A0A060W271_ONCMY Loading...

BLOC-1-related complex subunit 7

AlphaFold DB , UniProt , Accession A0A060W271, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 103 aa.

						>A0A060W271_ONCMY|A0A060W271
MASVESQPRFGQSVKGLLSDKVGSCSGDVIALTRQVLKGSRSQELLGQAARNMVIQEDAILHSEDSLRKMSIITTHLQYQQEAIQKNVEHSKNLQDQLRHLLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39	Very low	52.8	Low	240 Å²	240	149.1 Å²	149.1	100%	1.182	84%	0.843	S	S	*	*				0	107.4	0	-78.4	-81.6	127.3	0	0	106.1	S3	M1-S3 PolarHBondContact O-N 3.43Å
2	A	38.7	Very low	54.6	Low	96 Å²	96	141.8 Å²	141.8	79%	0.793	80%	0.797	S	S	*	*			trans	-64.3	124.8	-170.5	0	0	0	0	0	110.4	V4	A2-V4 PolarHBondContact O-N 3.48Å
3	S	46.3	Very low	57	Low	123 Å²	123	137.3 Å²	137.3	86%	0.86	78%	0.78	S	S	*	*			trans	-66.7	110.1	168.3	-150.5	0	0	0	0	106.7	M1 E5	M1-S3 PolarHBondContact O-N 3.43Å; S3-E5 PolarHBondContact O-N 2.97Å
4	V	51.8	Low	59.2	Low	134 Å²	134	135.1 Å²	135.1	81%	0.812	77%	0.771	S	S	*	*			trans	-73.7	99.7	176	-179.8	0	0	0	0	106.6	A2 S6	A2-V4 PolarHBondContact O-N 3.48Å; V4-S6 PolarHBondContact O-N 3.49Å
5	E	46.3	Very low	61.2	Low	182 Å²	182	137.5 Å²	137.5	85%	0.85	77%	0.769	S	S	*	*			trans	-55.6	117.4	171.7	-167.2	147.6	-171.2	0	0	108.9	S3 Q7	S3-E5 PolarHBondContact O-N 2.97Å; E5-Q7 VanDerWaalsContact C-N 3.33Å; E5-Q7 PolarHBondContact O-N 3.16Å
6	S	56.8	Low	62.9	Low	112 Å²	112	130.6 Å²	130.6	78%	0.783	74%	0.738	S	S	*	*			trans	-71.3	87.6	-175.5	51.7	0	0	0	0	110	V4	V4-S6 PolarHBondContact O-N 3.49Å
7	Q	55.4	Low	64.5	Low	170 Å²	170	127.4 Å²	127.4	79%	0.794	72%	0.718	S	S	*	*			trans	-53.5	138.5	167.8	-125.1	-174.6	-36.7	0	0	109.8	E5 R9	E5-Q7 VanDerWaalsContact C-N 3.33Å; E5-Q7 PolarHBondContact O-N 3.16Å; Q7-R9 PolarHBondContact O-N 3.08Å
8	P	53.9	Low	66	Low	108 Å²	108	126.1 Å²	126.1	70%	0.701	71%	0.708	S	S	*	*			trans	-65.5	104.8	177.6	25.2	-31.8	0	0	0	109.8	F10	P8-F10 VanDerWaalsContact C-N 3.29Å; P8-F10 PolarHBondContact O-N 2.84Å
9	R	63.3	Low	67.4	Low	179 Å²	179	123.7 Å²	123.7	68%	0.675	70%	0.7	S	S	*	*			trans	-75.2	81.4	175.1	-76.1	-178.3	172.8	179.7	1.3	109.6	Q7 G11 Q12	Q7-R9 PolarHBondContact O-N 3.08Å; R9-G11 PolarHBondContact O-N 2.88Å; R9-Q12 HydrophobicContact CB-CB 4.21Å; R9-Q12 PolarHBondContact O-N 3.3Å
10	F	59.9	Low	68.6	Low	208 Å²	208	122 Å²	122	91%	0.912	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.9	126.6	167.2	-99.2	-91.3	0	0	0	109.6	P8	P8-F10 VanDerWaalsContact C-N 3.29Å; P8-F10 PolarHBondContact O-N 2.84Å
11	G	69.2	Low	69.9	Low	88 Å²	88	123.7 Å²	123.7	91%	0.907	69%	0.689	S	S	*	*	T	Hydrogen-bonded Turn	trans	100	-7	-179.4	0	0	0	0	0	116	R9	R9-G11 PolarHBondContact O-N 2.88Å
12	Q	74.9	Confident	72.6	Confident	62 Å²	62	117 Å²	117	29%	0.29	66%	0.661	S	S	.	*			trans	-83.2	128.4	176.1	-148.9	170.2	-1.9	0	0	110.8	R9 V14 L17 D20	R9-Q12 HydrophobicContact CB-CB 4.21Å; R9-Q12 PolarHBondContact O-N 3.3Å; Q12-V14 PolarHBondContact O-N 3.22Å; Q12-L17 HydrophobicContact CB-CD2 4.38Å; Q12-L17 HydrophobicContact CB-CG 4.26Å; Q12-L17 HydrophobicContact CG-CD2 4.28Å; Q12-L17 HydrophobicContact CG-CG 4.26Å; Q12-L17 VanDerWaalsContact OE1-CD2 3.3Å; Q12-D20 PolarHBondContact NE2-OD2 3.42Å
13	S	86.3	Confident	75.3	Confident	83 Å²	83	114.5 Å²	114.5	58%	0.58	65%	0.646	S	S	*	*			trans	-61.3	139.1	176.1	177.6	0	0	0	0	110.4	K15 G16 L17	S13-K15 PolarHBondContact O-N 3.38Å; S13-K15 VanDerWaalsContact O-N 3.08Å; S13-K15 PolarHBondContact OG-N 3.44Å; S13-G16 WeakPolarHBondContact O-CA 3.35Å; S13-G16 PolarHBondContact O-N 2.96Å; S13-L17 PolarHBondContact O-N 3.4Å; S13-L17 VanDerWaalsContact O-N 3.16Å
14	V	87.6	Confident	77.6	Confident	107 Å²	107	112 Å²	112	65%	0.648	63%	0.628	S	S	*	*	H	α-helix	trans	-49.5	-36.4	173.8	178.2	0	0	0	0	111.4	Q12 G16 L17 L18	Q12-V14 PolarHBondContact O-N 3.22Å; V14-G16 PolarHBondContact O-N 3.28Å; V14-L17 PolarHBondContact O-N 3.09Å; V14-L18 HydrophobicContact CG1-CD1 3.93Å; V14-L18 HydrophobicContact CG1-CG 4.43Å; V14-L18 WeakPolarHBondContact O-CB 3.43Å; V14-L18 WeakPolarHBondContact O-CG 3.45Å; V14-L18 PolarHBondContact O-N 2.95Å
15	K	88.6	Confident	79.7	Confident	171 Å²	171	109.1 Å²	109.1	74%	0.743	61%	0.613	S	S	*	*	H	α-helix	trans	-61.9	-41.2	175.7	-175	-178.4	175.6	-175.6	0	112.6	S13 S19	S13-K15 PolarHBondContact O-N 3.38Å; S13-K15 VanDerWaalsContact O-N 3.08Å; S13-K15 PolarHBondContact OG-N 3.44Å; K15-S19 WeakPolarHBondContact O-CB 3.27Å; K15-S19 PolarHBondContact O-N 3.35Å
16	G	89.2	Confident	82.2	Confident	26 Å²	26	103.6 Å²	103.6	27%	0.268	59%	0.594	S	S	.	*	H	α-helix	trans	-66.3	-46.6	177.6	0	0	0	0	0	111.7	S13 V14 L18 S19 D20	S13-G16 WeakPolarHBondContact O-CA 3.35Å; S13-G16 PolarHBondContact O-N 2.96Å; V14-G16 PolarHBondContact O-N 3.28Å; G16-L18 VanDerWaalsContact C-N 3.31Å; G16-L18 PolarHBondContact O-N 2.92Å; G16-S19 WeakPolarHBondContact O-CB 3.44Å; G16-S19 PolarHBondContact O-N 2.94Å; G16-S19 VanDerWaalsContact O-N 3.16Å; G16-D20 PolarHBondContact O-N 3.46Å
17	L	89	Confident	84.1	Confident	77 Å²	77	99.9 Å²	99.9	40%	0.403	57%	0.574	S	S	.	*	H	α-helix	trans	-61.2	-39.2	177	-68.8	172	0	0	0	112.7	Q12 S13 V14 K21	Q12-L17 HydrophobicContact CB-CD2 4.38Å; Q12-L17 HydrophobicContact CB-CG 4.26Å; Q12-L17 HydrophobicContact CG-CD2 4.28Å; Q12-L17 HydrophobicContact CG-CG 4.26Å; Q12-L17 VanDerWaalsContact OE1-CD2 3.3Å; S13-L17 PolarHBondContact O-N 3.4Å; S13-L17 VanDerWaalsContact O-N 3.16Å; V14-L17 PolarHBondContact O-N 3.09Å; L17-K21 PolarHBondContact O-N 3.41Å; L17-K21 VanDerWaalsContact O-N 3.09Å
18	L	91.6	Very high	86.1	Confident	104 Å²	104	96.7 Å²	96.7	55%	0.545	56%	0.562	S	S	.	*	H	α-helix	trans	-66	-44.4	174	-77.1	168.3	0	0	0	111.5	V14 G16 D20 K21 V22	V14-L18 HydrophobicContact CG1-CD1 3.93Å; V14-L18 HydrophobicContact CG1-CG 4.43Å; V14-L18 WeakPolarHBondContact O-CB 3.43Å; V14-L18 WeakPolarHBondContact O-CG 3.45Å; V14-L18 PolarHBondContact O-N 2.95Å; G16-L18 VanDerWaalsContact C-N 3.31Å; G16-L18 PolarHBondContact O-N 2.92Å; L18-D20 VanDerWaalsContact C-N 3.31Å; L18-D20 PolarHBondContact O-N 3.24Å; L18-K21 PolarHBondContact O-N 3.42Å; L18-V22 WeakPolarHBondContact O-CB 3.4Å; L18-V22 VanDerWaalsContact O-CG2 3.27Å; L18-V22 WeakPolarHBondContact O-CG2 3.36Å; L18-V22 PolarHBondContact O-N 3.43Å
19	S	92.6	Very high	88.2	Confident	80 Å²	80	95.3 Å²	95.3	56%	0.559	55%	0.552	S	S	*	*	H	α-helix	trans	-58.7	-43.2	176.8	-168.6	0	0	0	0	111.8	K15 G16 V22 G23	K15-S19 WeakPolarHBondContact O-CB 3.27Å; K15-S19 PolarHBondContact O-N 3.35Å; G16-S19 WeakPolarHBondContact O-CB 3.44Å; G16-S19 PolarHBondContact O-N 2.94Å; G16-S19 VanDerWaalsContact O-N 3.16Å; S19-V22 PolarHBondContact O-N 2.94Å; S19-G23 PolarHBondContact O-N 3.3Å
20	D	92.4	Very high	89.8	Confident	90 Å²	90	90.7 Å²	90.7	48%	0.481	54%	0.54	S	S	.	.	H	α-helix	trans	-64.3	-45.2	178	-68	-16.7	0	0	0	111.4	Q12 G16 L18 G23 S24	Q12-D20 PolarHBondContact NE2-OD2 3.42Å; G16-D20 PolarHBondContact O-N 3.46Å; L18-D20 VanDerWaalsContact C-N 3.31Å; L18-D20 PolarHBondContact O-N 3.24Å; D20-G23 PolarHBondContact O-N 2.9Å; D20-S24 PolarHBondContact O-N 2.93Å
21	K	94.3	Very high	91.7	Very high	158 Å²	158	83 Å²	83	69%	0.687	51%	0.514	S	S	*	.	H	α-helix	trans	-63.6	-41.5	176.3	-80.1	-177.1	-178.1	-173.2	0	112.7	L17 L18 G23 S24 C25	L17-K21 PolarHBondContact O-N 3.41Å; L17-K21 VanDerWaalsContact O-N 3.09Å; L18-K21 PolarHBondContact O-N 3.42Å; K21-G23 VanDerWaalsContact C-N 3.34Å; K21-S24 PolarHBondContact O-N 3.16Å; K21-C25 VanDerWaalsContact O-CB 3.27Å; K21-C25 WeakPolarHBondContact O-CB 3.27Å; K21-C25 PolarHBondContact O-N 3.32Å
22	V	96	Very high	93	Very high	98 Å²	98	83.6 Å²	83.6	59%	0.594	50%	0.496	S	S	*	.	H	α-helix	trans	-64.1	-42.1	176	169.5	0	0	0	0	110.5	L18 S19 C25 S26	L18-V22 WeakPolarHBondContact O-CB 3.4Å; L18-V22 VanDerWaalsContact O-CG2 3.27Å; L18-V22 WeakPolarHBondContact O-CG2 3.36Å; L18-V22 PolarHBondContact O-N 3.43Å; S19-V22 PolarHBondContact O-N 2.94Å; V22-C25 PolarHBondContact O-N 3.13Å; V22-S26 WeakPolarHBondContact O-CB 3.42Å; V22-S26 PolarHBondContact O-N 2.94Å
23	G	95.7	Very high	94.1	Very high	45 Å²	45	84.3 Å²	84.3	46%	0.464	51%	0.505	S	S	.	.	H	α-helix	trans	-60.7	-47.3	175.8	0	0	0	0	0	112.7	S19 D20 K21 S26 G27	S19-G23 PolarHBondContact O-N 3.3Å; D20-G23 PolarHBondContact O-N 2.9Å; K21-G23 VanDerWaalsContact C-N 3.34Å; G23-S26 PolarHBondContact O-N 3.17Å; G23-G27 PolarHBondContact O-N 3.43Å; G23-G27 VanDerWaalsContact O-N 3.09Å
24	S	95.3	Very high	94.7	Very high	71 Å²	71	87 Å²	87	50%	0.497	50%	0.502	S	S	.	.	H	α-helix	trans	-60.5	-49.8	175.7	-169.8	0	0	0	0	111.6	D20 K21 S26 G27 D28	D20-S24 PolarHBondContact O-N 2.93Å; K21-S24 PolarHBondContact O-N 3.16Å; S24-S26 VanDerWaalsContact C-N 3.32Å; S24-S26 PolarHBondContact O-N 2.94Å; S24-G27 WeakPolarHBondContact O-CA 3.34Å; S24-G27 PolarHBondContact O-N 2.79Å; S24-D28 PolarHBondContact O-N 3.31Å
25	C	96.5	Very high	95.1	Very high	72 Å²	72	88.4 Å²	88.4	49%	0.486	50%	0.502	S	S	.	.	H	α-helix	trans	-57.8	-43.9	179.2	-179.9	0	0	0	0	111.8	K21 V22 G27 D28 V29	K21-C25 VanDerWaalsContact O-CB 3.27Å; K21-C25 WeakPolarHBondContact O-CB 3.27Å; K21-C25 PolarHBondContact O-N 3.32Å; V22-C25 PolarHBondContact O-N 3.13Å; C25-G27 VanDerWaalsContact C-N 3.32Å; C25-G27 PolarHBondContact O-N 2.93Å; C25-D28 PolarHBondContact O-N 2.87Å; C25-V29 WeakPolarHBondContact O-CG2 3.45Å; C25-V29 PolarHBondContact O-N 3.44Å
26	S	97.1	Very high	95.6	Very high	66 Å²	66	84.3 Å²	84.3	46%	0.462	49%	0.491	S	S	.	.	H	α-helix	trans	-58.3	-44.3	174.8	-176.1	0	0	0	0	111.8	V22 G23 S24 D28 V29 I30	V22-S26 WeakPolarHBondContact O-CB 3.42Å; V22-S26 PolarHBondContact O-N 2.94Å; G23-S26 PolarHBondContact O-N 3.17Å; S24-S26 VanDerWaalsContact C-N 3.32Å; S24-S26 PolarHBondContact O-N 2.94Å; S26-D28 PolarHBondContact O-N 2.84Å; S26-V29 PolarHBondContact O-N 2.94Å; S26-I30 WeakPolarHBondContact O-CD1 3.43Å; S26-I30 VanDerWaalsContact O-CG1 3.24Å; S26-I30 WeakPolarHBondContact O-CG1 3.39Å; S26-I30 PolarHBondContact O-N 3.05Å; S26-I30 VanDerWaalsContact O-N 3.13Å
27	G	97.4	Very high	96	Very high	35 Å²	35	88.6 Å²	88.6	36%	0.361	51%	0.507	S	S	.	.	H	α-helix	trans	-59.5	-46.1	175	0	0	0	0	0	113.1	G23 S24 C25 I30 A31	G23-G27 PolarHBondContact O-N 3.43Å; G23-G27 VanDerWaalsContact O-N 3.09Å; S24-G27 WeakPolarHBondContact O-CA 3.34Å; S24-G27 PolarHBondContact O-N 2.79Å; C25-G27 VanDerWaalsContact C-N 3.32Å; C25-G27 PolarHBondContact O-N 2.93Å; G27-I30 PolarHBondContact O-N 3.09Å; G27-A31 PolarHBondContact O-N 3.46Å
28	D	97.5	Very high	96.3	Very high	102 Å²	102	92.4 Å²	92.4	55%	0.545	52%	0.52	S	S	.	.	H	α-helix	trans	-64	-42.4	-179.9	-65.1	-31.5	0	0	0	111.8	S24 C25 S26 I30 A31 L32	S24-D28 PolarHBondContact O-N 3.31Å; C25-D28 PolarHBondContact O-N 2.87Å; S26-D28 PolarHBondContact O-N 2.84Å; D28-I30 VanDerWaalsContact C-N 3.34Å; D28-I30 PolarHBondContact O-N 3.47Å; D28-A31 PolarHBondContact O-N 3.23Å; D28-L32 WeakPolarHBondContact O-CB 3.49Å; D28-L32 PolarHBondContact O-N 3.4Å
29	V	98.1	Very high	96.5	Very high	80 Å²	80	89.2 Å²	89.2	49%	0.485	51%	0.513	S	S	.	.	H	α-helix	trans	-62.4	-41	176.7	170.3	0	0	0	0	111.5	C25 S26 L32 T33	C25-V29 WeakPolarHBondContact O-CG2 3.45Å; C25-V29 PolarHBondContact O-N 3.44Å; S26-V29 PolarHBondContact O-N 2.94Å; V29-L32 PolarHBondContact O-N 3.08Å; V29-T33 WeakPolarHBondContact O-CB 3.24Å; V29-T33 PolarHBondContact O-N 3.5Å; V29-T33 PolarHBondContact O-OG1 3.28Å
30	I	97.5	Very high	96.7	Very high	82 Å²	82	88.4 Å²	88.4	42%	0.421	51%	0.508	S	S	.	.	H	α-helix	trans	-67	-41.9	176.9	-63	166.2	0	0	0	110.2	S26 G27 D28 T33 R34	S26-I30 WeakPolarHBondContact O-CD1 3.43Å; S26-I30 VanDerWaalsContact O-CG1 3.24Å; S26-I30 WeakPolarHBondContact O-CG1 3.39Å; S26-I30 PolarHBondContact O-N 3.05Å; S26-I30 VanDerWaalsContact O-N 3.13Å; G27-I30 PolarHBondContact O-N 3.09Å; D28-I30 VanDerWaalsContact C-N 3.34Å; D28-I30 PolarHBondContact O-N 3.47Å; I30-T33 PolarHBondContact O-N 3.36Å; I30-R34 PolarHBondContact O-N 2.9Å; I30-R34 VanDerWaalsContact O-N 3.09Å
31	A	97.8	Very high	96.9	Very high	45 Å²	45	92.7 Å²	92.7	37%	0.372	52%	0.517	S	S	.	.	H	α-helix	trans	-61.6	-46	176.5	0	0	0	0	0	111.8	G27 D28 T33 R34 Q35	G27-A31 PolarHBondContact O-N 3.46Å; D28-A31 PolarHBondContact O-N 3.23Å; A31-T33 VanDerWaalsContact C-N 3.35Å; A31-T33 PolarHBondContact O-N 2.86Å; A31-R34 PolarHBondContact O-N 3.43Å; A31-Q35 PolarHBondContact O-N 3.2Å
32	L	98	Very high	97	Very high	102 Å²	102	88 Å²	88	53%	0.534	50%	0.504	S	S	.	.	H	α-helix	trans	-58	-46.8	175	177.7	61.3	0	0	0	111.3	D28 V29 R34 Q35 V36	D28-L32 WeakPolarHBondContact O-CB 3.49Å; D28-L32 PolarHBondContact O-N 3.4Å; V29-L32 PolarHBondContact O-N 3.08Å; L32-R34 VanDerWaalsContact C-N 3.31Å; L32-R34 PolarHBondContact O-N 3.43Å; L32-Q35 WeakPolarHBondContact O-CB 3.45Å; L32-Q35 PolarHBondContact O-N 3.12Å; L32-V36 HydrophobicContact CD1-CG2 4.3Å; L32-V36 WeakPolarHBondContact O-CG2 3.49Å; L32-V36 PolarHBondContact O-N 2.86Å
33	T	97.8	Very high	97	Very high	77 Å²	77	90.2 Å²	90.2	47%	0.472	51%	0.508	S	S	.	.	H	α-helix	trans	-57.2	-45.3	178.3	-57.9	0	0	0	0	111.3	V29 I30 A31 Q35 V36 L37	V29-T33 WeakPolarHBondContact O-CB 3.24Å; V29-T33 PolarHBondContact O-N 3.5Å; V29-T33 PolarHBondContact O-OG1 3.28Å; I30-T33 PolarHBondContact O-N 3.36Å; A31-T33 VanDerWaalsContact C-N 3.35Å; A31-T33 PolarHBondContact O-N 2.86Å; T33-Q35 VanDerWaalsContact C-N 3.34Å; T33-Q35 PolarHBondContact O-N 3.45Å; T33-V36 PolarHBondContact O-N 3.15Å; T33-L37 HydrophobicContact CG2-CD1 4.48Å; T33-L37 WeakPolarHBondContact O-CG 3.47Å; T33-L37 PolarHBondContact O-N 3.1Å; T33-L37 VanDerWaalsContact O-N 3.08Å
34	R	97.8	Very high	97.1	Very high	138 Å²	138	94.8 Å²	94.8	52%	0.521	52%	0.517	S	S	.	.	H	α-helix	trans	-63.7	-38.9	175.8	-73.3	-174	-70.5	-106.8	-4.2	112.7	I30 A31 L32 L37 K38	I30-R34 PolarHBondContact O-N 2.9Å; I30-R34 VanDerWaalsContact O-N 3.09Å; A31-R34 PolarHBondContact O-N 3.43Å; L32-R34 VanDerWaalsContact C-N 3.31Å; L32-R34 PolarHBondContact O-N 3.43Å; R34-L37 PolarHBondContact O-N 2.83Å; R34-K38 WeakPolarHBondContact O-CG 3.46Å; R34-K38 PolarHBondContact O-N 3.37Å
35	Q	97.7	Very high	97.2	Very high	138 Å²	138	96.7 Å²	96.7	65%	0.645	52%	0.521	S	S	*	.	H	α-helix	trans	-65.5	-43.1	178.5	-173.1	176.7	1.1	0	0	111.2	A31 L32 T33 K38 G39	A31-Q35 PolarHBondContact O-N 3.2Å; L32-Q35 WeakPolarHBondContact O-CB 3.45Å; L32-Q35 PolarHBondContact O-N 3.12Å; T33-Q35 VanDerWaalsContact C-N 3.34Å; T33-Q35 PolarHBondContact O-N 3.45Å; Q35-K38 PolarHBondContact O-N 3.35Å; Q35-G39 PolarHBondContact O-N 3.47Å
36	V	97.9	Very high	97.3	Very high	84 Å²	84	98.8 Å²	98.8	51%	0.509	53%	0.527	S	S	.	.	H	α-helix	trans	-58.6	-49.3	174.9	171.3	0	0	0	0	110.6	L32 T33 K38 G39 S40	L32-V36 HydrophobicContact CD1-CG2 4.3Å; L32-V36 WeakPolarHBondContact O-CG2 3.49Å; L32-V36 PolarHBondContact O-N 2.86Å; T33-V36 PolarHBondContact O-N 3.15Å; V36-K38 PolarHBondContact O-N 3.05Å; V36-G39 WeakPolarHBondContact O-CA 3.43Å; V36-G39 PolarHBondContact O-N 3.08Å; V36-G39 VanDerWaalsContact O-N 3.1Å; V36-S40 PolarHBondContact O-N 2.89Å; V36-S40 PolarHBondContact O-OG 3.07Å; V36-S40 VanDerWaalsContact O-OG 3.12Å
37	L	97.3	Very high	97.3	Very high	116 Å²	116	96.9 Å²	96.9	61%	0.607	52%	0.518	S	S	*	.	H	α-helix	trans	-59.4	-43.3	178.8	-68.8	173.4	0	0	0	112.8	T33 R34 R41	T33-L37 HydrophobicContact CG2-CD1 4.48Å; T33-L37 WeakPolarHBondContact O-CG 3.47Å; T33-L37 PolarHBondContact O-N 3.1Å; T33-L37 VanDerWaalsContact O-N 3.08Å; R34-L37 PolarHBondContact O-N 2.83Å; L37-R41 PolarHBondContact O-N 2.98Å
38	K	96.2	Very high	97.3	Very high	157 Å²	157	99.3 Å²	99.3	68%	0.683	52%	0.52	S	S	*	.	H	α-helix	trans	-64.1	-41.8	174.7	-72.5	178.4	-179.3	-176.8	0	111.5	R34 Q35 V36 R41 S42	R34-K38 WeakPolarHBondContact O-CG 3.46Å; R34-K38 PolarHBondContact O-N 3.37Å; Q35-K38 PolarHBondContact O-N 3.35Å; V36-K38 PolarHBondContact O-N 3.05Å; K38-R41 PolarHBondContact O-N 3.34Å; K38-S42 WeakPolarHBondContact O-CB 3.38Å; K38-S42 PolarHBondContact O-N 3.09Å
39	G	96.4	Very high	97.3	Very high	38 Å²	38	96.6 Å²	96.6	39%	0.392	51%	0.512	S	S	.	.	H	α-helix	trans	-59.6	-48	176.7	0	0	0	0	0	112.3	Q35 V36 R41 S42 Q43	Q35-G39 PolarHBondContact O-N 3.47Å; V36-G39 WeakPolarHBondContact O-CA 3.43Å; V36-G39 PolarHBondContact O-N 3.08Å; V36-G39 VanDerWaalsContact O-N 3.1Å; G39-R41 PolarHBondContact O-N 3.25Å; G39-S42 WeakPolarHBondContact O-CB 3.48Å; G39-S42 PolarHBondContact O-N 3.4Å; G39-S42 VanDerWaalsContact O-N 3.15Å; G39-Q43 PolarHBondContact O-N 3.46Å
40	S	96	Very high	97.2	Very high	63 Å²	63	95.3 Å²	95.3	44%	0.441	51%	0.51	S	S	.	.	H	α-helix	trans	-59.4	-45.3	177.9	-57.1	0	0	0	0	112	V36 S42 Q43 E44	V36-S40 PolarHBondContact O-N 2.89Å; V36-S40 PolarHBondContact O-OG 3.07Å; V36-S40 VanDerWaalsContact O-OG 3.12Å; S40-S42 VanDerWaalsContact C-N 3.33Å; S40-S42 PolarHBondContact O-N 3.46Å; S40-Q43 WeakPolarHBondContact O-CB 3.37Å; S40-Q43 PolarHBondContact O-N 3.37Å; S40-E44 PolarHBondContact O-N 3.03Å; S40-E44 VanDerWaalsContact O-N 3.08Å
41	R	96.2	Very high	97.2	Very high	180 Å²	180	97.8 Å²	97.8	68%	0.679	51%	0.514	S	S	*	.	H	α-helix	trans	-62.8	-40.3	175.7	-174.1	176.4	179.9	-177.3	-0.1	112.1	L37 K38 G39 Q43 E44 L45	L37-R41 PolarHBondContact O-N 2.98Å; K38-R41 PolarHBondContact O-N 3.34Å; G39-R41 PolarHBondContact O-N 3.25Å; R41-Q43 VanDerWaalsContact C-N 3.34Å; R41-E44 PolarHBondContact O-N 3.37Å; R41-L45 WeakPolarHBondContact O-CG 3.35Å; R41-L45 PolarHBondContact O-N 3.29Å; R41-L45 VanDerWaalsContact O-N 3.16Å
42	S	96.9	Very high	97.1	Very high	60 Å²	60	99.5 Å²	99.5	42%	0.42	52%	0.517	S	S	.	.	H	α-helix	trans	-64	-40.5	176.9	-169.7	0	0	0	0	111.8	K38 G39 S40 E44 L45 L46	K38-S42 WeakPolarHBondContact O-CB 3.38Å; K38-S42 PolarHBondContact O-N 3.09Å; G39-S42 WeakPolarHBondContact O-CB 3.48Å; G39-S42 PolarHBondContact O-N 3.4Å; G39-S42 VanDerWaalsContact O-N 3.15Å; S40-S42 VanDerWaalsContact C-N 3.33Å; S40-S42 PolarHBondContact O-N 3.46Å; S42-E44 VanDerWaalsContact C-N 3.34Å; S42-L45 PolarHBondContact O-N 3.38Å; S42-L46 WeakPolarHBondContact O-CB 3.45Å; S42-L46 VanDerWaalsContact O-CG 3.3Å; S42-L46 WeakPolarHBondContact O-CG 3.3Å; S42-L46 PolarHBondContact O-N 3.39Å
43	Q	96.6	Very high	97	Very high	144 Å²	144	101.1 Å²	101.1	67%	0.673	52%	0.523	S	S	*	.	H	α-helix	trans	-62.6	-42.6	177.4	-171.8	-152.6	-10.5	0	0	111.3	G39 S40 R41 L46 G47	G39-Q43 PolarHBondContact O-N 3.46Å; S40-Q43 WeakPolarHBondContact O-CB 3.37Å; S40-Q43 PolarHBondContact O-N 3.37Å; R41-Q43 VanDerWaalsContact C-N 3.34Å; Q43-L46 PolarHBondContact O-N 2.96Å; Q43-G47 PolarHBondContact O-N 3.18Å
44	E	97	Very high	96.8	Very high	141 Å²	141	102 Å²	102	66%	0.659	53%	0.528	S	S	*	.	H	α-helix	trans	-60.7	-47.4	177.5	-175.7	-178.8	-175.3	0	0	111.8	S40 R41 S42 L46 G47 Q48	S40-E44 PolarHBondContact O-N 3.03Å; S40-E44 VanDerWaalsContact O-N 3.08Å; R41-E44 PolarHBondContact O-N 3.37Å; S42-E44 VanDerWaalsContact C-N 3.34Å; E44-L46 PolarHBondContact O-N 3.06Å; E44-G47 PolarHBondContact O-N 2.91Å; E44-Q48 PolarHBondContact O-N 3.31Å
45	L	97.3	Very high	96.6	Very high	111 Å²	111	101.3 Å²	101.3	58%	0.581	53%	0.534	S	S	*	.	H	α-helix	trans	-61.7	-43.2	177	-69.4	173.7	0	0	0	111.9	R41 S42 G47 Q48 A49	R41-L45 WeakPolarHBondContact O-CG 3.35Å; R41-L45 PolarHBondContact O-N 3.29Å; R41-L45 VanDerWaalsContact O-N 3.16Å; S42-L45 PolarHBondContact O-N 3.38Å; L45-G47 VanDerWaalsContact C-N 3.33Å; L45-G47 PolarHBondContact O-N 3.47Å; L45-Q48 PolarHBondContact O-N 3.47Å; L45-A49 WeakPolarHBondContact O-CB 3.39Å; L45-A49 PolarHBondContact O-N 3.07Å
46	L	97.8	Very high	96.5	Very high	115 Å²	115	100.5 Å²	100.5	60%	0.602	53%	0.53	S	S	*	.	H	α-helix	trans	-62.3	-41.6	175.3	-75.1	169.1	0	0	0	111.4	S42 Q43 E44 Q48 A49 A50	S42-L46 WeakPolarHBondContact O-CB 3.45Å; S42-L46 VanDerWaalsContact O-CG 3.3Å; S42-L46 WeakPolarHBondContact O-CG 3.3Å; S42-L46 PolarHBondContact O-N 3.39Å; Q43-L46 PolarHBondContact O-N 2.96Å; E44-L46 PolarHBondContact O-N 3.06Å; L46-Q48 VanDerWaalsContact C-N 3.33Å; L46-Q48 PolarHBondContact O-N 3.3Å; L46-A49 PolarHBondContact O-N 3.46Å; L46-A50 WeakPolarHBondContact O-CB 3.44Å; L46-A50 PolarHBondContact O-N 2.93Å
47	G	97.3	Very high	96.4	Very high	27 Å²	27	102.1 Å²	102.1	28%	0.278	53%	0.532	S	S	.	.	H	α-helix	trans	-61.7	-40.6	175	0	0	0	0	0	112.5	Q43 E44 L45 R51	Q43-G47 PolarHBondContact O-N 3.18Å; E44-G47 PolarHBondContact O-N 2.91Å; L45-G47 VanDerWaalsContact C-N 3.33Å; L45-G47 PolarHBondContact O-N 3.47Å; G47-R51 WeakPolarHBondContact O-CG 3.35Å; G47-R51 PolarHBondContact O-N 3.14Å; G47-R51 VanDerWaalsContact O-N 3.14Å; G47-R51 PolarHBondContact O-NH1 3.27Å
48	Q	97.6	Very high	96.2	Very high	85 Å²	85	101.2 Å²	101.2	40%	0.397	53%	0.527	S	S	.	.	H	α-helix	trans	-67.8	-42.7	174.9	-173.2	61.2	43.9	0	0	112	E44 L45 L46 A50 R51 N52	E44-Q48 PolarHBondContact O-N 3.31Å; L45-Q48 PolarHBondContact O-N 3.47Å; L46-Q48 VanDerWaalsContact C-N 3.33Å; L46-Q48 PolarHBondContact O-N 3.3Å; Q48-A50 VanDerWaalsContact C-N 3.34Å; Q48-A50 PolarHBondContact O-N 3.48Å; Q48-R51 PolarHBondContact O-N 2.9Å; Q48-N52 PolarHBondContact NE2-OD1 3.21Å; Q48-N52 VanDerWaalsContact O-CG 3.27Å; Q48-N52 PolarHBondContact O-N 2.93Å; Q48-N52 PolarHBondContact O-OD1 3.35Å
49	A	97.3	Very high	96.2	Very high	46 Å²	46	96.2 Å²	96.2	38%	0.38	52%	0.515	S	S	.	.	H	α-helix	trans	-60.1	-44.9	177	0	0	0	0	0	111.3	L45 L46 R51 N52 M53	L45-A49 WeakPolarHBondContact O-CB 3.39Å; L45-A49 PolarHBondContact O-N 3.07Å; L46-A49 PolarHBondContact O-N 3.46Å; A49-R51 PolarHBondContact O-N 2.86Å; A49-N52 PolarHBondContact O-N 3.5Å; A49-M53 WeakPolarHBondContact O-CG 3.43Å; A49-M53 PolarHBondContact O-N 3.23Å
50	A	97	Very high	96.2	Very high	53 Å²	53	99.3 Å²	99.3	44%	0.438	52%	0.522	S	S	.	.	H	α-helix	trans	-59.2	-45.9	175.8	0	0	0	0	0	112	L46 Q48 N52 M53 V54	L46-A50 WeakPolarHBondContact O-CB 3.44Å; L46-A50 PolarHBondContact O-N 2.93Å; Q48-A50 VanDerWaalsContact C-N 3.34Å; Q48-A50 PolarHBondContact O-N 3.48Å; A50-N52 PolarHBondContact O-N 3.46Å; A50-M53 PolarHBondContact O-N 3.28Å; A50-V54 WeakPolarHBondContact O-CG2 3.5Å; A50-V54 PolarHBondContact O-N 2.97Å
51	R	96.5	Very high	96.2	Very high	134 Å²	134	101 Å²	101	51%	0.506	53%	0.526	S	S	.	.	H	α-helix	trans	-59.6	-44.9	175.1	-73.9	-171.9	-65.9	-90.2	6.1	112.2	G47 Q48 A49 M53 V54 I55	G47-R51 WeakPolarHBondContact O-CG 3.35Å; G47-R51 PolarHBondContact O-N 3.14Å; G47-R51 VanDerWaalsContact O-N 3.14Å; G47-R51 PolarHBondContact O-NH1 3.27Å; Q48-R51 PolarHBondContact O-N 2.9Å; A49-R51 PolarHBondContact O-N 2.86Å; R51-M53 VanDerWaalsContact C-N 3.34Å; R51-M53 PolarHBondContact O-N 3.37Å; R51-V54 PolarHBondContact O-N 3.43Å; R51-I55 WeakPolarHBondContact O-CG1 3.46Å; R51-I55 PolarHBondContact O-N 2.82Å; R51-I55 VanDerWaalsContact O-N 3.07Å
52	N	96.5	Very high	96.3	Very high	81 Å²	81	97.8 Å²	97.8	43%	0.433	52%	0.518	S	S	.	.	H	α-helix	trans	-62.4	-41.9	178.5	-70	-2.8	0	0	0	111.6	Q48 A49 A50 I55 Q56	Q48-N52 PolarHBondContact NE2-OD1 3.21Å; Q48-N52 VanDerWaalsContact O-CG 3.27Å; Q48-N52 PolarHBondContact O-N 2.93Å; Q48-N52 PolarHBondContact O-OD1 3.35Å; A49-N52 PolarHBondContact O-N 3.5Å; A50-N52 PolarHBondContact O-N 3.46Å; N52-I55 PolarHBondContact O-N 3.01Å; N52-Q56 WeakPolarHBondContact O-CB 3.44Å; N52-Q56 PolarHBondContact O-N 3.26Å
53	M	95.7	Very high	96.3	Very high	135 Å²	135	98.2 Å²	98.2	67%	0.665	52%	0.521	S	S	*	.	H	α-helix	trans	-63.8	-41.8	178.6	-73	-178.7	70.1	0	0	112.2	A49 A50 R51 Q56 E57	A49-M53 WeakPolarHBondContact O-CG 3.43Å; A49-M53 PolarHBondContact O-N 3.23Å; A50-M53 PolarHBondContact O-N 3.28Å; R51-M53 VanDerWaalsContact C-N 3.34Å; R51-M53 PolarHBondContact O-N 3.37Å; M53-Q56 PolarHBondContact O-N 3.48Å; M53-E57 PolarHBondContact O-N 3.45Å
54	V	94	Very high	96.4	Very high	96 Å²	96	95.7 Å²	95.7	58%	0.582	51%	0.509	S	S	*	.	H	α-helix	trans	-63.1	-44	175.8	172.1	0	0	0	0	111.2	A50 R51 Q56 E57	A50-V54 WeakPolarHBondContact O-CG2 3.5Å; A50-V54 PolarHBondContact O-N 2.97Å; R51-V54 PolarHBondContact O-N 3.43Å; V54-Q56 VanDerWaalsContact C-N 3.26Å; V54-Q56 PolarHBondContact O-N 3.16Å; V54-E57 WeakPolarHBondContact O-CB 3.42Å; V54-E57 PolarHBondContact O-N 2.98Å
55	I	93	Very high	96.4	Very high	124 Å²	124	91.8 Å²	91.8	64%	0.636	49%	0.493	S	S	*	.	H	α-helix	trans	-63.8	-35.9	176.7	-66.7	165.8	0	0	0	110.9	R51 N52 E57	R51-I55 WeakPolarHBondContact O-CG1 3.46Å; R51-I55 PolarHBondContact O-N 2.82Å; R51-I55 VanDerWaalsContact O-N 3.07Å; N52-I55 PolarHBondContact O-N 3.01Å; I55-E57 VanDerWaalsContact C-N 3.32Å; I55-E57 PolarHBondContact O-N 3.05Å
56	Q	96.8	Very high	96.5	Very high	120 Å²	120	89.5 Å²	89.5	56%	0.561	49%	0.486	S	S	*	.	H	α-helix	trans	-72.7	-24.5	-179.6	-168.2	168.8	9.1	0	0	113.1	N52 M53 V54 D58 A59 I60	N52-Q56 WeakPolarHBondContact O-CB 3.44Å; N52-Q56 PolarHBondContact O-N 3.26Å; M53-Q56 PolarHBondContact O-N 3.48Å; V54-Q56 VanDerWaalsContact C-N 3.26Å; V54-Q56 PolarHBondContact O-N 3.16Å; Q56-D58 VanDerWaalsContact C-N 3.35Å; Q56-D58 PolarHBondContact O-N 3.31Å; Q56-A59 PolarHBondContact O-N 3.44Å; Q56-I60 HydrophobicContact CG-CD1 4.2Å; Q56-I60 HydrophobicContact CG-CG1 4.45Å; Q56-I60 WeakPolarHBondContact O-CG1 3.34Å; Q56-I60 PolarHBondContact O-N 3.14Å
57	E	96.1	Very high	96.5	Very high	119 Å²	119	89.3 Å²	89.3	56%	0.556	49%	0.485	S	S	*	.	H	α-helix	trans	-57.5	-45.5	177.7	-173.7	172.8	-154.1	0	0	112.1	M53 V54 I55 A59 I60 L61	M53-E57 PolarHBondContact O-N 3.45Å; V54-E57 WeakPolarHBondContact O-CB 3.42Å; V54-E57 PolarHBondContact O-N 2.98Å; I55-E57 VanDerWaalsContact C-N 3.32Å; I55-E57 PolarHBondContact O-N 3.05Å; E57-A59 PolarHBondContact O-N 3.5Å; E57-I60 WeakPolarHBondContact O-CB 3.33Å; E57-I60 PolarHBondContact O-N 3.06Å; E57-I60 VanDerWaalsContact O-N 3.14Å; E57-L61 WeakPolarHBondContact O-CG 3.32Å; E57-L61 PolarHBondContact O-N 3.36Å
58	D	92.2	Very high	96.6	Very high	96 Å²	96	94.4 Å²	94.4	51%	0.513	50%	0.496	S	S	.	.	H	α-helix	trans	-62.3	-43.3	179	-174.2	68	0	0	0	112.1	Q56 I60 L61 H62	Q56-D58 VanDerWaalsContact C-N 3.35Å; Q56-D58 PolarHBondContact O-N 3.31Å; D58-I60 VanDerWaalsContact C-N 3.28Å; D58-I60 PolarHBondContact O-N 3.23Å; D58-L61 PolarHBondContact O-N 3.3Å; D58-H62 PolarHBondContact O-CD2 3.42Å; D58-H62 VanDerWaalsContact O-CD2 3.3Å; D58-H62 PolarHBondContact O-N 2.92Å; D58-H62 IonicContact OD1-CD2 3.43Å; D58-H62 IonicContact OD1-NE2 2.77Å; D58-H62 IonicContact OD2-CD2 3.79Å; D58-H62 PolarHBondContact OD2-CD2 3.31Å; D58-H62 IonicContact OD2-NE2 3.7Å
59	A	95.6	Very high	96.6	Very high	52 Å²	52	96 Å²	96	43%	0.43	50%	0.501	S	S	.	.	H	α-helix	trans	-62.9	-34.4	175.7	0	0	0	0	0	112.6	Q56 E57 S63	Q56-A59 PolarHBondContact O-N 3.44Å; E57-A59 PolarHBondContact O-N 3.5Å; A59-S63 WeakPolarHBondContact O-CB 3.25Å; A59-S63 PolarHBondContact O-N 3.1Å; A59-S63 PolarHBondContact O-OG 3.25Å
60	I	97.1	Very high	96.7	Very high	104 Å²	104	99 Å²	99	53%	0.533	51%	0.509	S	S	.	.	H	α-helix	trans	-67.2	-47.7	175.6	-69.4	166.1	0	0	0	110.2	Q56 E57 D58 H62 S63 E64	Q56-I60 HydrophobicContact CG-CD1 4.2Å; Q56-I60 HydrophobicContact CG-CG1 4.45Å; Q56-I60 WeakPolarHBondContact O-CG1 3.34Å; Q56-I60 PolarHBondContact O-N 3.14Å; E57-I60 WeakPolarHBondContact O-CB 3.33Å; E57-I60 PolarHBondContact O-N 3.06Å; E57-I60 VanDerWaalsContact O-N 3.14Å; D58-I60 VanDerWaalsContact C-N 3.28Å; D58-I60 PolarHBondContact O-N 3.23Å; I60-H62 VanDerWaalsContact C-N 3.34Å; I60-H62 PolarHBondContact O-N 2.77Å; I60-S63 WeakPolarHBondContact O-CB 3.46Å; I60-S63 PolarHBondContact O-N 2.66Å; I60-S63 VanDerWaalsContact O-N 3.17Å; I60-E64 PolarHBondContact O-N 3.48Å
61	L	96.6	Very high	96.7	Very high	98 Å²	98	100 Å²	100	51%	0.513	51%	0.513	S	S	.	.	H	α-helix	trans	-60.6	-43.2	178.6	-68.1	173.4	0	0	0	111.8	E57 D58 S63 E64 D65	E57-L61 WeakPolarHBondContact O-CG 3.32Å; E57-L61 PolarHBondContact O-N 3.36Å; D58-L61 PolarHBondContact O-N 3.3Å; L61-S63 VanDerWaalsContact C-N 3.34Å; L61-S63 PolarHBondContact O-N 3.04Å; L61-E64 WeakPolarHBondContact O-CB 3.34Å; L61-E64 PolarHBondContact O-N 3.5Å; L61-D65 PolarHBondContact O-N 3.13Å; L61-D65 VanDerWaalsContact O-N 3.13Å
62	H	97	Very high	96.8	Very high	113 Å²	113	98.1 Å²	98.1	52%	0.523	51%	0.512	S	S	.	.	H	α-helix	trans	-65.2	-36.6	175.3	-80.5	-54.3	0	0	0	113.3	D58 I60 E64 D65 S66	D58-H62 PolarHBondContact O-CD2 3.42Å; D58-H62 VanDerWaalsContact O-CD2 3.3Å; D58-H62 PolarHBondContact O-N 2.92Å; D58-H62 IonicContact OD1-CD2 3.43Å; D58-H62 IonicContact OD1-NE2 2.77Å; D58-H62 IonicContact OD2-CD2 3.79Å; D58-H62 PolarHBondContact OD2-CD2 3.31Å; D58-H62 IonicContact OD2-NE2 3.7Å; I60-H62 VanDerWaalsContact C-N 3.34Å; I60-H62 PolarHBondContact O-N 2.77Å; H62-E64 VanDerWaalsContact C-N 3.34Å; H62-D65 PolarHBondContact O-N 3.28Å; H62-S66 PolarHBondContact O-N 2.94Å; H62-S66 VanDerWaalsContact O-N 3.1Å; H62-S66 PolarHBondContact O-OG 3.43Å
63	S	97.9	Very high	96.9	Very high	69 Å²	69	99 Å²	99	48%	0.483	52%	0.515	S	S	.	.	H	α-helix	trans	-65.9	-39.2	174.9	-61.3	0	0	0	0	111.2	A59 I60 L61 S66 L67	A59-S63 WeakPolarHBondContact O-CB 3.25Å; A59-S63 PolarHBondContact O-N 3.1Å; A59-S63 PolarHBondContact O-OG 3.25Å; I60-S63 WeakPolarHBondContact O-CB 3.46Å; I60-S63 PolarHBondContact O-N 2.66Å; I60-S63 VanDerWaalsContact O-N 3.17Å; L61-S63 VanDerWaalsContact C-N 3.34Å; L61-S63 PolarHBondContact O-N 3.04Å; S63-S66 PolarHBondContact O-N 2.97Å; S63-L67 WeakPolarHBondContact O-CG 3.5Å; S63-L67 PolarHBondContact O-N 3.35Å
64	E	98	Very high	97.1	Very high	90 Å²	90	96 Å²	96	42%	0.421	51%	0.505	S	S	.	.	H	α-helix	trans	-61.6	-46.2	176	-166.2	-157.5	142.9	0	0	111.9	I60 L61 H62 S66 L67 R68	I60-E64 PolarHBondContact O-N 3.48Å; L61-E64 WeakPolarHBondContact O-CB 3.34Å; L61-E64 PolarHBondContact O-N 3.5Å; H62-E64 VanDerWaalsContact C-N 3.34Å; E64-S66 VanDerWaalsContact C-N 3.31Å; E64-S66 PolarHBondContact O-N 3.44Å; E64-L67 PolarHBondContact O-N 2.72Å; E64-R68 PolarHBondContact O-N 3.27Å; E64-R68 IonicContact OE1-CZ 3.62Å; E64-R68 IonicContact OE1-NH1 3.54Å; E64-R68 PolarHBondContact OE1-NH1 2.94Å; E64-R68 IonicContact OE1-NH2 3.36Å; E64-R68 PolarHBondContact OE1-NH2 3.32Å
65	D	97.9	Very high	97.3	Very high	60 Å²	60	94 Å²	94	32%	0.321	49%	0.493	S	S	.	.	H	α-helix	trans	-60.7	-41.4	176.1	-178.4	58.6	0	0	0	112.1	L61 H62 L67 R68 K69	L61-D65 PolarHBondContact O-N 3.13Å; L61-D65 VanDerWaalsContact O-N 3.13Å; H62-D65 PolarHBondContact O-N 3.28Å; D65-L67 PolarHBondContact O-N 2.92Å; D65-R68 WeakPolarHBondContact O-CB 3.41Å; D65-R68 PolarHBondContact O-N 3.48Å; D65-K69 PolarHBondContact O-N 3.01Å; D65-K69 VanDerWaalsContact OD2-CE 3.25Å; D65-K69 WeakPolarHBondContact OD2-CE 3.35Å; D65-K69 IonicContact OD2-NZ 2.66Å; D65-K69 PolarHBondContact OD2-NZ 3.17Å
66	S	98.3	Very high	97.6	Very high	62 Å²	62	93.1 Å²	93.1	43%	0.434	49%	0.486	S	S	.	.	H	α-helix	trans	-62	-43	175.6	-59.1	0	0	0	0	111.7	H62 S63 E64 R68 K69 M70	H62-S66 PolarHBondContact O-N 2.94Å; H62-S66 VanDerWaalsContact O-N 3.1Å; H62-S66 PolarHBondContact O-OG 3.43Å; S63-S66 PolarHBondContact O-N 2.97Å; E64-S66 VanDerWaalsContact C-N 3.31Å; E64-S66 PolarHBondContact O-N 3.44Å; S66-R68 PolarHBondContact O-N 3.1Å; S66-K69 PolarHBondContact O-N 3.49Å; S66-M70 WeakPolarHBondContact O-CG 3.46Å; S66-M70 PolarHBondContact O-N 3.22Å
67	L	98.5	Very high	97.7	Very high	112 Å²	112	92 Å²	92	59%	0.586	48%	0.484	S	S	*	.	H	α-helix	trans	-64.4	-38.2	175.6	-73.1	172.9	0	0	0	112.3	S63 E64 D65 M70 S71	S63-L67 WeakPolarHBondContact O-CG 3.5Å; S63-L67 PolarHBondContact O-N 3.35Å; E64-L67 PolarHBondContact O-N 2.72Å; D65-L67 PolarHBondContact O-N 2.92Å; L67-M70 HydrophobicContact CD2-SD 4.37Å; L67-M70 PolarHBondContact O-N 2.93Å; L67-S71 PolarHBondContact O-N 3.35Å
68	R	98.5	Very high	97.8	Very high	134 Å²	134	91.3 Å²	91.3	51%	0.506	48%	0.48	S	S	.	.	H	α-helix	trans	-61.6	-44.5	175.2	-173.8	178.9	-77.3	104.4	2.6	111.2	E64 D65 S66 S71 I72	E64-R68 PolarHBondContact O-N 3.27Å; E64-R68 IonicContact OE1-CZ 3.62Å; E64-R68 IonicContact OE1-NH1 3.54Å; E64-R68 PolarHBondContact OE1-NH1 2.94Å; E64-R68 IonicContact OE1-NH2 3.36Å; E64-R68 PolarHBondContact OE1-NH2 3.32Å; D65-R68 WeakPolarHBondContact O-CB 3.41Å; D65-R68 PolarHBondContact O-N 3.48Å; S66-R68 PolarHBondContact O-N 3.1Å; R68-S71 PolarHBondContact O-N 3.48Å; R68-I72 PolarHBondContact O-N 3.25Å
69	K	98.5	Very high	98.1	Very high	117 Å²	117	93.9 Å²	93.9	51%	0.509	48%	0.484	S	S	.	.	H	α-helix	trans	-61.6	-43.6	173.7	-71.3	165.9	177.4	159.7	0	111.8	D65 S66 S71 I72 I73	D65-K69 PolarHBondContact O-N 3.01Å; D65-K69 VanDerWaalsContact OD2-CE 3.25Å; D65-K69 WeakPolarHBondContact OD2-CE 3.35Å; D65-K69 IonicContact OD2-NZ 2.66Å; D65-K69 PolarHBondContact OD2-NZ 3.17Å; S66-K69 PolarHBondContact O-N 3.49Å; K69-S71 PolarHBondContact O-N 2.93Å; K69-I72 PolarHBondContact O-N 3.14Å; K69-I73 WeakPolarHBondContact O-CG1 3.34Å; K69-I73 PolarHBondContact O-N 2.85Å; K69-I73 VanDerWaalsContact O-N 3.1Å
70	M	98.6	Very high	98.2	Very high	111 Å²	111	96.9 Å²	96.9	55%	0.547	49%	0.489	S	S	.	.	H	α-helix	trans	-61.9	-42	176.8	-73	176.4	65.9	0	0	112.1	S66 L67 I72 I73 T74	S66-M70 WeakPolarHBondContact O-CG 3.46Å; S66-M70 PolarHBondContact O-N 3.22Å; L67-M70 HydrophobicContact CD2-SD 4.37Å; L67-M70 PolarHBondContact O-N 2.93Å; M70-I72 VanDerWaalsContact C-N 3.28Å; M70-I72 PolarHBondContact O-N 3.13Å; M70-I73 PolarHBondContact O-N 2.84Å; M70-I73 VanDerWaalsContact O-N 3.13Å; M70-T74 PolarHBondContact O-N 3.34Å; M70-T74 PolarHBondContact O-OG1 3.3Å; M70-T74 VanDerWaalsContact O-OG1 3.09Å
71	S	98.5	Very high	98.3	Very high	74 Å²	74	98.3 Å²	98.3	52%	0.517	49%	0.493	S	S	.	.	H	α-helix	trans	-58.6	-41	177.6	-176.9	0	0	0	0	111.8	L67 R68 K69 T74 T75	L67-S71 PolarHBondContact O-N 3.35Å; R68-S71 PolarHBondContact O-N 3.48Å; K69-S71 PolarHBondContact O-N 2.93Å; S71-T74 PolarHBondContact O-N 3.22Å; S71-T75 PolarHBondContact O-N 3.1Å; S71-T75 VanDerWaalsContact O-N 3.1Å; S71-T75 PolarHBondContact O-OG1 3.41Å
72	I	98.4	Very high	98.4	Very high	93 Å²	93	98.8 Å²	98.8	48%	0.477	49%	0.493	S	S	.	.	H	α-helix	trans	-63.9	-46.7	175.8	-66	165.8	0	0	0	110.4	R68 K69 M70 T74 T75 H76	R68-I72 PolarHBondContact O-N 3.25Å; K69-I72 PolarHBondContact O-N 3.14Å; M70-I72 VanDerWaalsContact C-N 3.28Å; M70-I72 PolarHBondContact O-N 3.13Å; I72-T74 VanDerWaalsContact C-N 3.31Å; I72-T74 PolarHBondContact O-N 3.41Å; I72-T75 WeakPolarHBondContact O-CB 3.17Å; I72-T75 PolarHBondContact O-N 3.47Å; I72-H76 PolarHBondContact O-CD2 2.93Å; I72-H76 PolarHBondContact O-N 3.29Å
73	I	98.6	Very high	98.5	Very high	99 Å²	99	95.7 Å²	95.7	51%	0.508	49%	0.486	S	S	.	.	H	α-helix	trans	-58.8	-44.5	177.4	-67.5	167.3	0	0	0	110.6	K69 M70 T75 H76 L77	K69-I73 WeakPolarHBondContact O-CG1 3.34Å; K69-I73 PolarHBondContact O-N 2.85Å; K69-I73 VanDerWaalsContact O-N 3.1Å; M70-I73 PolarHBondContact O-N 2.84Å; M70-I73 VanDerWaalsContact O-N 3.13Å; I73-T75 VanDerWaalsContact C-N 3.33Å; I73-T75 PolarHBondContact O-N 3.19Å; I73-H76 PolarHBondContact O-N 3.41Å; I73-L77 HydrophobicContact CG2-CD1 3.94Å; I73-L77 HydrophobicContact CG2-CG 4.28Å; I73-L77 WeakPolarHBondContact O-CG 3.5Å; I73-L77 PolarHBondContact O-N 3.47Å
74	T	98.7	Very high	98.5	Very high	72 Å²	72	97.3 Å²	97.3	44%	0.442	49%	0.489	S	S	.	.	H	α-helix	trans	-57.4	-45.6	176.6	-61.1	0	0	0	0	111.6	M70 S71 I72 H76 L77 Q78	M70-T74 PolarHBondContact O-N 3.34Å; M70-T74 PolarHBondContact O-OG1 3.3Å; M70-T74 VanDerWaalsContact O-OG1 3.09Å; S71-T74 PolarHBondContact O-N 3.22Å; I72-T74 VanDerWaalsContact C-N 3.31Å; I72-T74 PolarHBondContact O-N 3.41Å; T74-H76 PolarHBondContact O-N 3.19Å; T74-L77 PolarHBondContact O-N 2.96Å; T74-Q78 WeakPolarHBondContact O-CG 3.36Å; T74-Q78 PolarHBondContact O-N 3.09Å
75	T	98.6	Very high	98.5	Very high	55 Å²	55	99 Å²	99	34%	0.337	50%	0.497	S	S	.	.	H	α-helix	trans	-61.2	-43.4	176.4	-62.7	0	0	0	0	112	S71 I72 I73 L77 Q78 Y79	S71-T75 PolarHBondContact O-N 3.1Å; S71-T75 VanDerWaalsContact O-N 3.1Å; S71-T75 PolarHBondContact O-OG1 3.41Å; I72-T75 WeakPolarHBondContact O-CB 3.17Å; I72-T75 PolarHBondContact O-N 3.47Å; I73-T75 VanDerWaalsContact C-N 3.33Å; I73-T75 PolarHBondContact O-N 3.19Å; T75-L77 PolarHBondContact O-N 3.01Å; T75-Q78 WeakPolarHBondContact O-CB 3.49Å; T75-Q78 PolarHBondContact O-N 3.03Å; T75-Y79 HydrophobicContact CG2-CD2 3.78Å; T75-Y79 HydrophobicContact CG2-CE2 3.41Å; T75-Y79 VanDerWaalsContact CG2-CE2 3.41Å; T75-Y79 WeakPolarHBondContact O-CD2 3.49Å; T75-Y79 PolarHBondContact O-N 3.47Å
76	H	98.8	Very high	98.5	Very high	106 Å²	106	102.5 Å²	102.5	49%	0.491	51%	0.509	S	S	.	.	H	α-helix	trans	-63.3	-41.3	175.9	-76.1	-69	0	0	0	112.7	I72 I73 T74 Q78 Y79 Q80	I72-H76 PolarHBondContact O-CD2 2.93Å; I72-H76 PolarHBondContact O-N 3.29Å; I73-H76 PolarHBondContact O-N 3.41Å; T74-H76 PolarHBondContact O-N 3.19Å; H76-Q78 VanDerWaalsContact C-N 3.31Å; H76-Q78 PolarHBondContact O-N 3.27Å; H76-Y79 PolarHBondContact O-N 2.96Å; H76-Q80 VanDerWaalsContact O-CG 3.3Å; H76-Q80 WeakPolarHBondContact O-CG 3.26Å; H76-Q80 PolarHBondContact O-N 2.9Å
77	L	98.7	Very high	98.5	Very high	97 Å²	97	104.7 Å²	104.7	51%	0.508	52%	0.516	S	S	.	.	H	α-helix	trans	-63.1	-38.6	176.6	-71.3	173.6	0	0	0	111.6	I73 T74 T75 Q80 Q81	I73-L77 HydrophobicContact CG2-CD1 3.94Å; I73-L77 HydrophobicContact CG2-CG 4.28Å; I73-L77 WeakPolarHBondContact O-CG 3.5Å; I73-L77 PolarHBondContact O-N 3.47Å; T74-L77 PolarHBondContact O-N 2.96Å; T75-L77 PolarHBondContact O-N 3.01Å; L77-Q80 PolarHBondContact O-N 2.94Å; L77-Q81 WeakPolarHBondContact O-CB 3.34Å; L77-Q81 PolarHBondContact O-N 3.37Å
78	Q	98.6	Very high	98.5	Very high	103 Å²	103	102.6 Å²	102.6	48%	0.481	51%	0.507	S	S	.	.	H	α-helix	trans	-62	-48.9	174.1	-73.7	172.5	-26	0	0	111.6	T74 T75 H76 Q80 Q81 E82	T74-Q78 WeakPolarHBondContact O-CG 3.36Å; T74-Q78 PolarHBondContact O-N 3.09Å; T75-Q78 WeakPolarHBondContact O-CB 3.49Å; T75-Q78 PolarHBondContact O-N 3.03Å; H76-Q78 VanDerWaalsContact C-N 3.31Å; H76-Q78 PolarHBondContact O-N 3.27Å; Q78-Q80 VanDerWaalsContact C-N 3.3Å; Q78-Q80 PolarHBondContact O-N 3.06Å; Q78-Q81 PolarHBondContact O-N 3.47Å; Q78-E82 WeakPolarHBondContact O-CG 3.3Å; Q78-E82 PolarHBondContact O-N 3.33Å
79	Y	98.6	Very high	98.4	Very high	151 Å²	151	101.9 Å²	101.9	59%	0.592	51%	0.51	S	S	*	.	H	α-helix	trans	-58.3	-42.6	175.7	-77.7	-59	0	0	0	112.4	T75 H76 E82 A83	T75-Y79 HydrophobicContact CG2-CD2 3.78Å; T75-Y79 HydrophobicContact CG2-CE2 3.41Å; T75-Y79 VanDerWaalsContact CG2-CE2 3.41Å; T75-Y79 WeakPolarHBondContact O-CD2 3.49Å; T75-Y79 PolarHBondContact O-N 3.47Å; H76-Y79 PolarHBondContact O-N 2.96Å; Y79-E82 PolarHBondContact O-N 3.2Å; Y79-A83 PolarHBondContact O-N 3.36Å
80	Q	98.6	Very high	98.4	Very high	115 Å²	115	101.7 Å²	101.7	54%	0.537	51%	0.51	S	S	.	.	H	α-helix	trans	-65	-42.6	177.4	-72.4	176.4	18.4	0	0	111.7	H76 L77 Q78 E82 A83 I84	H76-Q80 VanDerWaalsContact O-CG 3.3Å; H76-Q80 WeakPolarHBondContact O-CG 3.26Å; H76-Q80 PolarHBondContact O-N 2.9Å; L77-Q80 PolarHBondContact O-N 2.94Å; Q78-Q80 VanDerWaalsContact C-N 3.3Å; Q78-Q80 PolarHBondContact O-N 3.06Å; Q80-E82 PolarHBondContact O-N 3.28Å; Q80-A83 PolarHBondContact O-N 3.35Å; Q80-I84 VanDerWaalsContact O-CG1 3.26Å; Q80-I84 WeakPolarHBondContact O-CG1 3.37Å; Q80-I84 PolarHBondContact O-N 2.86Å
81	Q	98.4	Very high	98.3	Very high	134 Å²	134	99.8 Å²	99.8	63%	0.626	51%	0.508	S	S	*	.	H	α-helix	trans	-60.6	-45.2	176.8	-179.1	179.7	-9.6	0	0	111.6	L77 Q78 A83 I84 Q85	L77-Q81 WeakPolarHBondContact O-CB 3.34Å; L77-Q81 PolarHBondContact O-N 3.37Å; Q78-Q81 PolarHBondContact O-N 3.47Å; Q81-A83 VanDerWaalsContact C-N 3.35Å; Q81-A83 PolarHBondContact O-N 3.49Å; Q81-I84 PolarHBondContact O-N 2.91Å; Q81-Q85 WeakPolarHBondContact O-CB 3.41Å; Q81-Q85 PolarHBondContact O-N 3.34Å
82	E	98.5	Very high	98.2	Very high	108 Å²	108	102.2 Å²	102.2	51%	0.505	51%	0.51	S	S	.	.	H	α-helix	trans	-61.7	-42	176.3	-73	-179.4	-167.3	0	0	112.2	Q78 Y79 Q80 Q85 K86	Q78-E82 WeakPolarHBondContact O-CG 3.3Å; Q78-E82 PolarHBondContact O-N 3.33Å; Y79-E82 PolarHBondContact O-N 3.2Å; Q80-E82 PolarHBondContact O-N 3.28Å; E82-Q85 PolarHBondContact O-N 3.48Å; E82-K86 WeakPolarHBondContact O-CG 3.45Å; E82-K86 PolarHBondContact O-N 3.03Å
83	A	98.4	Very high	98.1	Very high	47 Å²	47	101.5 Å²	101.5	39%	0.388	51%	0.507	S	S	.	.	H	α-helix	trans	-63.5	-43.4	177.5	0	0	0	0	0	111.5	Y79 Q80 Q81 K86 N87	Y79-A83 PolarHBondContact O-N 3.36Å; Q80-A83 PolarHBondContact O-N 3.35Å; Q81-A83 VanDerWaalsContact C-N 3.35Å; Q81-A83 PolarHBondContact O-N 3.49Å; A83-K86 PolarHBondContact O-N 3.05Å; A83-N87 VanDerWaalsContact O-CG 3.26Å; A83-N87 PolarHBondContact O-N 3.48Å; A83-N87 PolarHBondContact O-ND2 3.43Å
84	I	98.5	Very high	98	Very high	104 Å²	104	100.4 Å²	100.4	53%	0.533	50%	0.501	S	S	.	.	H	α-helix	trans	-61.3	-46.1	175.4	-69.3	165.2	0	0	0	110.5	Q80 Q81 K86 N87 V88	Q80-I84 VanDerWaalsContact O-CG1 3.26Å; Q80-I84 WeakPolarHBondContact O-CG1 3.37Å; Q80-I84 PolarHBondContact O-N 2.86Å; Q81-I84 PolarHBondContact O-N 2.91Å; I84-K86 PolarHBondContact O-N 2.9Å; I84-N87 PolarHBondContact O-N 2.95Å; I84-N87 VanDerWaalsContact O-N 3.16Å; I84-V88 HydrophobicContact CG2-CG2 4.43Å; I84-V88 WeakPolarHBondContact O-CG2 3.4Å; I84-V88 PolarHBondContact O-N 3.16Å
85	Q	98.3	Very high	97.9	Very high	125 Å²	125	101.6 Å²	101.6	58%	0.584	50%	0.502	S	S	*	.	H	α-helix	trans	-58.3	-46.8	179.5	-169.5	74.2	23.5	0	0	111.6	Q81 E82 N87 V88 E89	Q81-Q85 WeakPolarHBondContact O-CB 3.41Å; Q81-Q85 PolarHBondContact O-N 3.34Å; E82-Q85 PolarHBondContact O-N 3.48Å; Q85-N87 VanDerWaalsContact C-N 3.33Å; Q85-N87 PolarHBondContact O-N 3.42Å; Q85-V88 PolarHBondContact O-N 2.8Å; Q85-E89 PolarHBondContact O-N 2.93Å; Q85-E89 VanDerWaalsContact O-N 3.08Å
86	K	98.2	Very high	97.8	Very high	134 Å²	134	103.5 Å²	103.5	58%	0.583	51%	0.51	S	S	*	.	H	α-helix	trans	-59.9	-42.6	176.1	-73.5	176.1	-177.6	172.6	0	111.9	E82 A83 I84 V88 E89 H90	E82-K86 WeakPolarHBondContact O-CG 3.45Å; E82-K86 PolarHBondContact O-N 3.03Å; A83-K86 PolarHBondContact O-N 3.05Å; I84-K86 PolarHBondContact O-N 2.9Å; K86-V88 PolarHBondContact O-N 3.36Å; K86-E89 PolarHBondContact O-N 3.5Å; K86-H90 WeakPolarHBondContact O-CB 3.36Å; K86-H90 PolarHBondContact O-N 3.44Å
87	N	97.8	Very high	97.6	Very high	107 Å²	107	104.1 Å²	104.1	57%	0.572	51%	0.513	S	S	*	.	H	α-helix	trans	-66.1	-37.6	179.2	-71.8	-12.8	0	0	0	112.6	A83 I84 Q85 S91	A83-N87 VanDerWaalsContact O-CG 3.26Å; A83-N87 PolarHBondContact O-N 3.48Å; A83-N87 PolarHBondContact O-ND2 3.43Å; I84-N87 PolarHBondContact O-N 2.95Å; I84-N87 VanDerWaalsContact O-N 3.16Å; Q85-N87 VanDerWaalsContact C-N 3.33Å; Q85-N87 PolarHBondContact O-N 3.42Å; N87-S91 WeakPolarHBondContact O-CB 3.48Å; N87-S91 PolarHBondContact O-N 3.48Å; N87-S91 PolarHBondContact O-OG 3.38Å
88	V	97.9	Very high	97.5	Very high	68 Å²	68	104.4 Å²	104.4	41%	0.412	52%	0.515	S	S	.	.	H	α-helix	trans	-63.6	-45.6	174.9	169.5	0	0	0	0	110.9	I84 Q85 K86 S91 K92	I84-V88 HydrophobicContact CG2-CG2 4.43Å; I84-V88 WeakPolarHBondContact O-CG2 3.4Å; I84-V88 PolarHBondContact O-N 3.16Å; Q85-V88 PolarHBondContact O-N 2.8Å; K86-V88 PolarHBondContact O-N 3.36Å; V88-S91 PolarHBondContact O-N 3.06Å; V88-K92 WeakPolarHBondContact O-CG 3.43Å; V88-K92 PolarHBondContact O-N 3.4Å; V88-K92 VanDerWaalsContact O-N 3.1Å
89	E	97.3	Very high	97.4	Very high	119 Å²	119	106.6 Å²	106.6	56%	0.556	52%	0.518	S	S	*	.	H	α-helix	trans	-63.3	-45.1	177	-173.5	174.3	-175.8	0	0	111.9	Q85 K86 S91 K92 N93	Q85-E89 PolarHBondContact O-N 2.93Å; Q85-E89 VanDerWaalsContact O-N 3.08Å; K86-E89 PolarHBondContact O-N 3.5Å; E89-S91 VanDerWaalsContact C-N 3.31Å; E89-S91 PolarHBondContact O-N 3.37Å; E89-K92 WeakPolarHBondContact O-CB 3.39Å; E89-K92 PolarHBondContact O-N 3.08Å; E89-N93 PolarHBondContact O-N 3.3Å; E89-N93 PolarHBondContact O-ND2 2.96Å
90	H	97.4	Very high	97.2	Very high	113 Å²	113	106.5 Å²	106.5	52%	0.523	52%	0.523	S	S	.	.	H	α-helix	trans	-60.3	-41.7	176.5	-170.4	76.4	0	0	0	112	K86 K92 N93 L94	K86-H90 WeakPolarHBondContact O-CB 3.36Å; K86-H90 PolarHBondContact O-N 3.44Å; H90-K92 VanDerWaalsContact C-N 3.34Å; H90-K92 PolarHBondContact O-N 3.48Å; H90-N93 PolarHBondContact O-N 2.96Å; H90-L94 WeakPolarHBondContact O-CG 3.49Å; H90-L94 PolarHBondContact O-N 2.98Å
91	S	97.5	Very high	97	Very high	71 Å²	71	107.6 Å²	107.6	50%	0.497	53%	0.532	S	S	.	.	H	α-helix	trans	-63.4	-38.1	177.6	-61.5	0	0	0	0	112.4	N87 V88 E89 L94 Q95	N87-S91 WeakPolarHBondContact O-CB 3.48Å; N87-S91 PolarHBondContact O-N 3.48Å; N87-S91 PolarHBondContact O-OG 3.38Å; V88-S91 PolarHBondContact O-N 3.06Å; E89-S91 VanDerWaalsContact C-N 3.31Å; E89-S91 PolarHBondContact O-N 3.37Å; S91-L94 PolarHBondContact O-N 3.32Å; S91-Q95 WeakPolarHBondContact O-CB 3.46Å; S91-Q95 PolarHBondContact O-N 3.21Å
92	K	96.5	Very high	96.6	Very high	126 Å²	126	108 Å²	108	55%	0.548	54%	0.538	S	S	.	.	H	α-helix	trans	-62.6	-47.1	173.4	-72.7	178.6	178.9	179.7	0	111.3	V88 E89 H90 L94 Q95 D96	V88-K92 WeakPolarHBondContact O-CG 3.43Å; V88-K92 PolarHBondContact O-N 3.4Å; V88-K92 VanDerWaalsContact O-N 3.1Å; E89-K92 WeakPolarHBondContact O-CB 3.39Å; E89-K92 PolarHBondContact O-N 3.08Å; H90-K92 VanDerWaalsContact C-N 3.34Å; H90-K92 PolarHBondContact O-N 3.48Å; K92-L94 VanDerWaalsContact C-N 3.33Å; K92-L94 PolarHBondContact O-N 3.49Å; K92-Q95 WeakPolarHBondContact O-CB 3.31Å; K92-Q95 PolarHBondContact O-N 3.09Å; K92-Q95 VanDerWaalsContact O-N 3.11Å; K92-D96 PolarHBondContact O-N 3.44Å
93	N	96.6	Very high	94.8	Very high	78 Å²	78	114.3 Å²	114.3	42%	0.417	56%	0.564	S	S	.	*	H	α-helix	trans	-59.2	-44.5	178.2	-66.5	-21.5	0	0	0	111.7	E89 H90 Q95 D96 Q97	E89-N93 PolarHBondContact O-N 3.3Å; E89-N93 PolarHBondContact O-ND2 2.96Å; H90-N93 PolarHBondContact O-N 2.96Å; N93-Q95 VanDerWaalsContact C-N 3.34Å; N93-Q95 PolarHBondContact O-N 3.25Å; N93-D96 PolarHBondContact O-N 3.45Å; N93-Q97 VanDerWaalsContact O-CG 3.31Å; N93-Q97 WeakPolarHBondContact O-CG 3.33Å; N93-Q97 PolarHBondContact O-N 3.1Å
94	L	96.6	Very high	94.6	Very high	75 Å²	75	117.7 Å²	117.7	39%	0.393	57%	0.572	S	S	.	*	H	α-helix	trans	-62	-41.5	175.2	-72.7	176.4	0	0	0	112	H90 S91 K92 D96 Q97 L98	H90-L94 WeakPolarHBondContact O-CG 3.49Å; H90-L94 PolarHBondContact O-N 2.98Å; S91-L94 PolarHBondContact O-N 3.32Å; K92-L94 VanDerWaalsContact C-N 3.33Å; K92-L94 PolarHBondContact O-N 3.49Å; L94-D96 VanDerWaalsContact C-N 3.33Å; L94-D96 PolarHBondContact O-N 3.43Å; L94-Q97 PolarHBondContact O-N 2.95Å; L94-L98 WeakPolarHBondContact O-CB 3.42Å; L94-L98 PolarHBondContact O-N 2.93Å
95	Q	96.6	Very high	94.4	Very high	98 Å²	98	118.4 Å²	118.4	46%	0.458	57%	0.574	S	S	.	*	H	α-helix	trans	-62.3	-41	177.1	-170.2	-178.1	8.8	0	0	111.6	S91 K92 N93 L98 R99	S91-Q95 WeakPolarHBondContact O-CB 3.46Å; S91-Q95 PolarHBondContact O-N 3.21Å; K92-Q95 WeakPolarHBondContact O-CB 3.31Å; K92-Q95 PolarHBondContact O-N 3.09Å; K92-Q95 VanDerWaalsContact O-N 3.11Å; N93-Q95 VanDerWaalsContact C-N 3.34Å; N93-Q95 PolarHBondContact O-N 3.25Å; Q95-L98 PolarHBondContact O-N 2.99Å; Q95-R99 VanDerWaalsContact NE2-NH2 3.17Å; Q95-R99 WeakPolarHBondContact O-CG 3.48Å; Q95-R99 PolarHBondContact O-N 3.18Å
96	D	95.8	Very high	94.2	Very high	95 Å²	95	118.1 Å²	118.1	51%	0.508	57%	0.574	S	S	.	*	H	α-helix	trans	-67.4	-41	177.5	-71.9	-22.8	0	0	0	112	K92 N93 L94 L98 R99 H100	K92-D96 PolarHBondContact O-N 3.44Å; N93-D96 PolarHBondContact O-N 3.45Å; L94-D96 VanDerWaalsContact C-N 3.33Å; L94-D96 PolarHBondContact O-N 3.43Å; D96-L98 PolarHBondContact O-N 3.11Å; D96-R99 PolarHBondContact O-N 3.26Å; D96-H100 PolarHBondContact O-N 3.39Å
97	Q	95.4	Very high	94	Very high	119 Å²	119	117.1 Å²	117.1	56%	0.556	57%	0.573	S	S	*	*	H	α-helix	trans	-59.9	-45.8	173.3	-71.8	173.1	13.3	0	0	111.7	N93 L94 R99 H100 L101	N93-Q97 VanDerWaalsContact O-CG 3.31Å; N93-Q97 WeakPolarHBondContact O-CG 3.33Å; N93-Q97 PolarHBondContact O-N 3.1Å; L94-Q97 PolarHBondContact O-N 2.95Å; Q97-R99 VanDerWaalsContact C-N 3.33Å; Q97-R99 PolarHBondContact O-N 3.5Å; Q97-H100 PolarHBondContact O-N 3.37Å; Q97-L101 PolarHBondContact O-N 3.47Å; Q97-L101 VanDerWaalsContact O-N 3.09Å
98	L	96.2	Very high	93.7	Very high	103 Å²	103	117.8 Å²	117.8	54%	0.539	57%	0.573	S	S	.	*	H	α-helix	trans	-58.2	-44.4	174.7	-98.3	154.9	0	0	0	112	L94 Q95 D96 H100 L101 L102	L94-L98 WeakPolarHBondContact O-CB 3.42Å; L94-L98 PolarHBondContact O-N 2.93Å; Q95-L98 PolarHBondContact O-N 2.99Å; D96-L98 PolarHBondContact O-N 3.11Å; L98-H100 VanDerWaalsContact C-N 3.28Å; L98-H100 PolarHBondContact O-N 3.13Å; L98-L101 PolarHBondContact O-N 3.01Å; L98-L102 HydrophobicContact CD2-CD1 4.27Å; L98-L102 WeakPolarHBondContact O-CB 3.32Å; L98-L102 WeakPolarHBondContact O-CG 3.49Å; L98-L102 PolarHBondContact O-N 3.24Å; L98-L102 VanDerWaalsContact O-N 3.13Å
99	R	95.8	Very high	93.5	Very high	148 Å²	148	121.1 Å²	121.1	56%	0.558	58%	0.584	S	S	*	*	H	α-helix	trans	-62.8	-34.2	177.1	-73.8	173.4	-175.1	-119.4	4	112.7	Q95 D96 Q97	Q95-R99 VanDerWaalsContact NE2-NH2 3.17Å; Q95-R99 WeakPolarHBondContact O-CG 3.48Å; Q95-R99 PolarHBondContact O-N 3.18Å; D96-R99 PolarHBondContact O-N 3.26Å; Q97-R99 VanDerWaalsContact C-N 3.33Å; Q97-R99 PolarHBondContact O-N 3.5Å
100	H	94.8	Very high	93.2	Very high	149 Å²	149	121.2 Å²	121.2	69%	0.69	59%	0.586	S	S	*	*	H	α-helix	trans	-71.2	-36.8	177	-171	-63.1	0	0	0	112	D96 Q97 L98 L102	D96-H100 PolarHBondContact O-N 3.39Å; Q97-H100 PolarHBondContact O-N 3.37Å; L98-H100 VanDerWaalsContact C-N 3.28Å; L98-H100 PolarHBondContact O-N 3.13Å; H100-L102 VanDerWaalsContact C-N 3.34Å
101	L	93.8	Very high	92.8	Very high	139 Å²	139	121.8 Å²	121.8	73%	0.728	59%	0.591	S	S	*	*	H	α-helix	trans	-74.2	-24.5	179.1	-70	173	0	0	0	113.5	Q97 L98	Q97-L101 PolarHBondContact O-N 3.47Å; Q97-L101 VanDerWaalsContact O-N 3.09Å; L98-L101 PolarHBondContact O-N 3.01Å
102	L	90	Very high	92.5	Very high	143 Å²	143	126.1 Å²	126.1	75%	0.749	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.6	8.3	-178.1	-66.5	171.6	0	0	0	113.8	L98 H100	L98-L102 HydrophobicContact CD2-CD1 4.27Å; L98-L102 WeakPolarHBondContact O-CB 3.32Å; L98-L102 WeakPolarHBondContact O-CG 3.49Å; L98-L102 PolarHBondContact O-N 3.24Å; L98-L102 VanDerWaalsContact O-N 3.13Å; H100-L102 VanDerWaalsContact C-N 3.34Å
103	K	61.5	Low	92.1	Very high	240 Å²	240	126.1 Å²	126.1	100%	1.043	60%	0.604	S	S	*	*			trans	-105.1	0	169.9	-78.1	-179.4	178.1	-179.2	0	109.9

Retrieved 103 of 103 residues in 780.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).