PolarHBondContact O-N 3.47Å; A68-R71 PolarHBondContact O-N 3.06Å; R71-N74 PolarHBondContact O-N 3.24Å; R71-G75 PolarHBondContact O-N 3.49Å
72	A	98.8	Very high	98.8	Very high	68 Å²	68	87.7 Å²	87.7	56%	0.562	51%	0.506	S	S	*	.	H	α-helix	trans	-62.5	-43.9	176.6	0	0	0	0	0	111.6	A68 A69 G75 A76	A68-A72 PolarHBondContact O-N 3.32Å; A69-A72 PolarHBondContact O-N 3.46Å; A72-G75 PolarHBondContact O-N 3.01Å; A72-A76 PolarHBondContact O-N 3.02Å
73	R	98.8	Very high	98.8	Very high	170 Å²	170	85.8 Å²	85.8	64%	0.642	50%	0.495	S	S	*	.	H	α-helix	trans	-62.6	-45.3	176.7	-176.1	176.2	178.9	165.4	1	112.1	A69 L70 G75 A76 M77	A69-R73 WeakPolarHBondContact O-CB 3.35Å; A69-R73 PolarHBondContact O-N 2.97Å; L70-R73 PolarHBondContact O-N 3.38Å; R73-G75 VanDerWaalsContact C-N 3.35Å; R73-G75 PolarHBondContact O-N 3.26Å; R73-A76 PolarHBondContact O-N 3.42Å; R73-M77 HydrophobicContact CG-SD 4.17Å; R73-M77 WeakPolarHBondContact O-CG 3.35Å; R73-M77 PolarHBondContact O-N 2.89Å
74	N	98.7	Very high	98.8	Very high	89 Å²	89	83.6 Å²	83.6	48%	0.476	49%	0.491	S	S	.	.	H	α-helix	trans	-61	-44.9	177	-72.7	-6.1	0	0	0	111	L70 R71 A76 M77 D78	L70-N74 WeakPolarHBondContact O-CB 3.41Å; L70-N74 VanDerWaalsContact O-CG 3.24Å; L70-N74 PolarHBondContact O-N 2.91Å; L70-N74 PolarHBondContact O-OD1 2.74Å; R71-N74 PolarHBondContact O-N 3.24Å; N74-A76 VanDerWaalsContact C-N 3.33Å; N74-A76 PolarHBondContact O-N 3.31Å; N74-M77 PolarHBondContact O-N 3.06Å; N74-D78 PolarHBondContact O-N 2.79Å
75	G	98.7	Very high	98.8	Very high	37 Å²	37	81.8 Å²	81.8	38%	0.381	49%	0.486	S	S	.	.	H	α-helix	trans	-60	-40	175.8	0	0	0	0	0	113.4	R71 A72 R73 D78 A79	R71-G75 PolarHBondContact O-N 3.49Å; A72-G75 PolarHBondContact O-N 3.01Å; R73-G75 VanDerWaalsContact C-N 3.35Å; R73-G75 PolarHBondContact O-N 3.26Å; G75-D78 PolarHBondContact O-N 3.21Å; G75-A79 PolarHBondContact O-N 3.23Å; G75-A79 VanDerWaalsContact O-N 3.07Å
76	A	98.8	Very high	98.8	Very high	62 Å²	62	86.2 Å²	86.2	51%	0.512	49%	0.49	S	S	.	.	H	α-helix	trans	-66.6	-41.1	174.8	0	0	0	0	0	112.3	A72 R73 N74 A79 A80	A72-A76 PolarHBondContact O-N 3.02Å; R73-A76 PolarHBondContact O-N 3.42Å; N74-A76 VanDerWaalsContact C-N 3.33Å; N74-A76 PolarHBondContact O-N 3.31Å; A76-A79 PolarHBondContact O-N 3.42Å; A76-A80 PolarHBondContact O-N 3.11Å
77	M	98.7	Very high	98.8	Very high	109 Å²	109	89.7 Å²	89.7	54%	0.537	50%	0.499	S	S	.	.	H	α-helix	trans	-63.3	-42.3	175.3	-73.2	179	60.3	0	0	111.8	R73 N74 A79 A80 A81	R73-M77 HydrophobicContact CG-SD 4.17Å; R73-M77 WeakPolarHBondContact O-CG 3.35Å; R73-M77 PolarHBondContact O-N 2.89Å; N74-M77 PolarHBondContact O-N 3.06Å; M77-A79 VanDerWaalsContact C-N 3.32Å; M77-A79 PolarHBondContact O-N 3.33Å; M77-A80 PolarHBondContact O-N 3.49Å; M77-A81 WeakPolarHBondContact O-CB 3.35Å; M77-A81 PolarHBondContact O-N 2.74Å
78	D	98.8	Very high	98.8	Very high	95 Å²	95	90.5 Å²	90.5	51%	0.508	51%	0.507	S	S	.	.	H	α-helix	trans	-64.7	-35.8	176.5	-71.8	-21.1	0	0	0	112.3	N74 G75 R82	N74-D78 PolarHBondContact O-N 2.79Å; G75-D78 PolarHBondContact O-N 3.21Å; D78-R82 WeakPolarHBondContact O-CB 3.47Å; D78-R82 WeakPolarHBondContact O-CG 3.31Å; D78-R82 PolarHBondContact O-N 3.27Å; D78-R82 VanDerWaalsContact O-N 3.12Å; D78-R82 PolarHBondContact O-NE 2.9Å; D78-R82 VanDerWaalsContact O-NE 3.09Å
79	A	98.7	Very high	98.8	Very high	49 Å²	49	92.2 Å²	92.2	41%	0.405	51%	0.511	S	S	.	.	H	α-helix	trans	-66.9	-44.9	174.2	0	0	0	0	0	111.4	G75 A76 M77 R82 D83	G75-A79 PolarHBondContact O-N 3.23Å; G75-A79 VanDerWaalsContact O-N 3.07Å; A76-A79 PolarHBondContact O-N 3.42Å; M77-A79 VanDerWaalsContact C-N 3.32Å; M77-A79 PolarHBondContact O-N 3.33Å; A79-R82 PolarHBondContact O-N 3.09Å; A79-D83 PolarHBondContact O-N 3.41Å
80	A	98.8	Very high	98.8	Very high	62 Å²	62	92.2 Å²	92.2	51%	0.512	51%	0.511	S	S	.	.	H	α-helix	trans	-63.6	-42.5	177.1	0	0	0	0	0	112.2	A76 M77 R82 D83 A84	A76-A80 PolarHBondContact O-N 3.11Å; M77-A80 PolarHBondContact O-N 3.49Å; A80-R82 PolarHBondContact O-N 2.91Å; A80-D83 PolarHBondContact O-N 3.49Å; A80-A84 WeakPolarHBondContact O-CB 3.48Å; A80-A84 PolarHBondContact O-N 3.33Å
81	A	98.8	Very high	98.8	Very high	60 Å²	60	91 Å²	91	50%	0.496	51%	0.507	S	S	.	.	H	α-helix	trans	-62.5	-42.3	176.8	0	0	0	0	0	111.9	M77 A84 A85	M77-A81 WeakPolarHBondContact O-CB 3.35Å; M77-A81 PolarHBondContact O-N 2.74Å; A81-A84 PolarHBondContact O-N 3.12Å; A81-A85 WeakPolarHBondContact O-CB 3.44Å; A81-A85 PolarHBondContact O-N 3.37Å
82	R	98.8	Very high	98.8	Very high	157 Å²	157	88.7 Å²	88.7	59%	0.592	50%	0.504	S	S	*	.	H	α-helix	trans	-64.2	-39.1	175	-77.5	-178.8	-76.3	-172.1	-3.6	112.4	D78 A79 A80 A85 R86	D78-R82 WeakPolarHBondContact O-CB 3.47Å; D78-R82 WeakPolarHBondContact O-CG 3.31Å; D78-R82 PolarHBondContact O-N 3.27Å; D78-R82 VanDerWaalsContact O-N 3.12Å; D78-R82 PolarHBondContact O-NE 2.9Å; D78-R82 VanDerWaalsContact O-NE 3.09Å; A79-R82 PolarHBondContact O-N 3.09Å; A80-R82 PolarHBondContact O-N 2.91Å; R82-A85 PolarHBondContact O-N 2.98Å; R82-R86 WeakPolarHBondContact O-CG 3.48Å; R82-R86 PolarHBondContact O-N 3.38Å; R82-R86 VanDerWaalsContact O-N 3.11Å
83	D	98.8	Very high	98.8	Very high	49 Å²	49	88.4 Å²	88.4	26%	0.262	50%	0.502	S	S	.	.	H	α-helix	trans	-66.2	-45	175.5	-167.2	59.5	0	0	0	112.2	A79 A80 A85 R86 R87	A79-D83 PolarHBondContact O-N 3.41Å; A80-D83 PolarHBondContact O-N 3.49Å; D83-A85 VanDerWaalsContact C-N 3.32Å; D83-A85 PolarHBondContact O-N 3.07Å; D83-R86 PolarHBondContact O-N 3.44Å; D83-R86 IonicContact OD1-CZ 3.63Å; D83-R86 IonicContact OD1-NE 3.77Å; D83-R86 IonicContact OD1-NH2 2.74Å; D83-R86 PolarHBondContact OD1-NH2 3.49Å; D83-R87 WeakPolarHBondContact O-CG 3.34Å; D83-R87 PolarHBondContact O-N 3.49Å; D83-R87 IonicContact OD2-CZ 3.19Å; D83-R87 IonicContact OD2-NE 2.79Å; D83-R87 PolarHBondContact OD2-NE 3.18Å; D83-R87 IonicContact OD2-NH2 2.74Å; D83-R87 PolarHBondContact OD2-NH2 2.91Å
84	A	98.8	Very high	98.8	Very high	50 Å²	50	86 Å²	86	41%	0.413	50%	0.498	S	S	.	.	H	α-helix	trans	-58.4	-44.1	174.2	0	0	0	0	0	111.7	A80 A81 R86 R87 C88	A80-A84 WeakPolarHBondContact O-CB 3.48Å; A80-A84 PolarHBondContact O-N 3.33Å; A81-A84 PolarHBondContact O-N 3.12Å; A84-R86 PolarHBondContact O-N 2.84Å; A84-R87 PolarHBondContact O-N 3.36Å; A84-C88 PolarHBondContact O-N 3.43Å; A84-C88 PolarHBondContact O-SG 2.98Å
85	A	98.8	Very high	98.8	Very high	56 Å²	56	85.4 Å²	85.4	46%	0.463	50%	0.495	S	S	.	.	H	α-helix	trans	-59.6	-43.3	176.9	0	0	0	0	0	112.2	A81 R82 D83 C88 V89	A81-A85 WeakPolarHBondContact O-CB 3.44Å; A81-A85 PolarHBondContact O-N 3.37Å; R82-A85 PolarHBondContact O-N 2.98Å; D83-A85 VanDerWaalsContact C-N 3.32Å; D83-A85 PolarHBondContact O-N 3.07Å; A85-C88 PolarHBondContact O-N 3.38Å; A85-V89 WeakPolarHBondContact O-CG2 3.25Å; A85-V89 PolarHBondContact O-N 2.99Å
86	R	98.8	Very high	98.8	Very high	153 Å²	153	86.5 Å²	86.5	58%	0.577	50%	0.5	S	S	*	.	H	α-helix	trans	-61.4	-43.8	174.9	-73.1	-170.7	-59.2	-98.5	1.2	112.3	R82 D83 A84 C88 V89 A90	R82-R86 WeakPolarHBondContact O-CG 3.48Å; R82-R86 PolarHBondContact O-N 3.38Å; R82-R86 VanDerWaalsContact O-N 3.11Å; D83-R86 PolarHBondContact O-N 3.44Å; D83-R86 IonicContact OD1-CZ 3.63Å; D83-R86 IonicContact OD1-NE 3.77Å; D83-R86 IonicContact OD1-NH2 2.74Å; D83-R86 PolarHBondContact OD1-NH2 3.49Å; A84-R86 PolarHBondContact O-N 2.84Å; R86-C88 VanDerWaalsContact C-N 3.35Å; R86-V89 PolarHBondContact O-N 3.26Å; R86-A90 PolarHBondContact O-N 2.99Å
87	R	98.8	Very high	98.8	Very high	165 Å²	165	90.4 Å²	90.4	62%	0.623	51%	0.51	S	S	*	.	H	α-helix	trans	-63.2	-41.7	177.1	-66.6	176.9	-164.9	-130.1	4.2	111.5	D83 A84 V89 A90 V91	D83-R87 WeakPolarHBondContact O-CG 3.34Å; D83-R87 PolarHBondContact O-N 3.49Å; D83-R87 IonicContact OD2-CZ 3.19Å; D83-R87 IonicContact OD2-NE 2.79Å; D83-R87 PolarHBondContact OD2-NE 3.18Å; D83-R87 IonicContact OD2-NH2 2.74Å; D83-R87 PolarHBondContact OD2-NH2 2.91Å; A84-R87 PolarHBondContact O-N 3.36Å; R87-V89 VanDerWaalsContact C-N 3.35Å; R87-V89 PolarHBondContact O-N 2.88Å; R87-A90 PolarHBondContact O-N 3.33Å; R87-V91 WeakPolarHBondContact O-CG2 3.27Å; R87-V91 PolarHBondContact O-N 2.96Å
88	C	98.8	Very high	98.8	Very high	75 Å²	75	89.6 Å²	89.6	51%	0.507	51%	0.507	S	S	.	.	H	α-helix	trans	-59.7	-44.3	175.8	-71.8	0	0	0	0	111.8	A84 A85 R86 A90 V91 Q92	A84-C88 PolarHBondContact O-N 3.43Å; A84-C88 PolarHBondContact O-SG 2.98Å; A85-C88 PolarHBondContact O-N 3.38Å; R86-C88 VanDerWaalsContact C-N 3.35Å; C88-A90 PolarHBondContact O-N 2.87Å; C88-V91 PolarHBondContact O-N 3.45Å; C88-Q92 WeakPolarHBondContact O-CB 3.39Å; C88-Q92 VanDerWaalsContact O-CG 3.26Å; C88-Q92 WeakPolarHBondContact O-CG 3.41Å; C88-Q92 PolarHBondContact O-N 3.49Å
89	V	98.8	Very high	98.8	Very high	93 Å²	93	91.1 Å²	91.1	56%	0.564	51%	0.511	S	S	*	.	H	α-helix	trans	-62.4	-42.3	176.3	172	0	0	0	0	111.4	A85 R86 R87 Q92 A93	A85-V89 WeakPolarHBondContact O-CG2 3.25Å; A85-V89 PolarHBondContact O-N 2.99Å; R86-V89 PolarHBondContact O-N 3.26Å; R87-V89 VanDerWaalsContact C-N 3.35Å; R87-V89 PolarHBondContact O-N 2.88Å; V89-Q92 PolarHBondContact O-N 2.92Å; V89-A93 PolarHBondContact O-N 2.92Å
90	A	98.7	Very high	98.8	Very high	61 Å²	61	91.8 Å²	91.8	50%	0.504	52%	0.516	S	S	.	.	H	α-helix	trans	-61.5	-46.2	177.3	0	0	0	0	0	112.1	R86 R87 C88 Q92 A93 E94	R86-A90 PolarHBondContact O-N 2.99Å; R87-A90 PolarHBondContact O-N 3.33Å; C88-A90 PolarHBondContact O-N 2.87Å; A90-Q92 VanDerWaalsContact C-N 3.34Å; A90-Q92 PolarHBondContact O-N 3.36Å; A90-A93 PolarHBondContact O-N 3.3Å; A90-E94 PolarHBondContact O-N 3.48Å
91	V	98.8	Very high	98.8	Very high	74 Å²	74	94.5 Å²	94.5	45%	0.448	51%	0.513	S	S	.	.	H	α-helix	trans	-64.7	-37.8	177	171.6	0	0	0	0	111.6	R87 C88 A93 E94 N95	R87-V91 WeakPolarHBondContact O-CG2 3.27Å; R87-V91 PolarHBondContact O-N 2.96Å; C88-V91 PolarHBondContact O-N 3.45Å; V91-A93 VanDerWaalsContact C-N 3.34Å; V91-A93 PolarHBondContact O-N 3.26Å; V91-E94 PolarHBondContact O-N 3Å; V91-N95 WeakPolarHBondContact O-CB 3.45Å; V91-N95 VanDerWaalsContact O-CG 3.32Å; V91-N95 PolarHBondContact O-N 2.88Å; V91-N95 PolarHBondContact O-ND2 2.7Å
92	Q	98.8	Very high	98.8	Very high	128 Å²	128	95.2 Å²	95.2	60%	0.598	51%	0.512	S	S	*	.	H	α-helix	trans	-62.8	-40.8	174.7	-76.5	172.3	-13.7	0	0	112.1	C88 V89 A90 N95 A96	C88-Q92 WeakPolarHBondContact O-CB 3.39Å; C88-Q92 VanDerWaalsContact O-CG 3.26Å; C88-Q92 WeakPolarHBondContact O-CG 3.41Å; C88-Q92 PolarHBondContact O-N 3.49Å; V89-Q92 PolarHBondContact O-N 2.92Å; A90-Q92 VanDerWaalsContact C-N 3.34Å; A90-Q92 PolarHBondContact O-N 3.36Å; Q92-N95 PolarHBondContact O-N 3.46Å; Q92-A96 WeakPolarHBondContact O-CB 3.5Å; Q92-A96 PolarHBondContact O-N 3.37Å
93	A	98.8	Very high	98.8	Very high	63 Å²	63	92.6 Å²	92.6	52%	0.521	51%	0.513	S	S	.	.	H	α-helix	trans	-65	-42.4	175.9	0	0	0	0	0	111.9	V89 A90 V91 A96 M97	V89-A93 PolarHBondContact O-N 2.92Å; A90-A93 PolarHBondContact O-N 3.3Å; V91-A93 VanDerWaalsContact C-N 3.34Å; V91-A93 PolarHBondContact O-N 3.26Å; A93-A96 PolarHBondContact O-N 2.79Å; A93-M97 PolarHBondContact O-N 3.2Å
94	E	98.8	Very high	98.8	Very high	119 Å²	119	93.5 Å²	93.5	56%	0.556	52%	0.515	S	S	*	.	H	α-helix	trans	-62.4	-45.7	175	-173.9	176.3	-175.5	0	0	111.6	A90 V91 A96 M97 L98	A90-E94 PolarHBondContact O-N 3.48Å; V91-E94 PolarHBondContact O-N 3Å; E94-A96 VanDerWaalsContact C-N 3.31Å; E94-A96 PolarHBondContact O-N 2.86Å; E94-M97 WeakPolarHBondContact O-CB 3.3Å; E94-M97 PolarHBondContact O-N 2.95Å; E94-M97 VanDerWaalsContact O-N 3.14Å; E94-L98 HydrophobicContact CG-CD1 4.28Å; E94-L98 WeakPolarHBondContact O-CG 3.42Å; E94-L98 PolarHBondContact O-N 3.44Å
95	N	98.8	Very high	98.8	Very high	77 Å²	77	94.7 Å²	94.7	41%	0.412	51%	0.514	S	S	.	.	H	α-helix	trans	-59.9	-40.9	175.4	-76	-25	0	0	0	112	V91 Q92 M97 L98 H99	V91-N95 WeakPolarHBondContact O-CB 3.45Å; V91-N95 VanDerWaalsContact O-CG 3.32Å; V91-N95 PolarHBondContact O-N 2.88Å; V91-N95 PolarHBondContact O-ND2 2.7Å; Q92-N95 PolarHBondContact O-N 3.46Å; N95-M97 VanDerWaalsContact C-N 3.33Å; N95-M97 PolarHBondContact O-N 3.38Å; N95-L98 PolarHBondContact O-N 3.43Å; N95-H99 WeakPolarHBondContact O-CB 3.35Å; N95-H99 PolarHBondContact O-CD2 2.96Å; N95-H99 PolarHBondContact O-N 3.26Å
96	A	98.8	Very high	98.8	Very high	60 Å²	60	95.5 Å²	95.5	50%	0.496	52%	0.517	S	S	.	.	H	α-helix	trans	-62.5	-41.1	175.9	0	0	0	0	0	111.9	Q92 A93 E94 H99 A100	Q92-A96 WeakPolarHBondContact O-CB 3.5Å; Q92-A96 PolarHBondContact O-N 3.37Å; A93-A96 PolarHBondContact O-N 2.79Å; E94-A96 VanDerWaalsContact C-N 3.31Å; E94-A96 PolarHBondContact O-N 2.86Å; A96-H99 PolarHBondContact O-N 3.44Å; A96-A100 WeakPolarHBondContact O-CB 3.33Å; A96-A100 PolarHBondContact O-N 2.98Å
97	M	98.7	Very high	98.7	Very high	144 Å²	144	91.1 Å²	91.1	71%	0.709	51%	0.513	S	S	*	.	H	α-helix	trans	-64.4	-44.9	174.8	178.6	-178.4	155.9	0	0	111.8	A93 E94 N95 A100 R101	A93-M97 PolarHBondContact O-N 3.2Å; E94-M97 WeakPolarHBondContact O-CB 3.3Å; E94-M97 PolarHBondContact O-N 2.95Å; E94-M97 VanDerWaalsContact O-N 3.14Å; N95-M97 VanDerWaalsContact C-N 3.33Å; N95-M97 PolarHBondContact O-N 3.38Å; M97-A100 PolarHBondContact O-N 3.25Å; M97-R101 PolarHBondContact O-N 2.87Å
98	L	98.8	Very high	98.7	Very high	91 Å²	91	90 Å²	90	48%	0.476	51%	0.509	S	S	.	.	H	α-helix	trans	-61.1	-44.8	176.3	-70.7	174.1	0	0	0	110.9	E94 N95 A100 R101 T102	E94-L98 HydrophobicContact CG-CD1 4.28Å; E94-L98 WeakPolarHBondContact O-CG 3.42Å; E94-L98 PolarHBondContact O-N 3.44Å; N95-L98 PolarHBondContact O-N 3.43Å; L98-A100 PolarHBondContact O-N 2.87Å; L98-R101 PolarHBondContact O-N 2.92Å; L98-T102 WeakPolarHBondContact O-CG2 3.48Å; L98-T102 PolarHBondContact O-N 3.31Å; L98-T102 PolarHBondContact O-OG1 3.01Å
99	H	98.8	Very high	98.7	Very high	127 Å²	127	91.9 Å²	91.9	59%	0.588	51%	0.513	S	S	*	.	H	α-helix	trans	-59	-46.6	174.8	-80.5	-57.5	0	0	0	112.1	N95 A96 R101 T102 V103	N95-H99 WeakPolarHBondContact O-CB 3.35Å; N95-H99 PolarHBondContact O-CD2 2.96Å; N95-H99 PolarHBondContact O-N 3.26Å; A96-H99 PolarHBondContact O-N 3.44Å; H99-R101 VanDerWaalsContact C-N 3.29Å; H99-R101 PolarHBondContact O-N 2.73Å; H99-T102 WeakPolarHBondContact CA-OG1 3.42Å; H99-T102 PolarHBondContact O-N 3.47Å; H99-T102 PolarHBondContact O-OG1 3.28Å; H99-V103 WeakPolarHBondContact O-CG2 3.43Å; H99-V103 PolarHBondContact O-N 3.03Å
100	A	98.7	Very high	98.7	Very high	63 Å²	63	92.3 Å²	92.3	52%	0.521	51%	0.509	S	S	.	.	H	α-helix	trans	-58.9	-42.9	176.4	0	0	0	0	0	111.6	A96 M97 L98 V103 E104	A96-A100 WeakPolarHBondContact O-CB 3.33Å; A96-A100 PolarHBondContact O-N 2.98Å; M97-A100 PolarHBondContact O-N 3.25Å; L98-A100 PolarHBondContact O-N 2.87Å; A100-V103 PolarHBondContact O-N 3.42Å; A100-E104 PolarHBondContact O-N 3.21Å
101	R	98.6	Very high	98.7	Very high	120 Å²	120	93 Å²	93	45%	0.453	51%	0.51	S	S	.	.	H	α-helix	trans	-66.3	-38.8	177.4	-174.3	55.8	172.6	-166.5	-1.7	112.5	M97 L98 H99 V103 E104 L105	M97-R101 PolarHBondContact O-N 2.87Å; L98-R101 PolarHBondContact O-N 2.92Å; H99-R101 VanDerWaalsContact C-N 3.29Å; H99-R101 PolarHBondContact O-N 2.73Å; R101-V103 VanDerWaalsContact C-N 3.34Å; R101-E104 VanDerWaalsContact CD-OE2 3.28Å; R101-E104 WeakPolarHBondContact CD-OE2 3.18Å; R101-E104 IonicContact CZ-OE2 3.63Å; R101-E104 IonicContact NE-OE2 3.84Å; R101-E104 VanDerWaalsContact NH1-CD 3.29Å; R101-E104 IonicContact NH1-OE1 3.23Å; R101-E104 PolarHBondContact NH1-OE1 3.31Å; R101-E104 IonicContact NH1-OE2 2.73Å; R101-E104 PolarHBondContact NH1-OE2 3.06Å; R101-E104 PolarHBondContact O-N 3.03Å; R101-L105 HydrophobicContact CG-CD1 4.02Å; R101-L105 HydrophobicContact CG-CG 4.38Å; R101-L105 WeakPolarHBondContact O-CB 3.28Å; R101-L105 VanDerWaalsContact O-CG 3.32Å; R101-L105 WeakPolarHBondContact O-CG 3.46Å; R101-L105 PolarHBondContact O-N 3.46Å
102	T	98.8	Very high	98.7	Very high	75 Å²	75	94.2 Å²	94.2	46%	0.46	51%	0.514	S	S	.	.	H	α-helix	trans	-62.4	-43.4	175	55.6	0	0	0	0	111.3	L98 H99 E104 L105 S106	L98-T102 WeakPolarHBondContact O-CG2 3.48Å; L98-T102 PolarHBondContact O-N 3.31Å; L98-T102 PolarHBondContact O-OG1 3.01Å; H99-T102 WeakPolarHBondContact CA-OG1 3.42Å; H99-T102 PolarHBondContact O-N 3.47Å; H99-T102 PolarHBondContact O-OG1 3.28Å; T102-E104 PolarHBondContact O-N 2.87Å; T102-L105 PolarHBondContact O-N 3.35Å; T102-S106 VanDerWaalsContact O-CB 3.32Å; T102-S106 WeakPolarHBondContact O-CB 3.31Å; T102-S106 PolarHBondContact O-N 2.89Å; T102-S106 PolarHBondContact O-OG 2.87Å
103	V	98.8	Very high	98.6	Very high	101 Å²	101	91.1 Å²	91.1	61%	0.612	50%	0.503	S	S	*	.	H	α-helix	trans	-62.7	-45.7	177.8	170.7	0	0	0	0	110.9	H99 A100 R101 S106 A107	H99-V103 WeakPolarHBondContact O-CG2 3.43Å; H99-V103 PolarHBondContact O-N 3.03Å; A100-V103 PolarHBondContact O-N 3.42Å; R101-V103 VanDerWaalsContact C-N 3.34Å; V103-S106 PolarHBondContact O-N 3.04Å; V103-A107 WeakPolarHBondContact O-CB 3.4Å; V103-A107 PolarHBondContact O-N 3.46Å
104	E	98.7	Very high	98.6	Very high	68 Å²	68	91.4 Å²	91.4	32%	0.318	50%	0.496	S	S	.	.	H	α-helix	trans	-58.5	-49.5	177.2	-175.8	-163.9	171.9	0	0	111.9	A100 R101 T102 A107 R108	A100-E104 PolarHBondContact O-N 3.21Å; R101-E104 VanDerWaalsContact CD-OE2 3.28Å; R101-E104 WeakPolarHBondContact CD-OE2 3.18Å; R101-E104 IonicContact CZ-OE2 3.63Å; R101-E104 IonicContact NE-OE2 3.84Å; R101-E104 VanDerWaalsContact NH1-CD 3.29Å; R101-E104 IonicContact NH1-OE1 3.23Å; R101-E104 PolarHBondContact NH1-OE1 3.31Å; R101-E104 IonicContact NH1-OE2 2.73Å; R101-E104 PolarHBondContact NH1-OE2 3.06Å; R101-E104 PolarHBondContact O-N 3.03Å; T102-E104 PolarHBondContact O-N 2.87Å; E104-A107 PolarHBondContact O-N 3.45Å; E104-R108 WeakPolarHBondContact O-CG 3.34Å; E104-R108 PolarHBondContact O-N 3.29Å; E104-R108 IonicContact OE1-CZ 3.18Å; E104-R108 IonicContact OE1-NE 3.22Å; E104-R108 PolarHBondContact OE1-NE 2.96Å; E104-R108 IonicContact OE1-NH2 2.62Å; E104-R108 PolarHBondContact OE1-NH2 3.49Å
105	L	98.7	Very high	98.5	Very high	75 Å²	75	90.5 Å²	90.5	39%	0.393	50%	0.495	S	S	.	.	H	α-helix	trans	-67.7	-39.6	-178.8	-69.5	176.2	0	0	0	111.9	R101 T102 A107 R108 L109	R101-L105 HydrophobicContact CG-CD1 4.02Å; R101-L105 HydrophobicContact CG-CG 4.38Å; R101-L105 WeakPolarHBondContact O-CB 3.28Å; R101-L105 VanDerWaalsContact O-CG 3.32Å; R101-L105 WeakPolarHBondContact O-CG 3.46Å; R101-L105 PolarHBondContact O-N 3.46Å; T102-L105 PolarHBondContact O-N 3.35Å; L105-A107 VanDerWaalsContact C-N 3.35Å; L105-R108 PolarHBondContact O-N 3.35Å; L105-L109 WeakPolarHBondContact O-CG 3.4Å; L105-L109 PolarHBondContact O-N 2.94Å
106	S	98.7	Very high	98.4	Very high	74 Å²	74	90.7 Å²	90.7	52%	0.517	50%	0.495	S	S	.	.	H	α-helix	trans	-61	-42.6	173.9	-68.8	0	0	0	0	111.9	T102 V103 L109 Q110	T102-S106 VanDerWaalsContact O-CB 3.32Å; T102-S106 WeakPolarHBondContact O-CB 3.31Å; T102-S106 PolarHBondContact O-N 2.89Å; T102-S106 PolarHBondContact O-OG 2.87Å; V103-S106 PolarHBondContact O-N 3.04Å; S106-L109 PolarHBondContact O-N 2.88Å; S106-Q110 PolarHBondContact O-N 3.45Å
107	A	98.6	Very high	98.3	Very high	61 Å²	61	93 Å²	93	50%	0.504	50%	0.495	S	S	.	.	H	α-helix	trans	-64.4	-41.1	176.2	0	0	0	0	0	112.3	V103 E104 L105 Q110 S111	V103-A107 WeakPolarHBondContact O-CB 3.4Å; V103-A107 PolarHBondContact O-N 3.46Å; E104-A107 PolarHBondContact O-N 3.45Å; L105-A107 VanDerWaalsContact C-N 3.35Å; A107-Q110 PolarHBondContact O-N 3.43Å; A107-S111 PolarHBondContact O-N 2.85Å
108	R	98.4	Very high	98.1	Very high	142 Å²	142	90.4 Å²	90.4	54%	0.536	49%	0.491	S	S	.	.	H	α-helix	trans	-62.4	-43.8	174.8	-71.3	173.1	-176.9	-136	1.6	111.7	E104 L105 S111 L112	E104-R108 WeakPolarHBondContact O-CG 3.34Å; E104-R108 PolarHBondContact O-N 3.29Å; E104-R108 IonicContact OE1-CZ 3.18Å; E104-R108 IonicContact OE1-NE 3.22Å; E104-R108 PolarHBondContact OE1-NE 2.96Å; E104-R108 IonicContact OE1-NH2 2.62Å; E104-R108 PolarHBondContact OE1-NH2 3.49Å; L105-R108 PolarHBondContact O-N 3.35Å; R108-S111 PolarHBondContact O-N 2.84Å; R108-L112 WeakPolarHBondContact O-CG 3.45Å; R108-L112 PolarHBondContact O-N 3.28Å; R108-L112 VanDerWaalsContact O-N 3.09Å
109	L	98.7	Very high	97.9	Very high	114 Å²	114	91 Å²	91	60%	0.597	49%	0.492	S	S	*	.	H	α-helix	trans	-62.2	-44.3	176	-75.4	173.5	0	0	0	111.5	L105 S106 S111 L112 V113	L105-L109 WeakPolarHBondContact O-CG 3.4Å; L105-L109 PolarHBondContact O-N 2.94Å; S106-L109 PolarHBondContact O-N 2.88Å; L109-S111 VanDerWaalsContact C-N 3.34Å; L109-S111 PolarHBondContact O-N 2.97Å; L109-L112 PolarHBondContact O-N 3.5Å; L109-V113 WeakPolarHBondContact O-CG2 3.25Å; L109-V113 PolarHBondContact O-N 3.41Å
110	Q	98.5	Very high	97.6	Very high	101 Å²	101	90.8 Å²	90.8	47%	0.472	49%	0.492	S	S	.	.	H	α-helix	trans	-60.5	-44.8	177.1	-171.8	60.2	45.7	0	0	111.5	S106 A107 L112 V113 D114	S106-Q110 PolarHBondContact O-N 3.45Å; A107-Q110 PolarHBondContact O-N 3.43Å; Q110-L112 VanDerWaalsContact C-N 3.28Å; Q110-L112 PolarHBondContact O-N 2.83Å; Q110-V113 WeakPolarHBondContact O-CB 3.27Å; Q110-V113 PolarHBondContact O-N 3.4Å; Q110-V113 VanDerWaalsContact O-N 3.1Å; Q110-D114 PolarHBondContact NE2-OD1 2.86Å; Q110-D114 PolarHBondContact O-N 3.3Å
111	S	98.4	Very high	97.3	Very high	76 Å²	76	90.4 Å²	90.4	53%	0.531	49%	0.488	S	S	.	.	H	α-helix	trans	-59.4	-37.8	176.4	175.7	0	0	0	0	112.9	A107 R108 L109 L115	A107-S111 PolarHBondContact O-N 2.85Å; R108-S111 PolarHBondContact O-N 2.84Å; L109-S111 VanDerWaalsContact C-N 3.34Å; L109-S111 PolarHBondContact O-N 2.97Å; S111-L115 WeakPolarHBondContact O-CB 3.4Å; S111-L115 PolarHBondContact O-N 3.34Å
112	L	98.4	Very high	96.8	Very high	99 Å²	99	85.9 Å²	85.9	52%	0.518	48%	0.479	S	S	.	.	H	α-helix	trans	-69.3	-39.1	174.9	-68.9	173.9	0	0	0	112	R108 L109 Q110 L115 I116	R108-L112 WeakPolarHBondContact O-CG 3.45Å; R108-L112 PolarHBondContact O-N 3.28Å; R108-L112 VanDerWaalsContact O-N 3.09Å; L109-L112 PolarHBondContact O-N 3.5Å; Q110-L112 VanDerWaalsContact C-N 3.28Å; Q110-L112 PolarHBondContact O-N 2.83Å; L112-L115 PolarHBondContact O-N 3.25Å; L112-I116 VanDerWaalsContact O-CG1 3.29Å; L112-I116 WeakPolarHBondContact O-CG1 3.35Å; L112-I116 PolarHBondContact O-N 3.13Å
113	V	98.1	Very high	96.2	Very high	63 Å²	63	87 Å²	87	38%	0.382	48%	0.482	S	S	.	.	H	α-helix	trans	-62	-46	174.6	169.5	0	0	0	0	110.6	L109 Q110 L115 I116 Q117	L109-V113 WeakPolarHBondContact O-CG2 3.25Å; L109-V113 PolarHBondContact O-N 3.41Å; Q110-V113 WeakPolarHBondContact O-CB 3.27Å; Q110-V113 PolarHBondContact O-N 3.4Å; Q110-V113 VanDerWaalsContact O-N 3.1Å; V113-L115 VanDerWaalsContact C-N 3.34Å; V113-L115 PolarHBondContact O-N 3.2Å; V113-I116 PolarHBondContact O-N 3.07Å; V113-Q117 WeakPolarHBondContact O-CG 3.37Å; V113-Q117 PolarHBondContact O-N 2.94Å
114	D	97.6	Very high	95.5	Very high	69 Å²	69	84 Å²	84	37%	0.369	47%	0.468	S	S	.	.	H	α-helix	trans	-62.4	-42.1	178.3	-62	-18.3	0	0	0	110.9	Q110 I116 Q117 C118	Q110-D114 PolarHBondContact NE2-OD1 2.86Å; Q110-D114 PolarHBondContact O-N 3.3Å; D114-I116 VanDerWaalsContact C-N 3.35Å; D114-I116 PolarHBondContact O-N 3.25Å; D114-Q117 PolarHBondContact O-N 3.5Å; D114-C118 PolarHBondContact O-N 3.02Å; D114-C118 PolarHBondContact O-SG 3.11Å; D114-C118 VanDerWaalsContact O-SG 3.34Å
115	L	97	Very high	94.6	Very high	100 Å²	100	87 Å²	87	52%	0.524	48%	0.483	S	S	.	.	H	α-helix	trans	-59.5	-44.5	175.2	-173.7	77.2	0	0	0	111.7	S111 L112 V113 Q117 C118 M119	S111-L115 WeakPolarHBondContact O-CB 3.4Å; S111-L115 PolarHBondContact O-N 3.34Å; L112-L115 PolarHBondContact O-N 3.25Å; V113-L115 VanDerWaalsContact C-N 3.34Å; V113-L115 PolarHBondContact O-N 3.2Å; L115-Q117 VanDerWaalsContact C-N 3.34Å; L115-C118 PolarHBondContact O-N 3.32Å; L115-M119 HydrophobicContact CG-CE 4.37Å; L115-M119 WeakPolarHBondContact O-CG 3.45Å; L115-M119 PolarHBondContact O-N 2.85Å
116	I	96.7	Very high	93.6	Very high	81 Å²	81	91.1 Å²	91.1	42%	0.415	50%	0.495	S	S	.	.	H	α-helix	trans	-62	-43.8	177.5	-69.2	164.7	0	0	0	110.7	L112 V113 D114 M119 Q120	L112-I116 VanDerWaalsContact O-CG1 3.29Å; L112-I116 WeakPolarHBondContact O-CG1 3.35Å; L112-I116 PolarHBondContact O-N 3.13Å; V113-I116 PolarHBondContact O-N 3.07Å; D114-I116 VanDerWaalsContact C-N 3.35Å; D114-I116 PolarHBondContact O-N 3.25Å; I116-M119 HydrophobicContact CB-CE 4.47Å; I116-M119 HydrophobicContact CG1-CE 4.08Å; I116-M119 PolarHBondContact O-N 2.91Å; I116-Q120 HydrophobicContact CG2-CG 4.46Å; I116-Q120 WeakPolarHBondContact O-CG 3.14Å; I116-Q120 PolarHBondContact O-N 2.98Å
117	Q	96	Very high	92.6	Very high	109 Å²	109	94.3 Å²	94.3	51%	0.509	50%	0.501	S	S	.	.	H	α-helix	trans	-63.4	-41.6	177.4	-69.6	174.2	12.3	0	0	111.8	V113 D114 L115 M119 Q120 A121	V113-Q117 WeakPolarHBondContact O-CG 3.37Å; V113-Q117 PolarHBondContact O-N 2.94Å; D114-Q117 PolarHBondContact O-N 3.5Å; L115-Q117 VanDerWaalsContact C-N 3.34Å; Q117-M119 PolarHBondContact O-N 3.42Å; Q117-Q120 PolarHBondContact O-N 2.91Å; Q117-A121 WeakPolarHBondContact O-CB 3.32Å; Q117-A121 PolarHBondContact O-N 3.42Å
118	C	95	Very high	91.5	Very high	90 Å²	90	100 Å²	100	61%	0.608	51%	0.511	S	S	*	.	H	α-helix	trans	-61.2	-42.7	174.5	-71.7	0	0	0	0	112.3	D114 L115 A121 G122	D114-C118 PolarHBondContact O-N 3.02Å; D114-C118 PolarHBondContact O-SG 3.11Å; D114-C118 VanDerWaalsContact O-SG 3.34Å; L115-C118 PolarHBondContact O-N 3.32Å; C118-A121 PolarHBondContact O-N 3.41Å; C118-G122 PolarHBondContact O-N 3.45Å
119	M	94.4	Very high	90.3	Very high	103 Å²	103	100.3 Å²	100.3	51%	0.507	52%	0.519	S	S	.	.	H	α-helix	trans	-63.5	-44.6	176.5	-70.3	-174.1	-62	0	0	111.7	L115 I116 Q117 A121 G122 D123	L115-M119 HydrophobicContact CG-CE 4.37Å; L115-M119 WeakPolarHBondContact O-CG 3.45Å; L115-M119 PolarHBondContact O-N 2.85Å; I116-M119 HydrophobicContact CB-CE 4.47Å; I116-M119 HydrophobicContact CG1-CE 4.08Å; I116-M119 PolarHBondContact O-N 2.91Å; Q117-M119 PolarHBondContact O-N 3.42Å; M119-A121 VanDerWaalsContact C-N 3.34Å; M119-A121 PolarHBondContact O-N 2.93Å; M119-G122 PolarHBondContact O-N 3.02Å; M119-G122 VanDerWaalsContact O-N 3.17Å; M119-D123 PolarHBondContact O-N 3.07Å
120	Q	93.4	Very high	88.7	Confident	123 Å²	123	102.6 Å²	102.6	58%	0.575	53%	0.526	S	S	*	.	H	α-helix	trans	-63.2	-38.5	177.7	-72.1	173.7	-11.4	0	0	112.7	I116 Q117 D123 A124	I116-Q120 HydrophobicContact CG2-CG 4.46Å; I116-Q120 WeakPolarHBondContact O-CG 3.14Å; I116-Q120 PolarHBondContact O-N 2.98Å; Q117-Q120 PolarHBondContact O-N 2.91Å; Q120-D123 PolarHBondContact O-N 2.93Å; Q120-A124 PolarHBondContact O-N 3.41Å
121	A	91.3	Very high	86.9	Confident	55 Å²	55	103.2 Å²	103.2	46%	0.455	53%	0.532	S	S	.	.	H	α-helix	trans	-65.5	-39.5	173.9	0	0	0	0	0	111.9	Q117 C118 M119 A124 M125	Q117-A121 WeakPolarHBondContact O-CB 3.32Å; Q117-A121 PolarHBondContact O-N 3.42Å; C118-A121 PolarHBondContact O-N 3.41Å; M119-A121 VanDerWaalsContact C-N 3.34Å; M119-A121 PolarHBondContact O-N 2.93Å; A121-A124 PolarHBondContact O-N 3.32Å; A121-M125 WeakPolarHBondContact O-CG 3.45Å; A121-M125 PolarHBondContact O-N 2.97Å
122	G	88.9	Confident	85	Confident	24 Å²	24	104.7 Å²	104.7	25%	0.247	54%	0.54	C	S	.	.	H	α-helix	trans	-59	-50.3	173.2	0	0	0	0	0	112.1	C118 M119 A124 M125 Y126	C118-G122 PolarHBondContact O-N 3.45Å; M119-G122 PolarHBondContact O-N 3.02Å; M119-G122 VanDerWaalsContact O-N 3.17Å; G122-A124 VanDerWaalsContact C-N 3.32Å; G122-A124 PolarHBondContact O-N 3.46Å; G122-M125 PolarHBondContact O-N 3.2Å; G122-M125 VanDerWaalsContact O-N 3.13Å; G122-Y126 WeakPolarHBondContact O-CD2 3.5Å; G122-Y126 PolarHBondContact O-N 2.89Å
123	D	86.9	Confident	83.2	Confident	100 Å²	100	108.3 Å²	108.3	54%	0.535	56%	0.559	S	S	.	*	H	α-helix	trans	-58.6	-42.8	177.4	-77.9	-12	0	0	0	112.1	M119 Q120 Y126 Q127	M119-D123 PolarHBondContact O-N 3.07Å; Q120-D123 PolarHBondContact O-N 2.93Å; D123-Y126 PolarHBondContact O-N 3.47Å; D123-Q127 VanDerWaalsContact O-CG 3.32Å; D123-Q127 WeakPolarHBondContact O-CG 3.41Å; D123-Q127 PolarHBondContact O-N 2.94Å
124	A	83.9	Confident	81.4	Confident	37 Å²	37	111 Å²	111	31%	0.306	58%	0.575	S	S	.	*	H	α-helix	trans	-61.4	-44.1	175.2	0	0	0	0	0	111.7	Q120 A121 G122 Q127 Y128	Q120-A124 PolarHBondContact O-N 3.41Å; A121-A124 PolarHBondContact O-N 3.32Å; G122-A124 VanDerWaalsContact C-N 3.32Å; G122-A124 PolarHBondContact O-N 3.46Å; A124-Q127 WeakPolarHBondContact O-CB 3.29Å; A124-Q127 PolarHBondContact O-N 2.93Å; A124-Y128 WeakPolarHBondContact O-CD2 3.42Å; A124-Y128 PolarHBondContact O-N 2.9Å
125	M	79.5	Confident	79.4	Confident	132 Å²	132	112.4 Å²	112.4	65%	0.65	58%	0.583	S	S	*	*	H	α-helix	trans	-62.7	-41.8	176.5	-74.1	-173.1	70.3	0	0	112.6	A121 G122 Q127 Y128 Q129	A121-M125 WeakPolarHBondContact O-CG 3.45Å; A121-M125 PolarHBondContact O-N 2.97Å; G122-M125 PolarHBondContact O-N 3.2Å; G122-M125 VanDerWaalsContact O-N 3.13Å; M125-Q127 VanDerWaalsContact C-N 3.29Å; M125-Q127 PolarHBondContact O-N 2.67Å; M125-Y128 PolarHBondContact O-N 3.29Å; M125-Q129 PolarHBondContact O-N 3.44Å; M125-Q129 VanDerWaalsContact O-N 3.13Å
126	Y	78.2	Confident	77.5	Confident	160 Å²	160	111.6 Å²	111.6	63%	0.627	59%	0.591	S	S	*	*	H	α-helix	trans	-61.9	-38	174.2	-76.9	-66.4	0	0	0	111.7	G122 D123 Q129 Q130	G122-Y126 WeakPolarHBondContact O-CD2 3.5Å; G122-Y126 PolarHBondContact O-N 2.89Å; D123-Y126 PolarHBondContact O-N 3.47Å; Y126-Q129 PolarHBondContact O-N 2.91Å; Y126-Q130 VanDerWaalsContact O-CG 3.27Å; Y126-Q130 WeakPolarHBondContact O-CG 3.48Å; Y126-Q130 PolarHBondContact O-N 2.89Å
127	Q	76.7	Confident	75.5	Confident	141 Å²	141	112.2 Å²	112.2	66%	0.659	60%	0.598	S	S	*	*	H	α-helix	trans	-65.2	-38.9	175.1	-70.9	172.3	13.5	0	0	112.7	D123 A124 M125 Q129 Q130	D123-Q127 VanDerWaalsContact O-CG 3.32Å; D123-Q127 WeakPolarHBondContact O-CG 3.41Å; D123-Q127 PolarHBondContact O-N 2.94Å; A124-Q127 WeakPolarHBondContact O-CB 3.29Å; A124-Q127 PolarHBondContact O-N 2.93Å; M125-Q127 VanDerWaalsContact C-N 3.29Å; M125-Q127 PolarHBondContact O-N 2.67Å; Q127-Q129 PolarHBondContact O-N 3.43Å; Q127-Q130 PolarHBondContact O-N 3.03Å
128	Y	75.1	Confident	73.7	Confident	180 Å²	180	112.8 Å²	112.8	71%	0.706	60%	0.604	S	S	*	*	H	α-helix	trans	-66.4	-33.8	175.3	-75.8	-71.9	0	0	0	113.3	A124 M125 Q130 L131	A124-Y128 WeakPolarHBondContact O-CD2 3.42Å; A124-Y128 PolarHBondContact O-N 2.9Å; M125-Y128 PolarHBondContact O-N 3.29Å; Y128-Q130 PolarHBondContact O-N 2.93Å; Y128-L131 HydrophobicContact CD1-CD1 4.17Å; Y128-L131 VanDerWaalsContact O-CD1 3.26Å; Y128-L131 WeakPolarHBondContact O-CD1 3.27Å; Y128-L131 PolarHBondContact O-N 2.9Å
129	Q	72.9	Confident	71.7	Confident	149 Å²	149	119 Å²	119	70%	0.696	62%	0.616	S	S	*	*	H	α-helix	trans	-70.2	-18.7	174.9	-76.3	-177.7	-23.1	0	0	113.3	M125 Y126 Q127	M125-Q129 PolarHBondContact O-N 3.44Å; M125-Q129 VanDerWaalsContact O-N 3.13Å; Y126-Q129 PolarHBondContact O-N 2.91Å; Q127-Q129 PolarHBondContact O-N 3.43Å
130	Q	65.4	Low	69.7	Low	162 Å²	162	119.5 Å²	119.5	76%	0.757	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.6	6.9	179.8	-65.1	-75.9	12.4	0	0	113.5	Y126 Q127 Y128 P132	Y126-Q130 VanDerWaalsContact O-CG 3.27Å; Y126-Q130 WeakPolarHBondContact O-CG 3.48Å; Y126-Q130 PolarHBondContact O-N 2.89Å; Q127-Q130 PolarHBondContact O-N 3.03Å; Y128-Q130 PolarHBondContact O-N 2.93Å; Q130-P132 WeakPolarHBondContact O-CD 3.17Å
131	L	60.1	Low	67.7	Low	115 Å²	115	123.4 Å²	123.4	60%	0.602	63%	0.632	S	S	*	*	S	Bend	trans	-60.2	126.6	169.4	-87.4	94	0	0	0	108.3	Y128 L133	Y128-L131 HydrophobicContact CD1-CD1 4.17Å; Y128-L131 VanDerWaalsContact O-CD1 3.26Å; Y128-L131 WeakPolarHBondContact O-CD1 3.27Å; Y128-L131 PolarHBondContact O-N 2.9Å; L131-L133 PolarHBondContact O-N 2.99Å
132	P	59.8	Low	65.9	Low	107 Å²	107	135 Å²	135	70%	0.695	67%	0.666	S	S	*	*			trans	-55.1	134.4	175	2	0	0	0	0	107.5	Q130 V134	Q130-P132 WeakPolarHBondContact O-CD 3.17Å; P132-V134 PolarHBondContact O-N 2.92Å
133	L	59.6	Low	64.7	Low	175 Å²	175	140.6 Å²	140.6	92%	0.916	69%	0.687	S	S	*	*			trans	-51.1	95.5	157.5	-76.7	155.8	0	0	0	105.2	L131 D135	L131-L133 PolarHBondContact O-N 2.99Å; L133-D135 VanDerWaalsContact C-N 3.32Å; L133-D135 PolarHBondContact O-N 3.01Å
134	V	61.4	Low	63.6	Low	118 Å²	118	142.7 Å²	142.7	72%	0.715	70%	0.695	S	S	*	*			trans	-60.3	110.1	171.9	-151.9	0	0	0	0	102.3	P132 A136 I138	P132-V134 PolarHBondContact O-N 2.92Å; V134-A136 PolarHBondContact O-N 2.78Å; V134-I138 HydrophobicContact CG1-CD1 4.49Å
135	D	55.4	Low	62.4	Low	99 Å²	99	148.6 Å²	148.6	53%	0.529	72%	0.716	S	S	.	*			trans	-47.2	120.5	-165.9	-166.4	3.1	0	0	0	108.3	L133 T137 I138	L133-D135 VanDerWaalsContact C-N 3.32Å; L133-D135 PolarHBondContact O-N 3.01Å; D135-T137 WeakPolarHBondContact CB-OG1 3.48Å; D135-T137 PolarHBondContact O-N 3.1Å; D135-T137 WeakPolarHBondContact OD1-CG2 3.48Å; D135-T137 PolarHBondContact OD1-OG1 3.07Å; D135-T137 WeakPolarHBondContact OD2-CG2 3.41Å; D135-T137 PolarHBondContact OD2-OG1 3.25Å; D135-I138 PolarHBondContact O-N 2.77Å
136	A	56	Low	61.4	Low	84 Å²	84	149.6 Å²	149.6	69%	0.694	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.9	0.2	179.5	0	0	0	0	0	111.7	V134 I138	V134-A136 PolarHBondContact O-N 2.78Å; A136-I138 VanDerWaalsContact C-N 3.35Å
137	T	55.3	Low	60.4	Low	93 Å²	93	148.9 Å²	148.9	57%	0.571	73%	0.726	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.7	-15.3	167.7	62.8	0	0	0	0	114.4	D135	D135-T137 WeakPolarHBondContact CB-OG1 3.48Å; D135-T137 PolarHBondContact O-N 3.1Å; D135-T137 WeakPolarHBondContact OD1-CG2 3.48Å; D135-T137 PolarHBondContact OD1-OG1 3.07Å; D135-T137 WeakPolarHBondContact OD2-CG2 3.41Å; D135-T137 PolarHBondContact OD2-OG1 3.25Å
138	I	58.5	Low	59.3	Low	122 Å²	122	149.5 Å²	149.5	63%	0.626	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.7	-29.2	177.3	-56.9	-179.2	0	0	0	112.1	V134 D135 A136	V134-I138 HydrophobicContact CG1-CD1 4.49Å; D135-I138 PolarHBondContact O-N 2.77Å; A136-I138 VanDerWaalsContact C-N 3.35Å
139	Y	53.4	Low	58.2	Low	220 Å²	220	147.3 Å²	147.3	86%	0.863	73%	0.732	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.6	51.4	176.3	-71.2	-76.5	0	0	0	111.8
140	N	52	Low	57	Low	114 Å²	114	147.2 Å²	147.2	61%	0.61	74%	0.735	S	S	*	*			trans	-161.6	90.2	166.8	-120.2	-16.7	0	0	0	109.8
141	Y	52.4	Low	56.3	Low	205 Å²	205	145.9 Å²	145.9	80%	0.804	73%	0.733	S	S	*	*				164.1	139.3	111	-102.6	-94.1	0	0	0	110.2
142	Y	52.2	Low	56	Low	299 Å²	299	148.7 Å²	148.7	100%	1.173	75%	0.745	S	S	*	*			trans	-41.9	0	164	-73.5	-94.5	0	0	0	113.8

Retrieved 142 of 142 residues in 84.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).