A0A060VQF0_ONCMY Loading...

Complex III subunit 9

Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The complex plays an important role in the uptake of multiple carbon sources present in different host niches.

AlphaFold DB , UniProt , Accession A0A060VQF0, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene uqcr10, Length 62 aa.

						>A0A060VQF0_ONCMY|A0A060VQF0|uqcr10
MSLAKGVYNLLFRRTSTFAVTIMVGAVFFERMFDQGGDAIFEQLNRGKLWKHIKHQYETEEE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.1	Low	92.4	Very high	232 Å²	232	104.3 Å²	104.3	100%	1.143	56%	0.564	S	S	*	*				0	142.3	0	-75.7	-164.1	-175.2	0	0	108.6
2	S	92.6	Very high	92.8	Very high	74 Å²	74	102 Å²	102	52%	0.517	55%	0.546	S	S	.	.			trans	-73.4	138.4	173.3	160.9	0	0	0	0	110.7	A4 K5 G6	S2-A4 VanDerWaalsContact C-N 3.29Å; S2-A4 PolarHBondContact O-N 2.91Å; S2-A4 PolarHBondContact OG-N 2.98Å; S2-K5 WeakPolarHBondContact O-CB 3.43Å; S2-K5 PolarHBondContact O-N 2.99Å; S2-K5 VanDerWaalsContact O-N 3.1Å; S2-G6 PolarHBondContact O-N 3.04Å
3	L	94.4	Very high	93	Very high	146 Å²	146	106.8 Å²	106.8	76%	0.764	55%	0.551	S	S	*	*	H	α-helix	trans	-54.9	-44.3	175.9	-179.4	66.9	0	0	0	111.5	K5 G6 V7	L3-K5 VanDerWaalsContact C-N 3.29Å; L3-K5 PolarHBondContact O-N 3.29Å; L3-G6 PolarHBondContact O-N 3.37Å; L3-G6 VanDerWaalsContact O-N 3.1Å; L3-V7 HydrophobicContact CD1-CG2 4.5Å; L3-V7 WeakPolarHBondContact O-CG2 3.4Å; L3-V7 PolarHBondContact O-N 2.91Å
4	A	94.6	Very high	93.4	Very high	70 Å²	70	111.9 Å²	111.9	58%	0.579	56%	0.56	S	S	*	*	H	α-helix	trans	-60.4	-39.4	178	0	0	0	0	0	112	S2 G6 V7 Y8	S2-A4 VanDerWaalsContact C-N 3.29Å; S2-A4 PolarHBondContact O-N 2.91Å; S2-A4 PolarHBondContact OG-N 2.98Å; A4-G6 VanDerWaalsContact C-N 3.34Å; A4-V7 PolarHBondContact O-N 3.48Å; A4-Y8 WeakPolarHBondContact O-CB 3.45Å; A4-Y8 PolarHBondContact O-N 3.25Å
5	K	95	Very high	93.6	Very high	140 Å²	140	112.6 Å²	112.6	61%	0.609	57%	0.573	S	S	*	*	H	α-helix	trans	-68.3	-34.6	176.8	-163.5	173.9	-174.9	176.9	0	111.7	S2 L3 N9	S2-K5 WeakPolarHBondContact O-CB 3.43Å; S2-K5 PolarHBondContact O-N 2.99Å; S2-K5 VanDerWaalsContact O-N 3.1Å; L3-K5 VanDerWaalsContact C-N 3.29Å; L3-K5 PolarHBondContact O-N 3.29Å; K5-N9 WeakPolarHBondContact O-CB 3.48Å; K5-N9 PolarHBondContact O-N 3.1Å; K5-N9 PolarHBondContact O-ND2 3.06Å
6	G	95.6	Very high	93.8	Very high	35 Å²	35	110.7 Å²	110.7	36%	0.361	57%	0.573	S	S	.	*	H	α-helix	trans	-65.4	-49.7	173.2	0	0	0	0	0	112.1	S2 L3 A4 Y8 N9 L10	S2-G6 PolarHBondContact O-N 3.04Å; L3-G6 PolarHBondContact O-N 3.37Å; L3-G6 VanDerWaalsContact O-N 3.1Å; A4-G6 VanDerWaalsContact C-N 3.34Å; G6-Y8 PolarHBondContact O-N 3.45Å; G6-N9 PolarHBondContact O-N 3.45Å; G6-L10 WeakPolarHBondContact O-CB 3.47Å; G6-L10 PolarHBondContact O-N 3.35Å
7	V	95.2	Very high	94	Very high	57 Å²	57	107.2 Å²	107.2	35%	0.345	56%	0.558	S	S	.	*	H	α-helix	trans	-61	-45.5	179.1	167.7	0	0	0	0	111.8	L3 A4 N9 L10 L11 F12	L3-V7 HydrophobicContact CD1-CG2 4.5Å; L3-V7 WeakPolarHBondContact O-CG2 3.4Å; L3-V7 PolarHBondContact O-N 2.91Å; A4-V7 PolarHBondContact O-N 3.48Å; V7-N9 PolarHBondContact O-N 3.31Å; V7-L10 PolarHBondContact O-N 3.1Å; V7-L11 HydrophobicContact CG1-CD1 4.32Å; V7-L11 PolarHBondContact O-N 3.35Å; V7-F12 HydrophobicContact CG1-CD2 3.9Å; V7-F12 HydrophobicContact CG1-CE2 3.51Å
8	Y	96.1	Very high	94.2	Very high	133 Å²	133	106.1 Å²	106.1	52%	0.522	55%	0.548	S	S	.	.	I	π-helix	trans	-58.6	-48.2	176.7	177.7	-96.3	0	0	0	112	A4 G6 L10 F12 R13	A4-Y8 WeakPolarHBondContact O-CB 3.45Å; A4-Y8 PolarHBondContact O-N 3.25Å; G6-Y8 PolarHBondContact O-N 3.45Å; Y8-L10 VanDerWaalsContact C-N 3.29Å; Y8-L10 PolarHBondContact O-N 3.39Å; Y8-F12 HydrophobicContact CD2-CB 3.91Å; Y8-F12 HydrophobicContact CE2-CB 4.32Å; Y8-F12 CarbonylContact O-C 3.26Å; Y8-F12 PolarHBondContact O-N 2.92Å; Y8-R13 HydrophobicContact CD1-CB 4.42Å; Y8-R13 HydrophobicContact CE1-CB 4.11Å; Y8-R13 HydrophobicContact CE1-CG 4.38Å; Y8-R13 WeakPolarHBondContact O-CB 3.49Å; Y8-R13 PolarHBondContact O-N 2.91Å
9	N	95.3	Very high	94.4	Very high	72 Å²	72	102.8 Å²	102.8	39%	0.385	54%	0.539	S	S	.	.	I	π-helix	trans	-65.8	-32	-179	-76.7	-42.3	0	0	0	113.2	K5 G6 V7	K5-N9 WeakPolarHBondContact O-CB 3.48Å; K5-N9 PolarHBondContact O-N 3.1Å; K5-N9 PolarHBondContact O-ND2 3.06Å; G6-N9 PolarHBondContact O-N 3.45Å; V7-N9 PolarHBondContact O-N 3.31Å
10	L	94.8	Very high	94.6	Very high	128 Å²	128	101.7 Å²	101.7	67%	0.67	54%	0.536	S	S	*	.	I	π-helix	trans	-80.6	-47.3	-178	-177.2	65.8	0	0	0	112.6	G6 V7 Y8	G6-L10 WeakPolarHBondContact O-CB 3.47Å; G6-L10 PolarHBondContact O-N 3.35Å; V7-L10 PolarHBondContact O-N 3.1Å; Y8-L10 VanDerWaalsContact C-N 3.29Å; Y8-L10 PolarHBondContact O-N 3.39Å
11	L	95.3	Very high	94.8	Very high	60 Å²	60	98.6 Å²	98.6	31%	0.314	52%	0.521	S	S	.	.	I	π-helix	trans	-106.8	-41.7	-167.7	-59.4	-179.8	0	0	0	112.4	V7 T17 F18 T21	V7-L11 HydrophobicContact CG1-CD1 4.32Å; V7-L11 PolarHBondContact O-N 3.35Å; L11-T17 CarbonylContact O-C 3.53Å; L11-T17 VanDerWaalsContact O-C 3.3Å; L11-T17 PolarHBondContact O-OG1 3.5Å; L11-F18 WeakPolarHBondContact O-CA 3.48Å; L11-F18 PolarHBondContact O-N 3.24Å; L11-F18 VanDerWaalsContact O-N 3.15Å; L11-T21 HydrophobicContact CB-CG2 4.11Å; L11-T21 HydrophobicContact CD1-CG2 4.16Å
12	F	96.1	Very high	96.2	Very high	77 Å²	77	91.7 Å²	91.7	34%	0.338	49%	0.488	S	S	.	.	I	π-helix	trans	-106.8	-8.1	-163.5	-56.2	-66.4	0	0	0	115.1	V7 Y8 F18 T21	V7-F12 HydrophobicContact CG1-CD2 3.9Å; V7-F12 HydrophobicContact CG1-CE2 3.51Å; Y8-F12 HydrophobicContact CD2-CB 3.91Å; Y8-F12 HydrophobicContact CE2-CB 4.32Å; Y8-F12 CarbonylContact O-C 3.26Å; Y8-F12 PolarHBondContact O-N 2.92Å; F12-F18 HydrophobicContact CB-CD2 4.18Å; F12-F18 AromaticContact CD1-CD2 3.59Å; F12-F18 HydrophobicContact CD1-CD2 3.59Å; F12-F18 AromaticContact CD1-CE2 3.89Å; F12-F18 HydrophobicContact CD1-CE2 3.89Å; F12-F18 HydrophobicContact CG-CD2 4.37Å; F12-T21 HydrophobicContact CE1-CG2 3.88Å; F12-T21 HydrophobicContact CZ-CG2 4.17Å
13	R	96.6	Very high	96.5	Very high	164 Å²	164	93.9 Å²	93.9	62%	0.619	49%	0.491	S	S	*	.	S	Bend	trans	-73.2	-34.9	-176.3	178.7	175.5	173.6	172.7	-1.5	114.2	Y8	Y8-R13 HydrophobicContact CD1-CB 4.42Å; Y8-R13 HydrophobicContact CE1-CB 4.11Å; Y8-R13 HydrophobicContact CE1-CG 4.38Å; Y8-R13 WeakPolarHBondContact O-CB 3.49Å; Y8-R13 PolarHBondContact O-N 2.91Å
14	R	97.3	Very high	96.6	Very high	178 Å²	178	90.6 Å²	90.6	67%	0.672	48%	0.477	S	S	*	.	S	Bend	trans	-107.2	135.1	179.7	-64.8	-178.9	-179.2	-116.3	3.5	109.6	S16 T17 F18	R14-S16 PolarHBondContact O-N 3.23Å; R14-T17 HydrophobicContact CB-CG2 4.42Å; R14-T17 PolarHBondContact O-N 3.39Å; R14-T17 PolarHBondContact O-OG1 3.47Å; R14-F18 VanDerWaalsContact O-CB 3.24Å; R14-F18 WeakPolarHBondContact O-CB 3.24Å; R14-F18 PolarHBondContact O-N 2.7Å
15	T	97.3	Very high	96.8	Very high	123 Å²	123	89 Å²	89	76%	0.755	47%	0.467	S	S	*	.	H	α-helix	trans	-57.9	-35.8	-178.4	-46.5	0	0	0	0	113	F18 A19	T15-F18 WeakPolarHBondContact O-CB 3.4Å; T15-A19 WeakPolarHBondContact O-CB 3.34Å; T15-A19 PolarHBondContact O-N 3.47Å
16	S	97.1	Very high	97	Very high	82 Å²	82	84.7 Å²	84.7	57%	0.573	46%	0.458	S	S	*	.	H	α-helix	trans	-66.3	-47.4	177.3	52.8	0	0	0	0	112.8	R14 F18 A19 V20	R14-S16 PolarHBondContact O-N 3.23Å; S16-F18 VanDerWaalsContact C-N 3.32Å; S16-A19 PolarHBondContact O-N 3.29Å; S16-V20 WeakPolarHBondContact O-CG2 3.4Å; S16-V20 PolarHBondContact O-N 2.87Å
17	T	96.8	Very high	97.1	Very high	51 Å²	51	87.5 Å²	87.5	31%	0.313	47%	0.468	S	S	.	.	H	α-helix	trans	-69.3	-34.1	177.4	59.9	0	0	0	0	111.5	L11 R14 V20 T21	L11-T17 CarbonylContact O-C 3.53Å; L11-T17 VanDerWaalsContact O-C 3.3Å; L11-T17 PolarHBondContact O-OG1 3.5Å; R14-T17 HydrophobicContact CB-CG2 4.42Å; R14-T17 PolarHBondContact O-N 3.39Å; R14-T17 PolarHBondContact O-OG1 3.47Å; T17-V20 PolarHBondContact O-N 3.15Å; T17-T21 WeakPolarHBondContact O-CB 3.46Å; T17-T21 PolarHBondContact O-N 2.85Å; T17-T21 PolarHBondContact O-OG1 2.98Å
18	F	97.8	Very high	97.2	Very high	87 Å²	87	91.2 Å²	91.2	38%	0.382	48%	0.48	S	S	.	.	H	α-helix	trans	-58.7	-51	174	176.2	-92.8	0	0	0	111.3	L11 F12 R14 T15 S16 V20 T21 I22	L11-F18 WeakPolarHBondContact O-CA 3.48Å; L11-F18 PolarHBondContact O-N 3.24Å; L11-F18 VanDerWaalsContact O-N 3.15Å; F12-F18 HydrophobicContact CB-CD2 4.18Å; F12-F18 AromaticContact CD1-CD2 3.59Å; F12-F18 HydrophobicContact CD1-CD2 3.59Å; F12-F18 AromaticContact CD1-CE2 3.89Å; F12-F18 HydrophobicContact CD1-CE2 3.89Å; F12-F18 HydrophobicContact CG-CD2 4.37Å; R14-F18 VanDerWaalsContact O-CB 3.24Å; R14-F18 WeakPolarHBondContact O-CB 3.24Å; R14-F18 PolarHBondContact O-N 2.7Å; T15-F18 WeakPolarHBondContact O-CB 3.4Å; S16-F18 VanDerWaalsContact C-N 3.32Å; F18-V20 PolarHBondContact O-N 3.2Å; F18-T21 WeakPolarHBondContact O-CB 3.39Å; F18-T21 PolarHBondContact O-N 3.01Å; F18-I22 HydrophobicContact CD1-CD1 3.91Å; F18-I22 HydrophobicContact CE1-CD1 3.28Å; F18-I22 HydrophobicContact CE1-CG1 4.43Å; F18-I22 HydrophobicContact CE2-CD1 4.07Å; F18-I22 HydrophobicContact CZ-CD1 3.35Å; F18-I22 HydrophobicContact CZ-CG1 4.43Å; F18-I22 PolarHBondContact O-N 3.44Å
19	A	98.2	Very high	97.3	Very high	45 Å²	45	90.8 Å²	90.8	37%	0.372	48%	0.481	S	S	.	.	H	α-helix	trans	-61	-45.7	179.8	0	0	0	0	0	112.2	T15 S16 T21 I22 M23	T15-A19 WeakPolarHBondContact O-CB 3.34Å; T15-A19 PolarHBondContact O-N 3.47Å; S16-A19 PolarHBondContact O-N 3.29Å; A19-T21 VanDerWaalsContact C-N 3.34Å; A19-T21 PolarHBondContact O-N 2.93Å; A19-I22 PolarHBondContact O-N 3.12Å; A19-M23 WeakPolarHBondContact O-CG 3.38Å; A19-M23 PolarHBondContact O-N 3.33Å
20	V	98.1	Very high	97.4	Very high	80 Å²	80	92.9 Å²	92.9	49%	0.485	49%	0.488	S	S	.	.	H	α-helix	trans	-62	-42.3	176.3	174.4	0	0	0	0	111.4	S16 T17 F18 I22 M23 V24	S16-V20 WeakPolarHBondContact O-CG2 3.4Å; S16-V20 PolarHBondContact O-N 2.87Å; T17-V20 PolarHBondContact O-N 3.15Å; F18-V20 PolarHBondContact O-N 3.2Å; V20-I22 VanDerWaalsContact C-N 3.3Å; V20-I22 PolarHBondContact O-N 3.45Å; V20-M23 HydrophobicContact CG2-CE 4.17Å; V20-M23 PolarHBondContact O-N 3.21Å; V20-V24 HydrophobicContact CG1-CG2 4.27Å; V20-V24 WeakPolarHBondContact O-CG2 3.3Å; V20-V24 PolarHBondContact O-N 2.99Å
21	T	98.1	Very high	97.6	Very high	36 Å²	36	94.6 Å²	94.6	22%	0.221	49%	0.486	C	S	.	.	H	α-helix	trans	-59.3	-42.4	177.5	-59	0	0	0	0	111.2	L11 F12 T17 F18 A19 G25	L11-T21 HydrophobicContact CB-CG2 4.11Å; L11-T21 HydrophobicContact CD1-CG2 4.16Å; F12-T21 HydrophobicContact CE1-CG2 3.88Å; F12-T21 HydrophobicContact CZ-CG2 4.17Å; T17-T21 WeakPolarHBondContact O-CB 3.46Å; T17-T21 PolarHBondContact O-N 2.85Å; T17-T21 PolarHBondContact O-OG1 2.98Å; F18-T21 WeakPolarHBondContact O-CB 3.39Å; F18-T21 PolarHBondContact O-N 3.01Å; A19-T21 VanDerWaalsContact C-N 3.34Å; A19-T21 PolarHBondContact O-N 2.93Å; T21-G25 WeakPolarHBondContact O-CA 3.49Å; T21-G25 PolarHBondContact O-N 2.84Å
22	I	97.9	Very high	97.7	Very high	88 Å²	88	97.6 Å²	97.6	45%	0.451	50%	0.5	S	S	.	.	H	α-helix	trans	-66.3	-47	177.5	-70.3	177.3	0	0	0	111.2	F18 A19 V20 V24 G25 A26	F18-I22 HydrophobicContact CD1-CD1 3.91Å; F18-I22 HydrophobicContact CE1-CD1 3.28Å; F18-I22 HydrophobicContact CE1-CG1 4.43Å; F18-I22 HydrophobicContact CE2-CD1 4.07Å; F18-I22 HydrophobicContact CZ-CD1 3.35Å; F18-I22 HydrophobicContact CZ-CG1 4.43Å; F18-I22 PolarHBondContact O-N 3.44Å; A19-I22 PolarHBondContact O-N 3.12Å; V20-I22 VanDerWaalsContact C-N 3.3Å; V20-I22 PolarHBondContact O-N 3.45Å; I22-V24 PolarHBondContact O-N 2.81Å; I22-G25 PolarHBondContact O-N 3.31Å; I22-A26 VanDerWaalsContact O-CB 3.3Å; I22-A26 WeakPolarHBondContact O-CB 3.45Å; I22-A26 PolarHBondContact O-N 3.27Å
23	M	98.3	Very high	97.8	Very high	120 Å²	120	100.1 Å²	100.1	59%	0.591	51%	0.511	S	S	*	.	H	α-helix	trans	-60.2	-48.5	-179	-71	-173.7	-66.3	0	0	111.7	A19 V20 A26 V27	A19-M23 WeakPolarHBondContact O-CG 3.38Å; A19-M23 PolarHBondContact O-N 3.33Å; V20-M23 HydrophobicContact CG2-CE 4.17Å; V20-M23 PolarHBondContact O-N 3.21Å; M23-A26 PolarHBondContact O-N 3.02Å; M23-V27 WeakPolarHBondContact O-CG2 3.47Å; M23-V27 PolarHBondContact O-N 3.43Å
24	V	98.2	Very high	97.9	Very high	77 Å²	77	96.1 Å²	96.1	47%	0.467	50%	0.502	S	S	.	.	H	α-helix	trans	-64.4	-46.3	177	175.3	0	0	0	0	110.2	V20 I22 A26 V27 F28	V20-V24 HydrophobicContact CG1-CG2 4.27Å; V20-V24 WeakPolarHBondContact O-CG2 3.3Å; V20-V24 PolarHBondContact O-N 2.99Å; I22-V24 PolarHBondContact O-N 2.81Å; V24-A26 VanDerWaalsContact C-N 3.28Å; V24-A26 PolarHBondContact O-N 3.28Å; V24-V27 PolarHBondContact O-N 3.3Å; V24-F28 HydrophobicContact CG1-CD2 3.79Å; V24-F28 HydrophobicContact CG1-CE2 3.9Å; V24-F28 WeakPolarHBondContact O-CD2 3.41Å; V24-F28 PolarHBondContact O-N 2.85Å; V24-F28 VanDerWaalsContact O-N 3.12Å
25	G	98.1	Very high	97.9	Very high	36 Å²	36	92.4 Å²	92.4	37%	0.371	49%	0.492	S	S	.	.	H	α-helix	trans	-57	-41.3	178.6	0	0	0	0	0	112.7	T21 I22 F29	T21-G25 WeakPolarHBondContact O-CA 3.49Å; T21-G25 PolarHBondContact O-N 2.84Å; I22-G25 PolarHBondContact O-N 3.31Å; G25-F29 WeakPolarHBondContact O-CB 3.45Å; G25-F29 PolarHBondContact O-N 3.48Å
26	A	98.3	Very high	98	Very high	50 Å²	50	88.1 Å²	88.1	41%	0.413	47%	0.472	S	S	.	.	H	α-helix	trans	-64.1	-47.6	178.9	0	0	0	0	0	112.2	I22 M23 V24 F28 F29 E30	I22-A26 VanDerWaalsContact O-CB 3.3Å; I22-A26 WeakPolarHBondContact O-CB 3.45Å; I22-A26 PolarHBondContact O-N 3.27Å; M23-A26 PolarHBondContact O-N 3.02Å; V24-A26 VanDerWaalsContact C-N 3.28Å; V24-A26 PolarHBondContact O-N 3.28Å; A26-F28 VanDerWaalsContact C-N 3.35Å; A26-F28 PolarHBondContact O-N 3.02Å; A26-F29 PolarHBondContact O-N 3.01Å; A26-E30 WeakPolarHBondContact O-CB 3.43Å; A26-E30 PolarHBondContact O-N 3.4Å
27	V	98.1	Very high	98	Very high	94 Å²	94	85.8 Å²	85.8	57%	0.57	46%	0.461	S	S	*	.	H	α-helix	trans	-62.2	-42.8	179.7	174.2	0	0	0	0	111.5	M23 V24 R31	M23-V27 WeakPolarHBondContact O-CG2 3.47Å; M23-V27 PolarHBondContact O-N 3.43Å; V24-V27 PolarHBondContact O-N 3.3Å; V27-R31 PolarHBondContact O-N 3.28Å
28	F	98.3	Very high	98.1	Very high	134 Å²	134	87.9 Å²	87.9	59%	0.588	47%	0.47	S	S	*	.	H	α-helix	trans	-67.8	-41.7	176	-87.1	-87.5	0	0	0	111.9	V24 A26 M32	V24-F28 HydrophobicContact CG1-CD2 3.79Å; V24-F28 HydrophobicContact CG1-CE2 3.9Å; V24-F28 WeakPolarHBondContact O-CD2 3.41Å; V24-F28 PolarHBondContact O-N 2.85Å; V24-F28 VanDerWaalsContact O-N 3.12Å; A26-F28 VanDerWaalsContact C-N 3.35Å; A26-F28 PolarHBondContact O-N 3.02Å; F28-M32 HydrophobicContact CB-CE 4.37Å; F28-M32 WeakPolarHBondContact O-CE 3.42Å; F28-M32 WeakPolarHBondContact O-CG 3.13Å; F28-M32 PolarHBondContact O-N 3.48Å
29	F	98.1	Very high	98.1	Very high	124 Å²	124	86.3 Å²	86.3	54%	0.544	47%	0.474	S	S	.	.	H	α-helix	trans	-62.4	-48.4	179	-179.9	-93.9	0	0	0	111.4	G25 A26 R31 M32 F33	G25-F29 WeakPolarHBondContact O-CB 3.45Å; G25-F29 PolarHBondContact O-N 3.48Å; A26-F29 PolarHBondContact O-N 3.01Å; F29-R31 PolarHBondContact O-N 2.85Å; F29-M32 PolarHBondContact O-N 3.23Å; F29-F33 HydrophobicContact CD1-CB 4.24Å; F29-F33 HydrophobicContact CE1-CB 3.9Å; F29-F33 HydrophobicContact CE1-CD2 4.05Å; F29-F33 AromaticContact CE1-CG 3.91Å; F29-F33 HydrophobicContact CE1-CG 3.91Å; F29-F33 HydrophobicContact CE2-CB 4.5Å; F29-F33 HydrophobicContact CE2-CD2 4.1Å; F29-F33 HydrophobicContact CZ-CB 4.05Å; F29-F33 AromaticContact CZ-CD2 3.49Å; F29-F33 HydrophobicContact CZ-CD2 3.49Å; F29-F33 VanDerWaalsContact CZ-CD2 3.49Å; F29-F33 HydrophobicContact CZ-CE2 4.12Å; F29-F33 AromaticContact CZ-CG 3.85Å; F29-F33 HydrophobicContact CZ-CG 3.85Å; F29-F33 WeakPolarHBondContact O-CB 3.38Å; F29-F33 PolarHBondContact O-N 2.9Å
30	E	97.8	Very high	98.1	Very high	117 Å²	117	89.2 Å²	89.2	55%	0.547	48%	0.482	S	S	.	.	H	α-helix	trans	-50.1	-56.4	177	178.7	-178.4	-168.1	0	0	110.9	A26 M32 F33 D34	A26-E30 WeakPolarHBondContact O-CB 3.43Å; A26-E30 PolarHBondContact O-N 3.4Å; E30-M32 VanDerWaalsContact C-N 3.32Å; E30-M32 PolarHBondContact O-N 3.38Å; E30-F33 PolarHBondContact O-N 2.9Å; E30-D34 WeakPolarHBondContact O-CB 3.39Å; E30-D34 VanDerWaalsContact O-CG 3.32Å; E30-D34 PolarHBondContact O-N 3.25Å
31	R	98	Very high	98.1	Very high	164 Å²	164	90.5 Å²	90.5	62%	0.619	48%	0.481	S	S	*	.	H	α-helix	trans	-64.1	-35.1	-175.6	-172.6	57	174.1	154.7	3.3	113.7	V27 F29 Q35	V27-R31 PolarHBondContact O-N 3.28Å; F29-R31 PolarHBondContact O-N 2.85Å; R31-Q35 VanDerWaalsContact NE-NE2 3.13Å; R31-Q35 WeakPolarHBondContact O-CG 3.14Å; R31-Q35 PolarHBondContact O-N 3.19Å; R31-Q35 PolarHBondContact O-NE2 3.26Å
32	M	98.1	Very high	98.1	Very high	123 Å²	123	92.1 Å²	92.1	61%	0.606	49%	0.486	S	S	*	.	H	α-helix	trans	-76.7	-41.5	177.5	-72.2	-170.9	-65.9	0	0	111.7	F28 F29 E30 G36	F28-M32 HydrophobicContact CB-CE 4.37Å; F28-M32 WeakPolarHBondContact O-CE 3.42Å; F28-M32 WeakPolarHBondContact O-CG 3.13Å; F28-M32 PolarHBondContact O-N 3.48Å; F29-M32 PolarHBondContact O-N 3.23Å; E30-M32 VanDerWaalsContact C-N 3.32Å; E30-M32 PolarHBondContact O-N 3.38Å; M32-G36 PolarHBondContact O-N 2.78Å
33	F	97.9	Very high	98.1	Very high	129 Å²	129	94.9 Å²	94.9	57%	0.566	50%	0.497	S	S	*	.	H	α-helix	trans	-68.9	-42.6	-177.3	-168.5	-94.5	0	0	0	110.9	F29 E30 G36 G37	F29-F33 HydrophobicContact CD1-CB 4.24Å; F29-F33 HydrophobicContact CE1-CB 3.9Å; F29-F33 HydrophobicContact CE1-CD2 4.05Å; F29-F33 AromaticContact CE1-CG 3.91Å; F29-F33 HydrophobicContact CE1-CG 3.91Å; F29-F33 HydrophobicContact CE2-CB 4.5Å; F29-F33 HydrophobicContact CE2-CD2 4.1Å; F29-F33 HydrophobicContact CZ-CB 4.05Å; F29-F33 AromaticContact CZ-CD2 3.49Å; F29-F33 HydrophobicContact CZ-CD2 3.49Å; F29-F33 VanDerWaalsContact CZ-CD2 3.49Å; F29-F33 HydrophobicContact CZ-CE2 4.12Å; F29-F33 AromaticContact CZ-CG 3.85Å; F29-F33 HydrophobicContact CZ-CG 3.85Å; F29-F33 WeakPolarHBondContact O-CB 3.38Å; F29-F33 PolarHBondContact O-N 2.9Å; E30-F33 PolarHBondContact O-N 2.9Å; F33-G36 PolarHBondContact O-N 2.94Å; F33-G37 WeakPolarHBondContact O-CA 3.26Å; F33-G37 PolarHBondContact O-N 2.81Å
34	D	98.1	Very high	98.1	Very high	81 Å²	81	95.5 Å²	95.5	43%	0.433	50%	0.502	S	S	.	.	H	α-helix	trans	-62.1	-52.1	176.3	-71.6	-13.4	0	0	0	111.3	E30 G36 G37 D38	E30-D34 WeakPolarHBondContact O-CB 3.39Å; E30-D34 VanDerWaalsContact O-CG 3.32Å; E30-D34 PolarHBondContact O-N 3.25Å; D34-G36 VanDerWaalsContact C-N 3.34Å; D34-G36 PolarHBondContact O-N 3.39Å; D34-G37 PolarHBondContact O-N 3.3Å; D34-D38 WeakPolarHBondContact O-CB 3.34Å; D34-D38 PolarHBondContact O-N 3.46Å
35	Q	97.9	Very high	98.1	Very high	99 Å²	99	93.8 Å²	93.8	46%	0.463	49%	0.49	S	S	.	.	H	α-helix	trans	-62.9	-40.5	179.1	-76.1	178.6	75	0	0	112.6	R31 A39	R31-Q35 VanDerWaalsContact NE-NE2 3.13Å; R31-Q35 WeakPolarHBondContact O-CG 3.14Å; R31-Q35 PolarHBondContact O-N 3.19Å; R31-Q35 PolarHBondContact O-NE2 3.26Å; Q35-A39 VanDerWaalsContact O-CB 3.26Å; Q35-A39 WeakPolarHBondContact O-CB 3.31Å; Q35-A39 PolarHBondContact O-N 3.38Å
36	G	98.2	Very high	98	Very high	33 Å²	33	101.8 Å²	101.8	34%	0.34	51%	0.509	S	S	.	.	H	α-helix	trans	-66.6	-43.4	177.1	0	0	0	0	0	112.1	M32 F33 D34 A39 I40	M32-G36 PolarHBondContact O-N 2.78Å; F33-G36 PolarHBondContact O-N 2.94Å; D34-G36 VanDerWaalsContact C-N 3.34Å; D34-G36 PolarHBondContact O-N 3.39Å; G36-A39 PolarHBondContact O-N 2.93Å; G36-I40 VanDerWaalsContact O-CG1 3.29Å; G36-I40 WeakPolarHBondContact O-CG1 3.42Å; G36-I40 PolarHBondContact O-N 2.91Å
37	G	98.3	Very high	97.8	Very high	33 Å²	33	101.8 Å²	101.8	34%	0.34	51%	0.514	S	S	.	.	H	α-helix	trans	-62.6	-48	176.8	0	0	0	0	0	111.7	F33 D34 I40 F41	F33-G37 WeakPolarHBondContact O-CA 3.26Å; F33-G37 PolarHBondContact O-N 2.81Å; D34-G37 PolarHBondContact O-N 3.3Å; G37-I40 PolarHBondContact O-N 2.78Å; G37-F41 WeakPolarHBondContact O-CB 3.28Å; G37-F41 PolarHBondContact O-N 3.39Å
38	D	98.1	Very high	97.7	Very high	95 Å²	95	104.9 Å²	104.9	51%	0.508	52%	0.52	S	S	.	.	H	α-helix	trans	-56.4	-52.5	173.7	-80.2	-19.4	0	0	0	110.1	D34 I40 F41 E42	D34-D38 WeakPolarHBondContact O-CB 3.34Å; D34-D38 PolarHBondContact O-N 3.46Å; D38-I40 VanDerWaalsContact C-N 3.33Å; D38-I40 PolarHBondContact O-N 2.97Å; D38-F41 CarbonylContact O-C 3.3Å; D38-F41 WeakPolarHBondContact O-CA 3.49Å; D38-F41 WeakPolarHBondContact O-CB 3.25Å; D38-F41 PolarHBondContact O-N 3Å; D38-E42 WeakPolarHBondContact O-CG 3.45Å; D38-E42 PolarHBondContact O-N 3.46Å
39	A	97.9	Very high	97.7	Very high	55 Å²	55	100.2 Å²	100.2	46%	0.455	50%	0.501	S	S	.	.	H	α-helix	trans	-55.2	-45.8	-179.8	0	0	0	0	0	112.7	Q35 G36 E42 Q43	Q35-A39 VanDerWaalsContact O-CB 3.26Å; Q35-A39 WeakPolarHBondContact O-CB 3.31Å; Q35-A39 PolarHBondContact O-N 3.38Å; G36-A39 PolarHBondContact O-N 2.93Å; A39-E42 PolarHBondContact O-N 3.36Å; A39-Q43 VanDerWaalsContact O-CB 3.31Å; A39-Q43 WeakPolarHBondContact O-CB 3.29Å; A39-Q43 PolarHBondContact O-N 2.75Å
40	I	98.4	Very high	97.6	Very high	106 Å²	106	101 Å²	101	54%	0.544	50%	0.5	S	S	.	.	H	α-helix	trans	-61.6	-47.1	175.6	-68.7	166.7	0	0	0	110	G36 G37 D38 E42 Q43 L44	G36-I40 VanDerWaalsContact O-CG1 3.29Å; G36-I40 WeakPolarHBondContact O-CG1 3.42Å; G36-I40 PolarHBondContact O-N 2.91Å; G37-I40 PolarHBondContact O-N 2.78Å; D38-I40 VanDerWaalsContact C-N 3.33Å; D38-I40 PolarHBondContact O-N 2.97Å; I40-E42 PolarHBondContact O-N 3.49Å; I40-Q43 PolarHBondContact O-N 3.01Å; I40-L44 HydrophobicContact CG2-CD1 3.91Å; I40-L44 HydrophobicContact CG2-CG 4.45Å; I40-L44 VanDerWaalsContact O-CG 3.29Å; I40-L44 WeakPolarHBondContact O-CG 3.36Å; I40-L44 PolarHBondContact O-N 3.35Å
41	F	98.1	Very high	97.4	Very high	107 Å²	107	99.7 Å²	99.7	47%	0.469	49%	0.492	S	S	.	.	H	α-helix	trans	-62.5	-42.6	179.7	178.5	-97.9	0	0	0	112.5	G37 D38 L44 N45 L49	G37-F41 WeakPolarHBondContact O-CB 3.28Å; G37-F41 PolarHBondContact O-N 3.39Å; D38-F41 CarbonylContact O-C 3.3Å; D38-F41 WeakPolarHBondContact O-CA 3.49Å; D38-F41 WeakPolarHBondContact O-CB 3.25Å; D38-F41 PolarHBondContact O-N 3Å; F41-L44 PolarHBondContact O-N 3.47Å; F41-N45 WeakPolarHBondContact CE2-ND2 3.42Å; F41-N45 WeakPolarHBondContact O-CB 2.9Å; F41-N45 PolarHBondContact O-N 2.95Å; F41-N45 VanDerWaalsContact O-N 3.08Å; F41-N45 PolarHBondContact O-ND2 2.61Å; F41-L49 HydrophobicContact CD1-CD1 4.01Å; F41-L49 HydrophobicContact CE1-CD1 3.74Å; F41-L49 HydrophobicContact CE1-CD2 3.73Å; F41-L49 HydrophobicContact CE1-CG 4.41Å; F41-L49 HydrophobicContact CZ-CD2 4.11Å
42	E	97.8	Very high	97.3	Very high	69 Å²	69	94.1 Å²	94.1	32%	0.322	47%	0.474	S	S	.	.	H	α-helix	trans	-65	-42.3	177	-26.2	-157.2	147.1	0	0	111.1	D38 A39 I40 L44 N45 R46 L49 K51	D38-E42 WeakPolarHBondContact O-CG 3.45Å; D38-E42 PolarHBondContact O-N 3.46Å; A39-E42 PolarHBondContact O-N 3.36Å; I40-E42 PolarHBondContact O-N 3.49Å; E42-L44 VanDerWaalsContact C-N 3.34Å; E42-L44 PolarHBondContact O-N 3.46Å; E42-N45 CarbonylContact O-C 3.46Å; E42-N45 VanDerWaalsContact O-C 3.26Å; E42-N45 PolarHBondContact O-N 3.45Å; E42-R46 WeakPolarHBondContact O-CA 3.36Å; E42-R46 PolarHBondContact O-N 2.76Å; E42-L49 HydrophobicContact CB-CD1 4.33Å; E42-K51 VanDerWaalsContact OE1-CE 3.28Å; E42-K51 WeakPolarHBondContact OE1-CE 3.45Å; E42-K51 IonicContact OE1-NZ 2.75Å; E42-K51 PolarHBondContact OE1-NZ 2.91Å; E42-K51 VanDerWaalsContact OE2-CE 3.25Å; E42-K51 WeakPolarHBondContact OE2-CE 3.29Å; E42-K51 IonicContact OE2-NZ 2.61Å; E42-K51 PolarHBondContact OE2-NZ 2.95Å
43	Q	97.4	Very high	97.2	Very high	147 Å²	147	90.5 Å²	90.5	69%	0.687	46%	0.456	S	S	*	.	H	α-helix	trans	-62.2	-43.5	179.7	-176.3	174.3	-0.9	0	0	111.2	A39 I40 N45 R46	A39-Q43 VanDerWaalsContact O-CB 3.31Å; A39-Q43 WeakPolarHBondContact O-CB 3.29Å; A39-Q43 PolarHBondContact O-N 2.75Å; I40-Q43 PolarHBondContact O-N 3.01Å; Q43-N45 VanDerWaalsContact C-N 3.27Å; Q43-N45 PolarHBondContact O-N 3.3Å; Q43-R46 PolarHBondContact O-N 2.9Å
44	L	98.2	Very high	97	Very high	132 Å²	132	88 Å²	88	69%	0.691	45%	0.445	S	S	*	.	H	α-helix	trans	-67.6	-27.9	177.3	-68.9	174	0	0	0	112.8	I40 F41 E42	I40-L44 HydrophobicContact CG2-CD1 3.91Å; I40-L44 HydrophobicContact CG2-CG 4.45Å; I40-L44 VanDerWaalsContact O-CG 3.29Å; I40-L44 WeakPolarHBondContact O-CG 3.36Å; I40-L44 PolarHBondContact O-N 3.35Å; F41-L44 PolarHBondContact O-N 3.47Å; E42-L44 VanDerWaalsContact C-N 3.34Å; E42-L44 PolarHBondContact O-N 3.46Å
45	N	98.1	Very high	96.7	Very high	41 Å²	41	90.4 Å²	90.4	22%	0.219	45%	0.453	C	S	.	.	T	Hydrogen-bonded Turn	trans	-110.6	27.1	-179.1	-65	-77.7	0	0	0	113.1	F41 E42 Q43 G47 K48 L49 H52	F41-N45 WeakPolarHBondContact CE2-ND2 3.42Å; F41-N45 WeakPolarHBondContact O-CB 2.9Å; F41-N45 PolarHBondContact O-N 2.95Å; F41-N45 VanDerWaalsContact O-N 3.08Å; F41-N45 PolarHBondContact O-ND2 2.61Å; E42-N45 CarbonylContact O-C 3.46Å; E42-N45 VanDerWaalsContact O-C 3.26Å; E42-N45 PolarHBondContact O-N 3.45Å; Q43-N45 VanDerWaalsContact C-N 3.27Å; Q43-N45 PolarHBondContact O-N 3.3Å; N45-G47 PolarHBondContact O-N 2.99Å; N45-K48 PolarHBondContact O-N 3.42Å; N45-L49 HydrophobicContact CB-CD1 3.9Å; N45-L49 HydrophobicContact CB-CD2 3.94Å; N45-L49 HydrophobicContact CB-CG 3.71Å; N45-L49 PolarHBondContact O-N 3.32Å; N45-H52 PolarHBondContact O-CE1 3.15Å; N45-H52 PolarHBondContact O-ND1 3.15Å
46	R	96.4	Very high	96.4	Very high	205 Å²	205	91.2 Å²	91.2	77%	0.774	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55	131.6	179.9	-175.3	-179.9	-92.1	-150.2	-3.6	110.4	E42 Q43 K48	E42-R46 WeakPolarHBondContact O-CA 3.36Å; E42-R46 PolarHBondContact O-N 2.76Å; Q43-R46 PolarHBondContact O-N 2.9Å; R46-K48 PolarHBondContact O-N 3.49Å
47	G	94.9	Very high	96	Very high	49 Å²	49	96.4 Å²	96.4	51%	0.505	47%	0.468	S	S	.	.	T	Hydrogen-bonded Turn	trans	77.4	-8.1	-178.1	0	0	0	0	0	116	N45 H52	N45-G47 PolarHBondContact O-N 2.99Å; G47-H52 PolarHBondContact N-ND1 2.95Å
48	K	96.5	Very high	95.6	Very high	160 Å²	160	100 Å²	100	70%	0.696	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.3	-33.7	178.9	-58.8	179.9	-175.3	174.6	0	113.5	N45 R46	N45-K48 PolarHBondContact O-N 3.42Å; R46-K48 PolarHBondContact O-N 3.49Å
49	L	97.4	Very high	94.6	Very high	36 Å²	36	101.5 Å²	101.5	19%	0.188	49%	0.488	C	S	.	.	S	Bend	trans	-72.2	144.8	-177.8	-56.8	176	0	0	0	111.5	F41 E42 N45 K51 H52	F41-L49 HydrophobicContact CD1-CD1 4.01Å; F41-L49 HydrophobicContact CE1-CD1 3.74Å; F41-L49 HydrophobicContact CE1-CD2 3.73Å; F41-L49 HydrophobicContact CE1-CG 4.41Å; F41-L49 HydrophobicContact CZ-CD2 4.11Å; E42-L49 HydrophobicContact CB-CD1 4.33Å; N45-L49 HydrophobicContact CB-CD1 3.9Å; N45-L49 HydrophobicContact CB-CD2 3.94Å; N45-L49 HydrophobicContact CB-CG 3.71Å; N45-L49 PolarHBondContact O-N 3.32Å; L49-K51 VanDerWaalsContact C-N 3.26Å; L49-K51 HydrophobicContact CB-CG 3.96Å; L49-K51 HydrophobicContact CD1-CD 4.49Å; L49-K51 PolarHBondContact O-N 3.18Å; L49-H52 WeakPolarHBondContact O-CB 3.46Å; L49-H52 PolarHBondContact O-N 3.08Å
50	W	95.9	Very high	93.2	Very high	140 Å²	140	107.9 Å²	107.9	53%	0.53	51%	0.509	S	S	.	.	H	α-helix	trans	-50.4	-46.4	177.8	176.4	-116.6	0	0	0	112	H52 I53 K54 Y57	W50-H52 PolarHBondContact O-N 2.59Å; W50-I53 HydrophobicContact CE3-CD1 3.97Å; W50-I53 HydrophobicContact CE3-CG1 3.78Å; W50-I53 HydrophobicContact CZ3-CD1 4.28Å; W50-I53 HydrophobicContact CZ3-CG1 4.18Å; W50-I53 CarbonylContact O-C 3.57Å; W50-I53 WeakPolarHBondContact O-CG1 3.28Å; W50-I53 PolarHBondContact O-N 3.01Å; W50-K54 HydrophobicContact CD2-CB 4.23Å; W50-K54 HydrophobicContact CG-CB 4.5Å; W50-K54 HydrophobicContact CZ2-CB 4.14Å; W50-K54 HydrophobicContact CZ2-CG 3.89Å; W50-K54 VanDerWaalsContact O-CB 3.28Å; W50-K54 WeakPolarHBondContact O-CB 3.38Å; W50-K54 PolarHBondContact O-N 2.89Å; W50-Y57 AromaticContact CH2-CD2 3.49Å; W50-Y57 HydrophobicContact CH2-CD2 3.49Å; W50-Y57 VanDerWaalsContact CH2-CD2 3.49Å; W50-Y57 HydrophobicContact CH2-CE2 4.33Å; W50-Y57 AromaticContact CH2-CG 3.94Å; W50-Y57 HydrophobicContact CH2-CG 3.94Å; W50-Y57 AromaticContact CZ3-CD2 3.5Å; W50-Y57 HydrophobicContact CZ3-CD2 3.5Å; W50-Y57 VanDerWaalsContact CZ3-CD2 3.5Å; W50-Y57 AromaticContact CZ3-CE2 3.88Å; W50-Y57 HydrophobicContact CZ3-CE2 3.88Å; W50-Y57 HydrophobicContact CZ3-CG 4.29Å
51	K	94.6	Very high	91.7	Very high	89 Å²	89	112.1 Å²	112.1	39%	0.387	53%	0.526	S	S	.	.	H	α-helix	trans	-52.5	-26.6	176.9	68.4	-173.9	173.3	-151.8	0	114.8	E42 L49	E42-K51 VanDerWaalsContact OE1-CE 3.28Å; E42-K51 WeakPolarHBondContact OE1-CE 3.45Å; E42-K51 IonicContact OE1-NZ 2.75Å; E42-K51 PolarHBondContact OE1-NZ 2.91Å; E42-K51 VanDerWaalsContact OE2-CE 3.25Å; E42-K51 WeakPolarHBondContact OE2-CE 3.29Å; E42-K51 IonicContact OE2-NZ 2.61Å; E42-K51 PolarHBondContact OE2-NZ 2.95Å; L49-K51 VanDerWaalsContact C-N 3.26Å; L49-K51 HydrophobicContact CB-CG 3.96Å; L49-K51 HydrophobicContact CD1-CD 4.49Å; L49-K51 PolarHBondContact O-N 3.18Å
52	H	95.4	Very high	89.5	Confident	48 Å²	48	119.8 Å²	119.8	22%	0.222	56%	0.563	C	S	.	*	H	α-helix	trans	-81.7	-29.6	177.4	-56	142.2	0	0	0	112.7	N45 G47 L49 W50 H55	N45-H52 PolarHBondContact O-CE1 3.15Å; N45-H52 PolarHBondContact O-ND1 3.15Å; G47-H52 PolarHBondContact N-ND1 2.95Å; L49-H52 WeakPolarHBondContact O-CB 3.46Å; L49-H52 PolarHBondContact O-N 3.08Å; W50-H52 PolarHBondContact O-N 2.59Å; H52-H55 PolarHBondContact O-CE1 2.89Å; H52-H55 PolarHBondContact O-ND1 2.98Å
53	I	94.9	Very high	89	Confident	46 Å²	46	122.3 Å²	122.3	24%	0.236	58%	0.575	C	S	.	*	H	α-helix	trans	-108.6	-10.7	-174.5	66.3	174.1	0	0	0	113	W50 H55 Q56 Y57	W50-I53 HydrophobicContact CE3-CD1 3.97Å; W50-I53 HydrophobicContact CE3-CG1 3.78Å; W50-I53 HydrophobicContact CZ3-CD1 4.28Å; W50-I53 HydrophobicContact CZ3-CG1 4.18Å; W50-I53 CarbonylContact O-C 3.57Å; W50-I53 WeakPolarHBondContact O-CG1 3.28Å; W50-I53 PolarHBondContact O-N 3.01Å; I53-H55 PolarHBondContact O-N 2.9Å; I53-H55 VanDerWaalsContact O-N 3.15Å; I53-Q56 VanDerWaalsContact O-CB 3.24Å; I53-Q56 WeakPolarHBondContact O-CB 3.24Å; I53-Q56 WeakPolarHBondContact O-CG 3.49Å; I53-Q56 PolarHBondContact O-N 3.22Å; I53-Y57 HydrophobicContact CB-CE2 4.12Å; I53-Y57 HydrophobicContact CD1-CE2 4.1Å; I53-Y57 HydrophobicContact CG1-CE2 4.06Å; I53-Y57 WeakPolarHBondContact O-CD2 3.31Å; I53-Y57 VanDerWaalsContact O-CE2 3.31Å; I53-Y57 WeakPolarHBondContact O-CE2 2.86Å
54	K	94.2	Very high	88.6	Confident	76 Å²	76	121 Å²	121	33%	0.33	57%	0.569	S	S	.	*	G	3₁₀ helix	trans	-50.8	-41.1	-177.4	-177.5	175.2	-168.1	-96.7	0	112.4	W50 Q56 Y57 E58	W50-K54 HydrophobicContact CD2-CB 4.23Å; W50-K54 HydrophobicContact CG-CB 4.5Å; W50-K54 HydrophobicContact CZ2-CB 4.14Å; W50-K54 HydrophobicContact CZ2-CG 3.89Å; W50-K54 VanDerWaalsContact O-CB 3.28Å; W50-K54 WeakPolarHBondContact O-CB 3.38Å; W50-K54 PolarHBondContact O-N 2.89Å; K54-Q56 PolarHBondContact O-N 2.76Å; K54-Y57 PolarHBondContact O-N 3.06Å; K54-E58 VanDerWaalsContact CE-CD 3.43Å; K54-E58 WeakPolarHBondContact CE-OE1 3.34Å; K54-E58 WeakPolarHBondContact CE-OE2 3.21Å; K54-E58 VanDerWaalsContact CG-CD 3.45Å; K54-E58 HydrophobicContact CG-CG 3.88Å; K54-E58 WeakPolarHBondContact CG-OE2 3.39Å; K54-E58 IonicContact NZ-OE1 2.59Å; K54-E58 PolarHBondContact NZ-OE1 3.48Å; K54-E58 IonicContact NZ-OE2 3.46Å; K54-E58 PolarHBondContact NZ-OE2 3Å; K54-E58 PolarHBondContact O-N 3.32Å; K54-E58 VanDerWaalsContact O-N 3.15Å
55	H	91.3	Very high	88.1	Confident	133 Å²	133	120.4 Å²	120.4	62%	0.616	56%	0.563	S	S	*	*	G	3₁₀ helix	trans	-58.7	-15.4	177	71.3	-88.7	0	0	0	114.8	H52 I53 Y57	H52-H55 PolarHBondContact O-CE1 2.89Å; H52-H55 PolarHBondContact O-ND1 2.98Å; I53-H55 PolarHBondContact O-N 2.9Å; I53-H55 VanDerWaalsContact O-N 3.15Å; H55-Y57 VanDerWaalsContact C-N 3.34Å
56	Q	91.3	Very high	87.5	Confident	115 Å²	115	125.1 Å²	125.1	54%	0.537	58%	0.583	S	S	.	*	G	3₁₀ helix	trans	-82.7	-14.6	176.5	-57.7	177	-11.2	0	0	112.7	I53 K54	I53-Q56 VanDerWaalsContact O-CB 3.24Å; I53-Q56 WeakPolarHBondContact O-CB 3.24Å; I53-Q56 WeakPolarHBondContact O-CG 3.49Å; I53-Q56 PolarHBondContact O-N 3.22Å; K54-Q56 PolarHBondContact O-N 2.76Å
57	Y	91	Very high	86.9	Confident	143 Å²	143	120.1 Å²	120.1	56%	0.561	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-125.6	-13	-169.6	-51.1	-74.8	0	0	0	113.2	W50 I53 K54 H55	W50-Y57 AromaticContact CH2-CD2 3.49Å; W50-Y57 HydrophobicContact CH2-CD2 3.49Å; W50-Y57 VanDerWaalsContact CH2-CD2 3.49Å; W50-Y57 HydrophobicContact CH2-CE2 4.33Å; W50-Y57 AromaticContact CH2-CG 3.94Å; W50-Y57 HydrophobicContact CH2-CG 3.94Å; W50-Y57 AromaticContact CZ3-CD2 3.5Å; W50-Y57 HydrophobicContact CZ3-CD2 3.5Å; W50-Y57 VanDerWaalsContact CZ3-CD2 3.5Å; W50-Y57 AromaticContact CZ3-CE2 3.88Å; W50-Y57 HydrophobicContact CZ3-CE2 3.88Å; W50-Y57 HydrophobicContact CZ3-CG 4.29Å; I53-Y57 HydrophobicContact CB-CE2 4.12Å; I53-Y57 HydrophobicContact CD1-CE2 4.1Å; I53-Y57 HydrophobicContact CG1-CE2 4.06Å; I53-Y57 WeakPolarHBondContact O-CD2 3.31Å; I53-Y57 VanDerWaalsContact O-CE2 3.31Å; I53-Y57 WeakPolarHBondContact O-CE2 2.86Å; K54-Y57 PolarHBondContact O-N 3.06Å; H55-Y57 VanDerWaalsContact C-N 3.34Å
58	E	90.2	Very high	86.4	Confident	108 Å²	108	124.8 Å²	124.8	51%	0.505	58%	0.575	S	S	.	*			trans	-85.4	126	172.6	-63.9	-167.4	142.1	0	0	109.2	K54	K54-E58 VanDerWaalsContact CE-CD 3.43Å; K54-E58 WeakPolarHBondContact CE-OE1 3.34Å; K54-E58 WeakPolarHBondContact CE-OE2 3.21Å; K54-E58 VanDerWaalsContact CG-CD 3.45Å; K54-E58 HydrophobicContact CG-CG 3.88Å; K54-E58 WeakPolarHBondContact CG-OE2 3.39Å; K54-E58 IonicContact NZ-OE1 2.59Å; K54-E58 PolarHBondContact NZ-OE1 3.48Å; K54-E58 IonicContact NZ-OE2 3.46Å; K54-E58 PolarHBondContact NZ-OE2 3Å; K54-E58 PolarHBondContact O-N 3.32Å; K54-E58 VanDerWaalsContact O-N 3.15Å
59	T	76.7	Confident	85.7	Confident	127 Å²	127	122.3 Å²	122.3	78%	0.779	57%	0.567	S	S	*	*			trans	-81.7	137.5	168.5	-45	0	0	0	0	106.6	E61	T59-E61 PolarHBondContact O-N 3.32Å
60	E	68.4	Low	84.8	Confident	189 Å²	189	128.9 Å²	128.9	88%	0.883	60%	0.596	S	S	*	*			trans	-59.2	107.9	172.5	-68.3	-170	164.9	0	0	107.9	E62	E60-E62 PolarHBondContact O-N 3.29Å
61	E	65.9	Low	83.8	Confident	195 Å²	195	128 Å²	128	91%	0.911	60%	0.601	S	S	*	*			trans	-73.2	113.8	164	-71.4	-174.4	163.5	0	0	106.2	T59	T59-E61 PolarHBondContact O-N 3.32Å
62	E	51.9	Low	82.9	Confident	267 Å²	267	131.5 Å²	131.5	100%	1.248	62%	0.621	S	S	*	*			trans	-56.6	0	169.4	-76.6	-174	150.7	0	0	112.3	E60	E60-E62 PolarHBondContact O-N 3.29Å

Retrieved 62 of 62 residues in 155.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).