A0A060VX04_ONCMY Loading...

Small integral membrane protein 13

AlphaFold DB , UniProt , Accession A0A060VX04, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110488088, Length 88 aa.

						>A0A060VX04_ONCMY|A0A060VX04|LOC110488088
MWQSVGLTVLVIVATLVCALLFMVFGWYVVWQLFLSKFKFLREMLGDTGSPQTETQPSESKSKHTSPPTQRQRLKTARQRVVPPENTT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.6	Low	88	Confident	205 Å²	205	116.1 Å²	116.1	100%	1.01	62%	0.622	S	S	*	*				0	-57.8	0	-58.4	-176.4	90.5	0	0	112.1	Q3 S4 V5	M1-Q3 VanDerWaalsContact C-N 3.33Å; M1-Q3 PolarHBondContact O-N 3.13Å; M1-S4 WeakPolarHBondContact O-CB 3.25Å; M1-S4 PolarHBondContact O-N 3.38Å; M1-S4 VanDerWaalsContact O-N 3.1Å; M1-V5 PolarHBondContact O-N 3.3Å
2	W	79.6	Confident	88.6	Confident	231 Å²	231	114.8 Å²	114.8	88%	0.875	61%	0.613	S	S	*	*	H	α-helix	trans	-54.3	-40.5	-176.8	-137.5	66.1	0	0	0	114.9	S4 V5 G6	W2-S4 PolarHBondContact O-N 3.18Å; W2-V5 PolarHBondContact O-N 3.43Å; W2-G6 PolarHBondContact O-N 3.03Å
3	Q	81.5	Confident	89.3	Confident	150 Å²	150	112.2 Å²	112.2	70%	0.701	60%	0.603	S	S	*	*	H	α-helix	trans	-57	-44	175.9	-68.2	-66.5	-23.6	0	0	113.2	M1 V5 G6 L7	M1-Q3 VanDerWaalsContact C-N 3.33Å; M1-Q3 PolarHBondContact O-N 3.13Å; Q3-V5 VanDerWaalsContact C-N 3.35Å; Q3-V5 PolarHBondContact O-N 3.39Å; Q3-G6 PolarHBondContact O-N 3.17Å; Q3-L7 WeakPolarHBondContact O-CG 3.23Å; Q3-L7 PolarHBondContact O-N 2.63Å
4	S	86.8	Confident	89.8	Confident	75 Å²	75	107.8 Å²	107.8	52%	0.524	59%	0.59	S	S	.	*	H	α-helix	trans	-65	-39.4	178.6	-44.9	0	0	0	0	111.6	M1 W2 T8	M1-S4 WeakPolarHBondContact O-CB 3.25Å; M1-S4 PolarHBondContact O-N 3.38Å; M1-S4 VanDerWaalsContact O-N 3.1Å; W2-S4 PolarHBondContact O-N 3.18Å; S4-T8 PolarHBondContact O-N 2.77Å; S4-T8 PolarHBondContact O-OG1 3.3Å; S4-T8 VanDerWaalsContact O-OG1 3.07Å
5	V	92.3	Very high	90.3	Very high	90 Å²	90	106.5 Å²	106.5	55%	0.545	59%	0.587	S	S	.	*	H	α-helix	trans	-64.8	-45.3	175.8	-179.9	0	0	0	0	110.5	M1 W2 Q3 L7 T8 V9	M1-V5 PolarHBondContact O-N 3.3Å; W2-V5 PolarHBondContact O-N 3.43Å; Q3-V5 VanDerWaalsContact C-N 3.35Å; Q3-V5 PolarHBondContact O-N 3.39Å; V5-L7 PolarHBondContact O-N 3.12Å; V5-T8 PolarHBondContact O-N 3.08Å; V5-V9 HydrophobicContact CG1-CG2 4.33Å; V5-V9 WeakPolarHBondContact O-CB 3.43Å; V5-V9 VanDerWaalsContact O-CG2 3.31Å; V5-V9 WeakPolarHBondContact O-CG2 3.44Å; V5-V9 PolarHBondContact O-N 3.49Å
6	G	90.8	Very high	90.7	Very high	43 Å²	43	106.6 Å²	106.6	44%	0.443	59%	0.586	S	S	.	*	H	α-helix	trans	-59.1	-45.5	176.7	0	0	0	0	0	112.9	W2 Q3 V9 L10	W2-G6 PolarHBondContact O-N 3.03Å; Q3-G6 PolarHBondContact O-N 3.17Å; G6-V9 PolarHBondContact O-N 2.75Å; G6-L10 WeakPolarHBondContact O-CB 3.43Å; G6-L10 PolarHBondContact O-N 3.46Å
7	L	93.3	Very high	91	Very high	111 Å²	111	104.8 Å²	104.8	58%	0.581	58%	0.578	S	S	*	*	H	α-helix	trans	-62.6	-46.6	176	-73.9	168.7	0	0	0	112.3	Q3 V5 V9 L10 V11	Q3-L7 WeakPolarHBondContact O-CG 3.23Å; Q3-L7 PolarHBondContact O-N 2.63Å; V5-L7 PolarHBondContact O-N 3.12Å; L7-V9 PolarHBondContact O-N 2.61Å; L7-L10 PolarHBondContact O-N 3.05Å; L7-V11 WeakPolarHBondContact O-CG2 3.2Å; L7-V11 PolarHBondContact O-N 3.45Å
8	T	93.4	Very high	91.3	Very high	83 Å²	83	103.2 Å²	103.2	51%	0.509	58%	0.575	S	S	.	*	H	α-helix	trans	-63	-42.4	178	-60.7	0	0	0	0	111.8	S4 V5 V11 I12	S4-T8 PolarHBondContact O-N 2.77Å; S4-T8 PolarHBondContact O-OG1 3.3Å; S4-T8 VanDerWaalsContact O-OG1 3.07Å; V5-T8 PolarHBondContact O-N 3.08Å; T8-V11 PolarHBondContact O-N 3.49Å; T8-I12 HydrophobicContact CG2-CD1 3.87Å; T8-I12 VanDerWaalsContact O-CG1 3.26Å; T8-I12 WeakPolarHBondContact O-CG1 2.93Å; T8-I12 PolarHBondContact O-N 2.89Å
9	V	95.4	Very high	91.5	Very high	78 Å²	78	100.6 Å²	100.6	47%	0.473	57%	0.568	S	S	.	*	H	α-helix	trans	-63.9	-42.6	175.5	171.1	0	0	0	0	111	V5 G6 L7 V11 I12 V13	V5-V9 HydrophobicContact CG1-CG2 4.33Å; V5-V9 WeakPolarHBondContact O-CB 3.43Å; V5-V9 VanDerWaalsContact O-CG2 3.31Å; V5-V9 WeakPolarHBondContact O-CG2 3.44Å; V5-V9 PolarHBondContact O-N 3.49Å; G6-V9 PolarHBondContact O-N 2.75Å; L7-V9 PolarHBondContact O-N 2.61Å; V9-V11 VanDerWaalsContact C-N 3.35Å; V9-V11 PolarHBondContact O-N 2.9Å; V9-I12 PolarHBondContact O-N 2.59Å; V9-V13 HydrophobicContact CG1-CG2 4.3Å; V9-V13 WeakPolarHBondContact O-CB 3.26Å; V9-V13 VanDerWaalsContact O-CG2 3.31Å; V9-V13 WeakPolarHBondContact O-CG2 3.43Å; V9-V13 PolarHBondContact O-N 2.82Å
10	L	95.6	Very high	91.8	Very high	122 Å²	122	100.6 Å²	100.6	64%	0.639	57%	0.566	S	S	*	*	H	α-helix	trans	-60.6	-43.9	176.7	-166.2	84.9	0	0	0	111.5	G6 L7 V13 A14	G6-L10 WeakPolarHBondContact O-CB 3.43Å; G6-L10 PolarHBondContact O-N 3.46Å; L7-L10 PolarHBondContact O-N 3.05Å; L10-V13 PolarHBondContact O-N 2.72Å; L10-A14 VanDerWaalsContact O-CB 3.27Å; L10-A14 WeakPolarHBondContact O-CB 3.44Å; L10-A14 PolarHBondContact O-N 2.79Å
11	V	95.6	Very high	92	Very high	89 Å²	89	101 Å²	101	54%	0.539	57%	0.566	S	S	.	*	H	α-helix	trans	-62.9	-47.3	175.8	170.6	0	0	0	0	110.8	L7 T8 V9 V13 A14 T15	L7-V11 WeakPolarHBondContact O-CG2 3.2Å; L7-V11 PolarHBondContact O-N 3.45Å; T8-V11 PolarHBondContact O-N 3.49Å; V9-V11 VanDerWaalsContact C-N 3.35Å; V9-V11 PolarHBondContact O-N 2.9Å; V11-V13 VanDerWaalsContact C-N 3.35Å; V11-V13 PolarHBondContact O-N 2.7Å; V11-A14 PolarHBondContact O-N 3.48Å; V11-T15 WeakPolarHBondContact O-CB 3.31Å; V11-T15 PolarHBondContact O-N 2.8Å; V11-T15 PolarHBondContact O-OG1 3.39Å; V11-T15 VanDerWaalsContact O-OG1 3.06Å
12	I	95.9	Very high	93.4	Very high	101 Å²	101	99.3 Å²	99.3	52%	0.518	55%	0.553	S	S	.	*	H	α-helix	trans	-58.1	-47.7	177.1	-69.7	164.4	0	0	0	110.6	T8 V9 T15 L16	T8-I12 HydrophobicContact CG2-CD1 3.87Å; T8-I12 VanDerWaalsContact O-CG1 3.26Å; T8-I12 WeakPolarHBondContact O-CG1 2.93Å; T8-I12 PolarHBondContact O-N 2.89Å; V9-I12 PolarHBondContact O-N 2.59Å; I12-T15 PolarHBondContact O-N 2.72Å; I12-L16 VanDerWaalsContact O-CB 3.27Å; I12-L16 WeakPolarHBondContact O-CB 3.5Å; I12-L16 PolarHBondContact O-N 2.8Å
13	V	97.5	Very high	94.2	Very high	80 Å²	80	95.1 Å²	95.1	49%	0.485	55%	0.545	S	S	.	.	H	α-helix	trans	-62.9	-44.1	178.3	171.2	0	0	0	0	111.2	V9 L10 V11 L16 V17	V9-V13 HydrophobicContact CG1-CG2 4.3Å; V9-V13 WeakPolarHBondContact O-CB 3.26Å; V9-V13 VanDerWaalsContact O-CG2 3.31Å; V9-V13 WeakPolarHBondContact O-CG2 3.43Å; V9-V13 PolarHBondContact O-N 2.82Å; L10-V13 PolarHBondContact O-N 2.72Å; V11-V13 VanDerWaalsContact C-N 3.35Å; V11-V13 PolarHBondContact O-N 2.7Å; V13-L16 PolarHBondContact O-N 2.81Å; V13-V17 HydrophobicContact CG1-CG2 4.41Å; V13-V17 WeakPolarHBondContact O-CB 3.39Å; V13-V17 WeakPolarHBondContact O-CG2 3.45Å; V13-V17 PolarHBondContact O-N 2.75Å
14	A	96.6	Very high	94.7	Very high	51 Å²	51	91 Å²	91	42%	0.421	53%	0.531	S	S	.	.	H	α-helix	trans	-63	-45.1	177.4	0	0	0	0	0	111.8	L10 V11 L16 V17 C18	L10-A14 VanDerWaalsContact O-CB 3.27Å; L10-A14 WeakPolarHBondContact O-CB 3.44Å; L10-A14 PolarHBondContact O-N 2.79Å; V11-A14 PolarHBondContact O-N 3.48Å; A14-L16 VanDerWaalsContact C-N 3.34Å; A14-L16 PolarHBondContact O-N 2.74Å; A14-V17 PolarHBondContact O-N 3.31Å; A14-C18 WeakPolarHBondContact O-CB 3.39Å; A14-C18 PolarHBondContact O-N 2.85Å; A14-C18 PolarHBondContact O-SG 3.48Å
15	T	96.3	Very high	95	Very high	88 Å²	88	94.6 Å²	94.6	54%	0.54	54%	0.537	S	S	.	.	H	α-helix	trans	-62.5	-40.7	174.3	-59.9	0	0	0	0	111.5	V11 I12 C18 A19	V11-T15 WeakPolarHBondContact O-CB 3.31Å; V11-T15 PolarHBondContact O-N 2.8Å; V11-T15 PolarHBondContact O-OG1 3.39Å; V11-T15 VanDerWaalsContact O-OG1 3.06Å; I12-T15 PolarHBondContact O-N 2.72Å; T15-C18 PolarHBondContact O-N 2.9Å; T15-A19 VanDerWaalsContact O-CB 3.29Å; T15-A19 WeakPolarHBondContact O-CB 3.28Å; T15-A19 PolarHBondContact O-N 2.79Å
16	L	97	Very high	94.8	Very high	109 Å²	109	92.2 Å²	92.2	57%	0.571	53%	0.53	S	S	*	.	H	α-helix	trans	-64.5	-45.8	177.8	-155.5	76.7	0	0	0	111.1	I12 V13 A14 A19 L20	I12-L16 VanDerWaalsContact O-CB 3.27Å; I12-L16 WeakPolarHBondContact O-CB 3.5Å; I12-L16 PolarHBondContact O-N 2.8Å; V13-L16 PolarHBondContact O-N 2.81Å; A14-L16 VanDerWaalsContact C-N 3.34Å; A14-L16 PolarHBondContact O-N 2.74Å; L16-A19 PolarHBondContact O-N 3.32Å; L16-L20 HydrophobicContact CG-CD1 4.13Å; L16-L20 WeakPolarHBondContact O-CB 3.46Å; L16-L20 WeakPolarHBondContact O-CD1 3.2Å; L16-L20 PolarHBondContact O-N 2.77Å
17	V	96.5	Very high	94.8	Very high	75 Å²	75	97.9 Å²	97.9	46%	0.455	54%	0.539	S	S	.	.	H	α-helix	trans	-62.5	-44.5	174.9	171	0	0	0	0	111	V13 A14 A19 L20 L21	V13-V17 HydrophobicContact CG1-CG2 4.41Å; V13-V17 WeakPolarHBondContact O-CB 3.39Å; V13-V17 WeakPolarHBondContact O-CG2 3.45Å; V13-V17 PolarHBondContact O-N 2.75Å; A14-V17 PolarHBondContact O-N 3.31Å; V17-A19 VanDerWaalsContact C-N 3.33Å; V17-A19 PolarHBondContact O-N 2.98Å; V17-L20 PolarHBondContact O-N 3.44Å; V17-L21 HydrophobicContact CG1-CD1 3.97Å; V17-L21 HydrophobicContact CG1-CG 4.34Å; V17-L21 WeakPolarHBondContact O-CB 3.05Å; V17-L21 VanDerWaalsContact O-CG 3.28Å; V17-L21 WeakPolarHBondContact O-CG 3.17Å; V17-L21 PolarHBondContact O-N 3.48Å
18	C	96.1	Very high	94.7	Very high	76 Å²	76	99.3 Å²	99.3	51%	0.514	54%	0.537	S	S	.	.	H	α-helix	trans	-60.9	-40.8	174.6	-75.3	0	0	0	0	112.3	A14 T15 L21 F22	A14-C18 WeakPolarHBondContact O-CB 3.39Å; A14-C18 PolarHBondContact O-N 2.85Å; A14-C18 PolarHBondContact O-SG 3.48Å; T15-C18 PolarHBondContact O-N 2.9Å; C18-L21 PolarHBondContact O-N 3.37Å; C18-F22 WeakPolarHBondContact O-CB 3.32Å; C18-F22 PolarHBondContact O-N 2.71Å
19	A	95.7	Very high	94.5	Very high	54 Å²	54	98.3 Å²	98.3	45%	0.446	53%	0.531	S	S	.	.	H	α-helix	trans	-68.6	-41.3	176.8	0	0	0	0	0	112.2	T15 L16 V17 F22 M23	T15-A19 VanDerWaalsContact O-CB 3.29Å; T15-A19 WeakPolarHBondContact O-CB 3.28Å; T15-A19 PolarHBondContact O-N 2.79Å; L16-A19 PolarHBondContact O-N 3.32Å; V17-A19 VanDerWaalsContact C-N 3.33Å; V17-A19 PolarHBondContact O-N 2.98Å; A19-F22 PolarHBondContact O-N 2.75Å; A19-M23 VanDerWaalsContact O-CB 3.25Å; A19-M23 WeakPolarHBondContact O-CB 3.25Å; A19-M23 PolarHBondContact O-N 3.39Å
20	L	96.4	Very high	94.1	Very high	100 Å²	100	98.8 Å²	98.8	52%	0.524	53%	0.534	S	S	.	.	H	α-helix	trans	-60.5	-46.9	171.4	-97.1	126.8	0	0	0	110.9	L16 V17 F22 M23 V24	L16-L20 HydrophobicContact CG-CD1 4.13Å; L16-L20 WeakPolarHBondContact O-CB 3.46Å; L16-L20 WeakPolarHBondContact O-CD1 3.2Å; L16-L20 PolarHBondContact O-N 2.77Å; V17-L20 PolarHBondContact O-N 3.44Å; L20-F22 PolarHBondContact O-N 2.71Å; L20-M23 PolarHBondContact O-N 2.78Å; L20-V24 WeakPolarHBondContact O-CB 3.23Å; L20-V24 WeakPolarHBondContact O-CG2 3.01Å; L20-V24 PolarHBondContact O-N 3.36Å
21	L	95.3	Very high	93.5	Very high	110 Å²	110	100 Å²	100	58%	0.576	53%	0.53	S	S	*	.	H	α-helix	trans	-61.3	-42.9	175.7	-73.3	173.2	0	0	0	111.3	V17 C18 F25	V17-L21 HydrophobicContact CG1-CD1 3.97Å; V17-L21 HydrophobicContact CG1-CG 4.34Å; V17-L21 WeakPolarHBondContact O-CB 3.05Å; V17-L21 VanDerWaalsContact O-CG 3.28Å; V17-L21 WeakPolarHBondContact O-CG 3.17Å; V17-L21 PolarHBondContact O-N 3.48Å; C18-L21 PolarHBondContact O-N 3.37Å; L21-F25 WeakPolarHBondContact O-CB 3.39Å; L21-F25 PolarHBondContact O-N 2.81Å
22	F	94.8	Very high	92.9	Very high	169 Å²	169	100.9 Å²	100.9	74%	0.741	53%	0.528	S	S	*	.	H	α-helix	trans	-66.9	-41.5	176.2	-110.6	-86.7	0	0	0	113	C18 A19 L20 F25 G26	C18-F22 WeakPolarHBondContact O-CB 3.32Å; C18-F22 PolarHBondContact O-N 2.71Å; A19-F22 PolarHBondContact O-N 2.75Å; L20-F22 PolarHBondContact O-N 2.71Å; F22-F25 PolarHBondContact O-N 3.35Å; F22-G26 PolarHBondContact O-N 2.88Å
23	M	95.1	Very high	92.2	Very high	143 Å²	143	100.7 Å²	100.7	70%	0.704	53%	0.527	S	S	*	.	H	α-helix	trans	-64.2	-47.7	177.1	-176.4	-172	179.9	0	0	110.4	A19 L20 W27	A19-M23 VanDerWaalsContact O-CB 3.25Å; A19-M23 WeakPolarHBondContact O-CB 3.25Å; A19-M23 PolarHBondContact O-N 3.39Å; L20-M23 PolarHBondContact O-N 2.78Å; M23-W27 WeakPolarHBondContact O-CB 3.43Å; M23-W27 PolarHBondContact O-N 2.82Å
24	V	91.9	Very high	91	Very high	65 Å²	65	103.2 Å²	103.2	39%	0.394	53%	0.532	S	S	.	.	H	α-helix	trans	-61.1	-47.9	174.1	168.6	0	0	0	0	109.9	L20 W27 Y28	L20-V24 WeakPolarHBondContact O-CB 3.23Å; L20-V24 WeakPolarHBondContact O-CG2 3.01Å; L20-V24 PolarHBondContact O-N 3.36Å; V24-W27 PolarHBondContact O-N 3.41Å; V24-Y28 HydrophobicContact CG1-CD2 3.58Å; V24-Y28 HydrophobicContact CG1-CE2 3.65Å; V24-Y28 HydrophobicContact CG1-CG 4.37Å; V24-Y28 WeakPolarHBondContact O-CA 3.12Å; V24-Y28 WeakPolarHBondContact O-CB 3.14Å; V24-Y28 WeakPolarHBondContact O-CD2 3.19Å; V24-Y28 PolarHBondContact O-N 3.41Å
25	F	92.9	Very high	89.8	Confident	149 Å²	149	105.2 Å²	105.2	65%	0.654	54%	0.535	S	S	*	.	H	α-helix	trans	-66.3	-42.7	-178	-156.9	-91.6	0	0	0	111.9	L21 F22 Y28 V29	L21-F25 WeakPolarHBondContact O-CB 3.39Å; L21-F25 PolarHBondContact O-N 2.81Å; F22-F25 PolarHBondContact O-N 3.35Å; F25-Y28 PolarHBondContact O-N 3.44Å; F25-V29 HydrophobicContact CD1-CG2 3.8Å; F25-V29 HydrophobicContact CE1-CG2 3.74Å; F25-V29 VanDerWaalsContact O-CB 3.26Å; F25-V29 WeakPolarHBondContact O-CB 3.15Å; F25-V29 WeakPolarHBondContact O-CG2 3.43Å; F25-V29 PolarHBondContact O-N 2.81Å
26	G	89.7	Confident	88.4	Confident	40 Å²	40	104 Å²	104	41%	0.412	53%	0.531	S	S	.	.	H	α-helix	trans	-62.3	-45.9	173.5	0	0	0	0	0	112.3	F22 V29 V30	F22-G26 PolarHBondContact O-N 2.88Å; G26-V29 PolarHBondContact O-N 3.35Å; G26-V30 WeakPolarHBondContact O-CG2 3.39Å; G26-V30 PolarHBondContact O-N 2.82Å
27	W	90.3	Very high	86.9	Confident	163 Å²	163	105.2 Å²	105.2	62%	0.617	53%	0.531	S	S	*	.	H	α-helix	trans	-62.1	-46.3	175	-176.4	-94.4	0	0	0	112.1	M23 V24 V30 W31	M23-W27 WeakPolarHBondContact O-CB 3.43Å; M23-W27 PolarHBondContact O-N 2.82Å; V24-W27 PolarHBondContact O-N 3.41Å; W27-V30 PolarHBondContact O-N 3.44Å; W27-W31 HydrophobicContact CZ2-CE3 4.36Å; W27-W31 HydrophobicContact CZ2-CZ3 4.45Å; W27-W31 AromaticContact NE1-CE3 3.88Å; W27-W31 WeakPolarHBondContact O-CB 3.5Å; W27-W31 PolarHBondContact O-N 3.27Å
28	Y	90.6	Very high	85.2	Confident	141 Å²	141	107.3 Å²	107.3	55%	0.553	53%	0.534	S	S	*	.	H	α-helix	trans	-68.6	-31.9	178.3	-89.1	-114.3	0	0	0	112.1	V24 F25 Q32	V24-Y28 HydrophobicContact CG1-CD2 3.58Å; V24-Y28 HydrophobicContact CG1-CE2 3.65Å; V24-Y28 HydrophobicContact CG1-CG 4.37Å; V24-Y28 WeakPolarHBondContact O-CA 3.12Å; V24-Y28 WeakPolarHBondContact O-CB 3.14Å; V24-Y28 WeakPolarHBondContact O-CD2 3.19Å; V24-Y28 PolarHBondContact O-N 3.41Å; F25-Y28 PolarHBondContact O-N 3.44Å; Y28-Q32 WeakPolarHBondContact O-CA 3.19Å; Y28-Q32 WeakPolarHBondContact O-CB 3.17Å; Y28-Q32 WeakPolarHBondContact O-CG 3.22Å; Y28-Q32 PolarHBondContact O-N 3.4Å
29	V	88.4	Confident	83.8	Confident	62 Å²	62	109.4 Å²	109.4	38%	0.376	54%	0.535	S	S	.	.	H	α-helix	trans	-70.2	-41.5	172.9	165.3	0	0	0	0	110.4	F25 G26 Q32 L33	F25-V29 HydrophobicContact CD1-CG2 3.8Å; F25-V29 HydrophobicContact CE1-CG2 3.74Å; F25-V29 VanDerWaalsContact O-CB 3.26Å; F25-V29 WeakPolarHBondContact O-CB 3.15Å; F25-V29 WeakPolarHBondContact O-CG2 3.43Å; F25-V29 PolarHBondContact O-N 2.81Å; G26-V29 PolarHBondContact O-N 3.35Å; V29-Q32 PolarHBondContact O-N 2.86Å; V29-L33 HydrophobicContact CG1-CD1 3.8Å; V29-L33 HydrophobicContact CG1-CG 4.36Å; V29-L33 WeakPolarHBondContact O-CB 3.13Å; V29-L33 WeakPolarHBondContact O-CG 3.06Å; V29-L33 PolarHBondContact O-N 3.34Å
30	V	87.1	Confident	82.1	Confident	87 Å²	87	113 Å²	113	53%	0.527	54%	0.541	S	S	.	.	H	α-helix	trans	-62.9	-46.3	171.9	171.3	0	0	0	0	110.7	G26 W27 L33 F34	G26-V30 WeakPolarHBondContact O-CG2 3.39Å; G26-V30 PolarHBondContact O-N 2.82Å; W27-V30 PolarHBondContact O-N 3.44Å; V30-L33 PolarHBondContact O-N 2.8Å; V30-F34 WeakPolarHBondContact O-CB 3.2Å; V30-F34 PolarHBondContact O-N 3.3Å
31	W	84.4	Confident	80.7	Confident	149 Å²	149	113 Å²	113	56%	0.564	54%	0.541	S	S	*	.	H	α-helix	trans	-63.5	-39.7	177.9	-171	-87.1	0	0	0	112.4	W27 F34 L35	W27-W31 HydrophobicContact CZ2-CE3 4.36Å; W27-W31 HydrophobicContact CZ2-CZ3 4.45Å; W27-W31 AromaticContact NE1-CE3 3.88Å; W27-W31 WeakPolarHBondContact O-CB 3.5Å; W27-W31 PolarHBondContact O-N 3.27Å; W31-F34 PolarHBondContact O-N 2.83Å; W31-L35 VanDerWaalsContact NE1-CD1 3.29Å; W31-L35 WeakPolarHBondContact O-CB 3.2Å; W31-L35 PolarHBondContact O-N 2.84Å
32	Q	81.5	Confident	79.4	Confident	106 Å²	106	117.3 Å²	117.3	50%	0.495	55%	0.549	S	S	.	.	H	α-helix	trans	-74.4	-35.9	175.3	-80.8	-76.1	26.3	0	0	112.3	Y28 V29 F34 S36	Y28-Q32 WeakPolarHBondContact O-CA 3.19Å; Y28-Q32 WeakPolarHBondContact O-CB 3.17Å; Y28-Q32 WeakPolarHBondContact O-CG 3.22Å; Y28-Q32 PolarHBondContact O-N 3.4Å; V29-Q32 PolarHBondContact O-N 2.86Å; Q32-F34 VanDerWaalsContact C-N 3.31Å; Q32-S36 WeakPolarHBondContact O-CA 3.43Å; Q32-S36 WeakPolarHBondContact O-CB 3.13Å; Q32-S36 PolarHBondContact O-N 3.26Å; Q32-S36 PolarHBondContact O-OG 2.85Å
33	L	81.1	Confident	78	Confident	97 Å²	97	113.6 Å²	113.6	51%	0.508	53%	0.534	S	S	.	.	H	α-helix	trans	-66.5	-38.3	171.8	-77.2	167.4	0	0	0	110	V29 V30 K37	V29-L33 HydrophobicContact CG1-CD1 3.8Å; V29-L33 HydrophobicContact CG1-CG 4.36Å; V29-L33 WeakPolarHBondContact O-CB 3.13Å; V29-L33 WeakPolarHBondContact O-CG 3.06Å; V29-L33 PolarHBondContact O-N 3.34Å; V30-L33 PolarHBondContact O-N 2.8Å; L33-K37 WeakPolarHBondContact O-CB 3.37Å; L33-K37 WeakPolarHBondContact O-CG 3.18Å; L33-K37 PolarHBondContact O-N 3.46Å
34	F	72.9	Confident	76.4	Confident	133 Å²	133	111.5 Å²	111.5	58%	0.583	52%	0.524	S	S	*	.	H	α-helix	trans	-62.7	-57.3	170.3	-107	-101.2	0	0	0	111.5	V30 W31 Q32 S36 K37 F38	V30-F34 WeakPolarHBondContact O-CB 3.2Å; V30-F34 PolarHBondContact O-N 3.3Å; W31-F34 PolarHBondContact O-N 2.83Å; Q32-F34 VanDerWaalsContact C-N 3.31Å; F34-S36 VanDerWaalsContact C-N 3.35Å; F34-S36 PolarHBondContact O-N 3.28Å; F34-K37 PolarHBondContact O-N 2.87Å; F34-F38 AromaticContact CD1-CD2 3.93Å; F34-F38 HydrophobicContact CD1-CD2 3.93Å; F34-F38 AromaticContact CD1-CE2 3.77Å; F34-F38 HydrophobicContact CD1-CE2 3.77Å; F34-F38 HydrophobicContact CE1-CD2 4.5Å; F34-F38 AromaticContact CE1-CE2 3.89Å; F34-F38 HydrophobicContact CE1-CE2 3.89Å; F34-F38 VanDerWaalsContact O-CB 3.32Å; F34-F38 WeakPolarHBondContact O-CB 3.26Å; F34-F38 WeakPolarHBondContact O-CD2 3.4Å; F34-F38 PolarHBondContact O-N 2.85Å
35	L	70.8	Confident	74.8	Confident	93 Å²	93	114.6 Å²	114.6	49%	0.487	54%	0.538	S	S	.	.	H	α-helix	trans	-64.4	-34.3	-179.1	-88.7	165	0	0	0	113.4	W31 F38 K39	W31-L35 VanDerWaalsContact NE1-CD1 3.29Å; W31-L35 WeakPolarHBondContact O-CB 3.2Å; W31-L35 PolarHBondContact O-N 2.84Å; L35-F38 CarbonylContact O-C 3.59Å; L35-K39 WeakPolarHBondContact O-CA 3.32Å; L35-K39 WeakPolarHBondContact O-CB 3.48Å; L35-K39 PolarHBondContact O-N 3.43Å
36	S	67.9	Low	73.1	Confident	63 Å²	63	109.6 Å²	109.6	44%	0.441	53%	0.528	S	S	.	.	H	α-helix	trans	-75.7	-36.4	176.7	-60	0	0	0	0	111.4	Q32 F34 F40	Q32-S36 WeakPolarHBondContact O-CA 3.43Å; Q32-S36 WeakPolarHBondContact O-CB 3.13Å; Q32-S36 PolarHBondContact O-N 3.26Å; Q32-S36 PolarHBondContact O-OG 2.85Å; F34-S36 VanDerWaalsContact C-N 3.35Å; F34-S36 PolarHBondContact O-N 3.28Å; S36-F40 VanDerWaalsContact O-CB 3.25Å; S36-F40 WeakPolarHBondContact O-CB 3.25Å; S36-F40 PolarHBondContact O-N 2.83Å
37	K	64.7	Low	71.4	Confident	134 Å²	134	113.4 Å²	113.4	58%	0.583	54%	0.539	S	S	*	.	H	α-helix	trans	-70.5	-34.4	169.8	-69.9	-76.4	170	64.2	0	111.7	L33 F34 F40 L41	L33-K37 WeakPolarHBondContact O-CB 3.37Å; L33-K37 WeakPolarHBondContact O-CG 3.18Å; L33-K37 PolarHBondContact O-N 3.46Å; F34-K37 PolarHBondContact O-N 2.87Å; K37-F40 CarbonylContact O-C 3.58Å; K37-F40 PolarHBondContact O-N 3.31Å; K37-L41 WeakPolarHBondContact O-CB 3.43Å; K37-L41 WeakPolarHBondContact O-CD1 3.19Å; K37-L41 PolarHBondContact O-N 2.97Å
38	F	62.1	Low	69.5	Low	119 Å²	119	110.2 Å²	110.2	52%	0.522	54%	0.537	S	S	.	.	H	α-helix	trans	-75.9	-26.5	173.4	-90.8	-80.7	0	0	0	113.7	F34 L35 L41 R42	F34-F38 AromaticContact CD1-CD2 3.93Å; F34-F38 HydrophobicContact CD1-CD2 3.93Å; F34-F38 AromaticContact CD1-CE2 3.77Å; F34-F38 HydrophobicContact CD1-CE2 3.77Å; F34-F38 HydrophobicContact CE1-CD2 4.5Å; F34-F38 AromaticContact CE1-CE2 3.89Å; F34-F38 HydrophobicContact CE1-CE2 3.89Å; F34-F38 VanDerWaalsContact O-CB 3.32Å; F34-F38 WeakPolarHBondContact O-CB 3.26Å; F34-F38 WeakPolarHBondContact O-CD2 3.4Å; F34-F38 PolarHBondContact O-N 2.85Å; L35-F38 CarbonylContact O-C 3.59Å; F38-L41 CarbonylContact O-C 3.56Å; F38-R42 VanDerWaalsContact O-CB 3.23Å; F38-R42 WeakPolarHBondContact O-CB 3.37Å; F38-R42 PolarHBondContact O-N 3.33Å
39	K	65.3	Low	67.4	Low	120 Å²	120	106.2 Å²	106.2	52%	0.522	54%	0.539	S	S	.	.	H	α-helix	trans	-73.1	-40.4	168.5	173.8	168.2	149.8	54.4	0	110.1	L35 L41 R42 E43	L35-K39 WeakPolarHBondContact O-CA 3.32Å; L35-K39 WeakPolarHBondContact O-CB 3.48Å; L35-K39 PolarHBondContact O-N 3.43Å; K39-L41 VanDerWaalsContact C-N 3.35Å; K39-L41 PolarHBondContact O-N 3.43Å; K39-R42 CarbonylContact O-C 3.56Å; K39-R42 PolarHBondContact O-N 2.83Å; K39-E43 IonicContact NZ-OE1 2.59Å; K39-E43 PolarHBondContact NZ-OE1 3.41Å; K39-E43 IonicContact NZ-OE2 3.6Å; K39-E43 WeakPolarHBondContact O-CB 3.28Å; K39-E43 WeakPolarHBondContact O-CG 3.27Å; K39-E43 PolarHBondContact O-N 3.49Å
40	F	60.1	Low	65.5	Low	130 Å²	130	106.1 Å²	106.1	57%	0.57	54%	0.541	S	S	*	.	H	α-helix	trans	-64.8	-34.9	168.7	-160.2	-89.3	0	0	0	112.4	S36 K37 M44	S36-F40 VanDerWaalsContact O-CB 3.25Å; S36-F40 WeakPolarHBondContact O-CB 3.25Å; S36-F40 PolarHBondContact O-N 2.83Å; K37-F40 CarbonylContact O-C 3.58Å; K37-F40 PolarHBondContact O-N 3.31Å; F40-M44 HydrophobicContact CD1-CG 4.02Å; F40-M44 HydrophobicContact CE1-CG 3.94Å; F40-M44 HydrophobicContact CE1-SD 4.48Å; F40-M44 WeakPolarHBondContact O-CB 3.47Å; F40-M44 VanDerWaalsContact O-CG 3.23Å; F40-M44 WeakPolarHBondContact O-CG 3.35Å; F40-M44 PolarHBondContact O-N 2.89Å
41	L	66.9	Low	63.5	Low	100 Å²	100	107 Å²	107	52%	0.524	55%	0.549	S	S	.	.	H	α-helix	trans	-71.5	-28.1	168.7	-99	101.3	0	0	0	112.4	K37 F38 K39 L45	K37-L41 WeakPolarHBondContact O-CB 3.43Å; K37-L41 WeakPolarHBondContact O-CD1 3.19Å; K37-L41 PolarHBondContact O-N 2.97Å; F38-L41 CarbonylContact O-C 3.56Å; K39-L41 VanDerWaalsContact C-N 3.35Å; K39-L41 PolarHBondContact O-N 3.43Å; L41-L45 WeakPolarHBondContact O-CA 3.29Å; L41-L45 WeakPolarHBondContact O-CB 3.46Å; L41-L45 PolarHBondContact O-N 3.02Å
42	R	68	Low	61.7	Low	200 Å²	200	107.5 Å²	107.5	76%	0.755	56%	0.557	S	S	*	*	H	α-helix	trans	-84.5	-24.3	177.1	-176	161	-70.7	169.1	0.5	112.5	F38 K39 G46	F38-R42 VanDerWaalsContact O-CB 3.23Å; F38-R42 WeakPolarHBondContact O-CB 3.37Å; F38-R42 PolarHBondContact O-N 3.33Å; K39-R42 CarbonylContact O-C 3.56Å; K39-R42 PolarHBondContact O-N 2.83Å; R42-G46 VanDerWaalsContact O-CA 3.26Å; R42-G46 WeakPolarHBondContact O-CA 3.37Å; R42-G46 PolarHBondContact O-N 3.48Å
43	E	65.9	Low	59.8	Low	91 Å²	91	107.7 Å²	107.7	43%	0.425	57%	0.566	S	S	.	*	H	α-helix	trans	-74.3	-48.2	164.3	-77.8	157.1	162.9	0	0	108.9	K39 L45 G46 D47	K39-E43 IonicContact NZ-OE1 2.59Å; K39-E43 PolarHBondContact NZ-OE1 3.41Å; K39-E43 IonicContact NZ-OE2 3.6Å; K39-E43 WeakPolarHBondContact O-CB 3.28Å; K39-E43 WeakPolarHBondContact O-CG 3.27Å; K39-E43 PolarHBondContact O-N 3.49Å; E43-L45 PolarHBondContact O-N 2.9Å; E43-G46 PolarHBondContact O-N 3.35Å; E43-G46 VanDerWaalsContact O-N 3.17Å; E43-D47 WeakPolarHBondContact O-CB 3.31Å; E43-D47 PolarHBondContact O-N 3.28Å
44	M	61.4	Low	58.1	Low	100 Å²	100	111.4 Å²	111.4	49%	0.493	58%	0.581	S	S	.	*	H	α-helix	trans	-62.7	-41.5	173.6	-77.2	-101.1	60	0	0	114	F40 G46 T48	F40-M44 HydrophobicContact CD1-CG 4.02Å; F40-M44 HydrophobicContact CE1-CG 3.94Å; F40-M44 HydrophobicContact CE1-SD 4.48Å; F40-M44 WeakPolarHBondContact O-CB 3.47Å; F40-M44 VanDerWaalsContact O-CG 3.23Å; F40-M44 WeakPolarHBondContact O-CG 3.35Å; F40-M44 PolarHBondContact O-N 2.89Å; M44-G46 VanDerWaalsContact C-N 3.33Å; M44-T48 HydrophobicContact CE-CG2 4.42Å; M44-T48 VanDerWaalsContact O-CB 3.28Å; M44-T48 WeakPolarHBondContact O-CB 3.27Å; M44-T48 VanDerWaalsContact O-CG2 3.31Å; M44-T48 WeakPolarHBondContact O-CG2 3.43Å; M44-T48 PolarHBondContact O-N 3.49Å; M44-T48 PolarHBondContact O-OG1 3.46Å
45	L	59.5	Low	56.9	Low	130 Å²	130	111.9 Å²	111.9	68%	0.681	59%	0.594	S	S	*	*	H	α-helix	trans	-78.5	-18.3	175.7	-171.5	64.1	0	0	0	112.3	L41 E43 T48 G49	L41-L45 WeakPolarHBondContact O-CA 3.29Å; L41-L45 WeakPolarHBondContact O-CB 3.46Å; L41-L45 PolarHBondContact O-N 3.02Å; E43-L45 PolarHBondContact O-N 2.9Å; L45-T48 WeakPolarHBondContact CA-OG1 3.31Å; L45-G49 PolarHBondContact O-N 2.92Å
46	G	56.6	Low	55.2	Low	43 Å²	43	115.4 Å²	115.4	44%	0.443	61%	0.608	S	S	.	*	H	α-helix	trans	-80	-48.9	173.5	0	0	0	0	0	111.7	R42 E43 M44 G49 S50	R42-G46 VanDerWaalsContact O-CA 3.26Å; R42-G46 WeakPolarHBondContact O-CA 3.37Å; R42-G46 PolarHBondContact O-N 3.48Å; E43-G46 PolarHBondContact O-N 3.35Å; E43-G46 VanDerWaalsContact O-N 3.17Å; M44-G46 VanDerWaalsContact C-N 3.33Å; G46-G49 WeakPolarHBondContact O-CA 3.35Å; G46-G49 PolarHBondContact O-N 2.94Å; G46-S50 PolarHBondContact O-N 3.38Å
47	D	53.5	Low	54.1	Low	121 Å²	121	117 Å²	117	65%	0.647	62%	0.617	S	S	*	*	H	α-helix	trans	-69.6	-35.3	173.2	-93.1	-47.5	0	0	0	112	E43 G49 S50	E43-D47 WeakPolarHBondContact O-CB 3.31Å; E43-D47 PolarHBondContact O-N 3.28Å; D47-G49 VanDerWaalsContact C-N 3.28Å; D47-G49 PolarHBondContact O-N 3.06Å; D47-S50 CarbonylContact O-C 3.48Å; D47-S50 PolarHBondContact O-N 3.41Å; D47-S50 VanDerWaalsContact O-N 3.08Å
48	T	50.2	Low	52.7	Low	96 Å²	96	114.9 Å²	114.9	59%	0.589	62%	0.619	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.6	-10	169.7	58.8	0	0	0	0	113.6	M44 L45	M44-T48 HydrophobicContact CE-CG2 4.42Å; M44-T48 VanDerWaalsContact O-CB 3.28Å; M44-T48 WeakPolarHBondContact O-CB 3.27Å; M44-T48 VanDerWaalsContact O-CG2 3.31Å; M44-T48 WeakPolarHBondContact O-CG2 3.43Å; M44-T48 PolarHBondContact O-N 3.49Å; M44-T48 PolarHBondContact O-OG1 3.46Å; L45-T48 WeakPolarHBondContact CA-OG1 3.31Å
49	G	47.3	Very low	51.7	Low	57 Å²	57	118.1 Å²	118.1	59%	0.588	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73	-11.9	161.7	0	0	0	0	0	113.1	L45 G46 D47 P51	L45-G49 PolarHBondContact O-N 2.92Å; G46-G49 WeakPolarHBondContact O-CA 3.35Å; G46-G49 PolarHBondContact O-N 2.94Å; D47-G49 VanDerWaalsContact C-N 3.28Å; D47-G49 PolarHBondContact O-N 3.06Å; G49-P51 VanDerWaalsContact C-CD 3.44Å; G49-P51 WeakPolarHBondContact O-CD 3.48Å
50	S	47.7	Very low	50.1	Low	59 Å²	59	117.3 Å²	117.3	41%	0.413	65%	0.645	S	S	.	*			trans	-109.1	85.7	174.4	-174.1	0	0	0	0	112.2	G46 D47 Q52	G46-S50 PolarHBondContact O-N 3.38Å; D47-S50 CarbonylContact O-C 3.48Å; D47-S50 PolarHBondContact O-N 3.41Å; D47-S50 VanDerWaalsContact O-N 3.08Å; S50-Q52 PolarHBondContact O-N 3.23Å; S50-Q52 VanDerWaalsContact O-N 3.12Å; S50-Q52 WeakPolarHBondContact OG-CB 3.47Å; S50-Q52 PolarHBondContact OG-N 3.22Å
51	P	45.2	Very low	48.9	Very low	107 Å²	107	120.5 Å²	120.5	70%	0.695	66%	0.659	S	S	*	*			trans	-78	55.1	147.7	36.4	-33.1	0	0	0	109.6	G49 T53	G49-P51 VanDerWaalsContact C-CD 3.44Å; G49-P51 WeakPolarHBondContact O-CD 3.48Å; P51-T53 VanDerWaalsContact O-CB 3.25Å; P51-T53 WeakPolarHBondContact O-CB 3.26Å; P51-T53 PolarHBondContact O-OG1 3.1Å
52	Q	46.7	Very low	47.3	Very low	159 Å²	159	119.2 Å²	119.2	74%	0.743	66%	0.659	S	S	*	*			trans	-98.7	74.3	155.2	-168.7	174.8	66.2	0	0	105.8	S50 E54	S50-Q52 PolarHBondContact O-N 3.23Å; S50-Q52 VanDerWaalsContact O-N 3.12Å; S50-Q52 WeakPolarHBondContact OG-CB 3.47Å; S50-Q52 PolarHBondContact OG-N 3.22Å; Q52-E54 PolarHBondContact O-N 3Å
53	T	42.7	Very low	45.6	Very low	109 Å²	109	118 Å²	118	67%	0.669	66%	0.659	S	S	*	*				41.2	50.9	71.8	-43.7	0	0	0	0	112	P51	P51-T53 VanDerWaalsContact O-CB 3.25Å; P51-T53 WeakPolarHBondContact O-CB 3.26Å; P51-T53 PolarHBondContact O-OG1 3.1Å
54	E	45.6	Very low	44.6	Very low	176 Å²	176	121.3 Å²	121.3	82%	0.822	67%	0.674	S	S	*	*			trans	-150	60.9	145.9	-132.5	175	117.1	0	0	114	Q52	Q52-E54 PolarHBondContact O-N 3Å
55	T	46.7	Very low	43.8	Very low	142 Å²	142	122.2 Å²	122.2	87%	0.871	69%	0.685	S	S	*	*			trans	-97	100.7	145.7	-58.9	0	0	0	0	108
56	Q	35.1	Very low	42.6	Very low	168 Å²	168	120.6 Å²	120.6	79%	0.785	69%	0.685	S	S	*	*				-174.6	173.2	126.4	-115	-153.3	97.4	0	0	111.8
57	P	45.6	Very low	42	Very low	96 Å²	96	122.5 Å²	122.5	62%	0.623	69%	0.689	S	S	*	*				-123.2	-151.9	-125.8	42.6	-22.8	0	0	0	112.2
58	S	34.8	Very low	42.3	Very low	89 Å²	89	122.2 Å²	122.2	62%	0.622	69%	0.694	S	S	*	*			trans	69	106.7	179.2	-69.2	0	0	0	0	114.3
59	E	40.8	Very low	42	Very low	187 Å²	187	123.8 Å²	123.8	87%	0.874	70%	0.704	S	S	*	*				59.6	85.1	85.9	-67.8	-171.3	102.2	0	0	113.6
60	S	32.3	Very low	41.9	Very low	103 Å²	103	128.6 Å²	128.6	72%	0.72	71%	0.711	S	S	*	*			trans	-155	97.5	146.4	32.2	0	0	0	0	112.2
61	K	34.4	Very low	41.7	Very low	197 Å²	197	136.1 Å²	136.1	86%	0.857	73%	0.73	S	S	*	*			trans	-42.4	126.9	167.3	-179.2	168.7	-179.6	172	0	114.3
62	S	32.4	Very low	41.9	Very low	74 Å²	74	138.8 Å²	138.8	52%	0.517	73%	0.733	S	S	.	*			trans	75.8	140.2	156.8	93.5	0	0	0	0	116.5
63	K	33.6	Very low	42	Very low	175 Å²	175	141 Å²	141	76%	0.761	74%	0.735	S	S	*	*	S	Bend	cis	-136.6	137.4	3.8	-68.3	172.9	178.7	166.4	0	107.5
64	H	43.6	Very low	42.2	Very low	160 Å²	160	143 Å²	143	74%	0.741	74%	0.74	S	S	*	*	S	Bend		-81.6	-59.3	63.3	-164.4	-14.4	0	0	0	115.7	S66	H64-S66 VanDerWaalsContact N-N 3.15Å; H64-S66 PolarHBondContact N-O 3.49Å
65	T	46.2	Very low	42.1	Very low	118 Å²	118	144.6 Å²	144.6	72%	0.724	75%	0.745	S	S	*	*	S	Bend	cis	50.9	61.4	-26.4	52.3	0	0	0	0	119
66	S	33.7	Very low	42.4	Very low	97 Å²	97	144 Å²	144	68%	0.678	74%	0.741	S	S	*	*	S	Bend	trans	72.1	139.8	162.2	-51.3	0	0	0	0	117.4	H64	H64-S66 VanDerWaalsContact N-N 3.15Å; H64-S66 PolarHBondContact N-O 3.49Å
67	P	43.7	Very low	43.2	Very low	83 Å²	83	140.1 Å²	140.1	54%	0.539	74%	0.738	S	S	.	*			trans	-116.7	-178.9	-165.4	41.6	-27.1	0	0	0	114.7
68	P	59	Low	43.5	Very low	114 Å²	114	147.1 Å²	147.1	74%	0.74	75%	0.752	S	S	*	*			trans	-119	-176.8	-164.7	41	-29.4	0	0	0	115.9
69	T	45.9	Very low	44.3	Very low	129 Å²	129	151.8 Å²	151.8	79%	0.791	76%	0.763	S	S	*	*			trans	94.3	126.4	157	-39.2	0	0	0	0	117.1
70	Q	43.2	Very low	45	Very low	159 Å²	159	154.5 Å²	154.5	74%	0.743	77%	0.766	S	S	*	*				169.5	168.6	104.6	-157.6	169.9	44.9	0	0	112.8
71	R	44.4	Very low	45.9	Very low	216 Å²	216	155 Å²	155	82%	0.815	76%	0.764	S	S	*	*			trans	74.5	83.4	176.2	-55.8	-176.1	178.4	-165	0.2	113.9
72	Q	49.8	Very low	46.7	Very low	163 Å²	163	151.6 Å²	151.6	76%	0.762	76%	0.759	S	S	*	*			cis	52.5	120.4	47.9	-151.1	-161.3	-8	0	0	113.5
73	R	49	Very low	47.8	Very low	206 Å²	206	152.8 Å²	152.8	78%	0.777	77%	0.766	S	S	*	*			trans	67.7	97.8	154.3	-119.9	-175.4	175.8	-159.6	-0.2	117.7
74	L	47.1	Very low	48.5	Very low	150 Å²	150	150 Å²	150	79%	0.785	77%	0.766	S	S	*	*				-175.9	94	108	-120.5	67.5	0	0	0	111.4
75	K	42.4	Very low	49.1	Very low	211 Å²	211	150.1 Å²	150.1	92%	0.917	77%	0.766	S	S	*	*			trans	-135.9	42.5	158.1	-144.9	169	-172.2	175.3	0	111	A77	K75-A77 VanDerWaalsContact C-N 3.31Å; K75-A77 PolarHBondContact O-N 3.35Å; K75-A77 VanDerWaalsContact O-N 3.13Å
76	T	52.7	Low	49.3	Very low	130 Å²	130	152 Å²	152	80%	0.798	77%	0.772	S	S	*	*			trans	-84.9	71.9	177.4	-47	0	0	0	0	109.9
77	A	51.9	Low	50.3	Low	85 Å²	85	153.3 Å²	153.3	70%	0.702	78%	0.776	S	S	*	*			trans	-145.9	96.2	175.7	0	0	0	0	0	110.5	K75	K75-A77 VanDerWaalsContact C-N 3.31Å; K75-A77 PolarHBondContact O-N 3.35Å; K75-A77 VanDerWaalsContact O-N 3.13Å
78	R	52.6	Low	50.2	Low	244 Å²	244	159.3 Å²	159.3	92%	0.921	81%	0.812	S	S	*	*	S	Bend	trans	88.8	87.9	-176.6	-61.6	177.6	152.4	179.9	-6.9	117.1
79	Q	52.4	Low	49.8	Very low	186 Å²	186	161.6 Å²	161.6	87%	0.869	82%	0.815	S	S	*	*				-159.3	92.5	109.1	-117.6	174	-25.9	0	0	110.6	V81	Q79-V81 PolarHBondContact O-N 3.07Å
80	R	53.6	Low	50	Low	245 Å²	245	163.3 Å²	163.3	93%	0.925	82%	0.816	S	S	*	*			trans	-89.6	89.7	167.8	-175.6	-170.7	-166	-173.3	5.3	107.7
81	V	51.6	Low	50.4	Low	113 Å²	113	163.6 Å²	163.6	69%	0.685	82%	0.821	S	S	*	*			trans	-140	89.1	168.8	-175.4	0	0	0	0	103.9	Q79	Q79-V81 PolarHBondContact O-N 3.07Å
82	V	51	Low	50.7	Low	125 Å²	125	160.5 Å²	160.5	76%	0.758	82%	0.821	S	S	*	*				71.3	129.9	93	176.3	0	0	0	0	110.8
83	P	57.1	Low	50.8	Low	100 Å²	100	160.3 Å²	160.3	65%	0.649	83%	0.825	S	S	*	*			trans	-95.3	-175.4	-151.5	40.7	-37.9	0	0	0	113.2
84	P	48.2	Very low	50.9	Low	117 Å²	117	157.3 Å²	157.3	76%	0.76	83%	0.828	S	S	*	*			trans	-113.3	130.5	139.5	34	-26.9	0	0	0	111.4
85	E	56.2	Low	51.2	Low	162 Å²	162	157.8 Å²	157.8	76%	0.757	83%	0.831	S	S	*	*			trans	-63	142.2	158.2	54.3	-103.4	62.2	0	0	112.6
86	N	50	Low	51.8	Low	156 Å²	156	153.7 Å²	153.7	83%	0.834	82%	0.824	S	S	*	*			trans	-148.4	98.8	148.3	63.1	-36.1	0	0	0	111.2
87	T	53.5	Low	51.7	Low	126 Å²	126	155.7 Å²	155.7	77%	0.773	83%	0.826	S	S	*	*			trans	-70.6	141.5	168	-52.6	0	0	0	0	110.3
88	T	42.9	Very low	51.7	Low	209 Å²	209	162.1 Å²	162.1	100%	1.282	84%	0.837	S	S	*	*			trans	35.2	0	156.6	-55.1	0	0	0	0	118.7

Retrieved 88 of 88 residues in 548.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).