A0A060W2R1_ONCMY Loading...

Mitochondrial import inner membrane translocase subunit TIM17

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

AlphaFold DB , UniProt , Accession A0A060W2R1, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110527776, Length 167 aa.

						>A0A060W2R1_ONCMY|A0A060W2R1|LOC110527776
MEEYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNSPAGMSHRLKGSMTAIKTRAPQLGGSFAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASSQFPTGPQFAEEPAPMPAPSYGGDYRQYQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	32.4	Very low	57.2	Low	241 Å²	241	145 Å²	145	100%	1.187	72%	0.723	S	S	*	*				0	78.7	0	-69.4	-171.3	-120.7	0	0	108
2	E	35.1	Very low	59.5	Low	193 Å²	193	136 Å²	136	90%	0.902	67%	0.674	S	S	*	*			trans	-107.2	38.6	167	-82.7	-174.6	112.8	0	0	109.1	Y4	E2-Y4 PolarHBondContact O-N 3.12Å; E2-Y4 VanDerWaalsContact O-N 3.16Å
3	E	39.9	Very low	61.7	Low	189 Å²	189	128.4 Å²	128.4	88%	0.883	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.8	50.2	-178.6	-154.7	162.8	139.1	0	0	109.6
4	Y	40.6	Very low	63.8	Low	228 Å²	228	125.5 Å²	125.5	89%	0.894	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-150.4	16.8	177.7	-136.4	-90.1	0	0	0	114.1	E2	E2-Y4 PolarHBondContact O-N 3.12Å; E2-Y4 VanDerWaalsContact O-N 3.16Å
5	A	47.9	Very low	65.7	Low	99 Å²	99	123.6 Å²	123.6	82%	0.818	62%	0.622	S	S	*	*	S	Bend	trans	-104.7	1.4	-179.9	0	0	0	0	0	114.3
6	R	54	Low	67.3	Low	116 Å²	116	118.7 Å²	118.7	44%	0.438	60%	0.598	S	S	.	*	S	Bend	trans	-122.2	113.5	-176.3	-148.6	167.3	172.6	86.9	-5.8	108.8	R12 D77 E87	R6-R12 VanDerWaalsContact NH1-NH2 3.15Å; R6-R12 VanDerWaalsContact NH2-CZ 3.26Å; R6-D77 IonicContact NH2-OD2 3.6Å; R6-D77 PolarHBondContact NH2-OD2 3.05Å; R6-E87 IonicContact NE-OE1 3.98Å; R6-E87 IonicContact NE-OE2 2.93Å
7	E	60	Low	68.8	Low	110 Å²	110	114 Å²	114	51%	0.514	58%	0.578	S	S	.	*	P	Polyproline II helix	trans	-49.4	132.5	174.8	-70.6	-90.4	154.7	0	0	110.2	W11 R12	E7-W11 HydrophobicContact CB-CB 4.5Å; E7-R12 HydrophobicContact CB-CB 4.22Å
8	P	72	Confident	70.2	Confident	96 Å²	96	109.6 Å²	109.6	62%	0.623	57%	0.566	S	S	*	*	P	Polyproline II helix	trans	-63.6	141.2	179.5	25.1	-32.4	0	0	0	110.9	W11	P8-W11 PolarHBondContact O-N 3.41Å
9	C	79.6	Confident	71.5	Confident	72 Å²	72	105.5 Å²	105.5	49%	0.486	55%	0.553	S	S	.	*	T	Hydrogen-bonded Turn	trans	-61.8	118.3	166.9	-49.2	0	0	0	0	107.1	C78	C9-C78 HydrophobicContact CB-CB 3.84Å; C9-C78 WeakPolarHBondContact CB-SG 3.42Å; C9-C78 WeakPolarHBondContact SG-CB 3.12Å; C9-C78 CovalentContact SG-SG 2.04Å; C9-C78 PolarHBondContact SG-SG 3.13Å
10	P	81.6	Confident	72.6	Confident	93 Å²	93	101.1 Å²	101.1	60%	0.604	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	cis	-107.8	-5.9	36.2	38.3	-35.9	0	0	0	116.7	R12 I13 V14	P10-R12 PolarHBondContact O-N 3.02Å; P10-I13 WeakPolarHBondContact O-CB 3.35Å; P10-I13 PolarHBondContact O-N 3.34Å; P10-V14 PolarHBondContact O-N 2.86Å
11	W	86.1	Confident	73.7	Confident	158 Å²	158	100.5 Å²	100.5	60%	0.598	53%	0.526	S	S	*	.	H	α-helix	trans	-59.5	-40.3	-174.1	-118.2	117.2	0	0	0	111.7	E7 P8 I13 V14 D15	E7-W11 HydrophobicContact CB-CB 4.5Å; P8-W11 PolarHBondContact O-N 3.41Å; W11-I13 VanDerWaalsContact C-N 3.27Å; W11-I13 PolarHBondContact O-N 3.03Å; W11-V14 HydrophobicContact CE3-CB 4.38Å; W11-V14 HydrophobicContact CZ3-CG1 4.35Å; W11-V14 WeakPolarHBondContact O-CB 3.39Å; W11-V14 PolarHBondContact O-N 2.82Å; W11-D15 PolarHBondContact O-N 3.43Å
12	R	84.8	Confident	76.8	Confident	37 Å²	37	92.4 Å²	92.4	14%	0.14	49%	0.49	C	S	.	.	H	α-helix	trans	-56.9	-34.9	175.9	-163.6	-122.8	179.6	77.3	8.2	114.5	R6 E7 P10 D16	R6-R12 VanDerWaalsContact NH1-NH2 3.15Å; R6-R12 VanDerWaalsContact NH2-CZ 3.26Å; E7-R12 HydrophobicContact CB-CB 4.22Å; P10-R12 PolarHBondContact O-N 3.02Å; R12-D16 WeakPolarHBondContact CD-OD2 3.25Å; R12-D16 IonicContact CZ-OD2 3.88Å; R12-D16 IonicContact NE-OD2 3.04Å; R12-D16 PolarHBondContact NE-OD2 3.14Å; R12-D16 VanDerWaalsContact O-CB 3.27Å; R12-D16 WeakPolarHBondContact O-CB 3.33Å; R12-D16 VanDerWaalsContact O-CG 3.25Å; R12-D16 PolarHBondContact O-N 3.26Å
13	I	88.6	Confident	79.6	Confident	37 Å²	37	90.2 Å²	90.2	19%	0.19	48%	0.482	C	S	.	.	H	α-helix	trans	-67.8	-42.3	177.2	-61.6	161.2	0	0	0	109.8	P10 W11 C17 M75	P10-I13 WeakPolarHBondContact O-CB 3.35Å; P10-I13 PolarHBondContact O-N 3.34Å; W11-I13 VanDerWaalsContact C-N 3.27Å; W11-I13 PolarHBondContact O-N 3.03Å; I13-C17 VanDerWaalsContact O-CB 3.28Å; I13-C17 WeakPolarHBondContact O-CB 3.45Å; I13-C17 PolarHBondContact O-N 3.39Å; I13-C17 PolarHBondContact O-SG 3.32Å; I13-M75 HydrophobicContact CD1-CG 3.82Å; I13-M75 HydrophobicContact CG1-CG 4.19Å; I13-M75 HydrophobicContact CG2-CG 3.89Å
14	V	91	Very high	82.2	Confident	88 Å²	88	81.3 Å²	81.3	53%	0.533	44%	0.441	S	S	.	.	H	α-helix	trans	-67	-43.3	179.7	-179.8	0	0	0	0	110.4	P10 W11 C17 G18	P10-V14 PolarHBondContact O-N 2.86Å; W11-V14 HydrophobicContact CE3-CB 4.38Å; W11-V14 HydrophobicContact CZ3-CG1 4.35Å; W11-V14 WeakPolarHBondContact O-CB 3.39Å; W11-V14 PolarHBondContact O-N 2.82Å; V14-C17 PolarHBondContact O-N 3.3Å; V14-G18 PolarHBondContact O-N 3.1Å
15	D	92	Very high	84.8	Confident	97 Å²	97	71.6 Å²	71.6	52%	0.519	41%	0.408	S	S	.	.	H	α-helix	trans	-63.1	-48.7	177	-167.8	61.6	0	0	0	111.5	W11 C17 G18 G19	W11-D15 PolarHBondContact O-N 3.43Å; D15-C17 PolarHBondContact O-N 3.15Å; D15-G18 PolarHBondContact O-N 3.05Å; D15-G19 PolarHBondContact O-N 3.41Å
16	D	91.4	Very high	87.1	Confident	45 Å²	45	71.9 Å²	71.9	24%	0.241	39%	0.394	C	S	.	.	H	α-helix	trans	-64.2	-38.2	178	-73.9	-29.8	0	0	0	111.9	R12 A20 S74	R12-D16 WeakPolarHBondContact CD-OD2 3.25Å; R12-D16 IonicContact CZ-OD2 3.88Å; R12-D16 IonicContact NE-OD2 3.04Å; R12-D16 PolarHBondContact NE-OD2 3.14Å; R12-D16 VanDerWaalsContact O-CB 3.27Å; R12-D16 WeakPolarHBondContact O-CB 3.33Å; R12-D16 VanDerWaalsContact O-CG 3.25Å; R12-D16 PolarHBondContact O-N 3.26Å; D16-A20 WeakPolarHBondContact O-CB 3.39Å; D16-A20 PolarHBondContact O-N 2.86Å; D16-S74 WeakPolarHBondContact CB-OG 3.21Å; D16-S74 WeakPolarHBondContact OD2-CB 3.31Å; D16-S74 PolarHBondContact OD2-OG 2.87Å
17	C	92.7	Very high	89	Confident	39 Å²	39	68.2 Å²	68.2	26%	0.264	39%	0.393	S	S	.	.	H	α-helix	trans	-60.3	-50.5	172.4	-75.2	0	0	0	0	111.8	I13 V14 D15 F21 G71	I13-C17 VanDerWaalsContact O-CB 3.28Å; I13-C17 WeakPolarHBondContact O-CB 3.45Å; I13-C17 PolarHBondContact O-N 3.39Å; I13-C17 PolarHBondContact O-SG 3.32Å; V14-C17 PolarHBondContact O-N 3.3Å; D15-C17 PolarHBondContact O-N 3.15Å; C17-F21 WeakPolarHBondContact O-CB 3.49Å; C17-F21 PolarHBondContact O-N 2.88Å; C17-G71 WeakPolarHBondContact SG-CA 3.35Å
18	G	93.8	Very high	90.6	Very high	34 Å²	34	63 Å²	63	35%	0.351	37%	0.369	S	S	.	.	H	α-helix	trans	-69.5	-41.8	-175.9	0	0	0	0	0	112.4	V14 D15 F21 T22	V14-G18 PolarHBondContact O-N 3.1Å; D15-G18 PolarHBondContact O-N 3.05Å; G18-F21 PolarHBondContact O-N 3.21Å; G18-T22 WeakPolarHBondContact O-CB 3.46Å; G18-T22 PolarHBondContact O-N 3.2Å; G18-T22 PolarHBondContact O-OG1 3.03Å
19	G	94.2	Very high	91.7	Very high	32 Å²	32	59 Å²	59	33%	0.33	34%	0.344	S	S	.	.	H	α-helix	trans	-60	-50.8	173.4	0	0	0	0	0	111.1	D15 F21 T22 M23	D15-G19 PolarHBondContact O-N 3.41Å; G19-F21 PolarHBondContact O-N 3.31Å; G19-T22 PolarHBondContact O-N 3.5Å; G19-M23 WeakPolarHBondContact O-CG 3.41Å; G19-M23 PolarHBondContact O-N 2.93Å
20	A	94.6	Very high	92.5	Very high	17 Å²	17	60.8 Å²	60.8	14%	0.14	35%	0.348	C	S	.	.	H	α-helix	trans	-63.3	-40.4	177.8	0	0	0	0	0	112.3	D16 T22 M23 G24 F66	D16-A20 WeakPolarHBondContact O-CB 3.39Å; D16-A20 PolarHBondContact O-N 2.86Å; A20-T22 VanDerWaalsContact C-N 3.34Å; A20-T22 PolarHBondContact O-N 3.12Å; A20-M23 PolarHBondContact O-N 3.36Å; A20-G24 PolarHBondContact O-N 3.26Å; A20-F66 HydrophobicContact CB-CB 4.33Å; A20-F66 VanDerWaalsContact CB-O 3.31Å; A20-F66 WeakPolarHBondContact CB-O 3.19Å; A20-F66 VanDerWaalsContact O-CB 3.29Å; A20-F66 WeakPolarHBondContact O-CB 3.39Å
21	F	96.4	Very high	93.1	Very high	89 Å²	89	62.2 Å²	62.2	39%	0.39	35%	0.345	S	S	.	.	H	α-helix	trans	-56.7	-49.3	173.5	179.5	-98.2	0	0	0	111.4	C17 G18 G19 G24 A25 G63 A67	C17-F21 WeakPolarHBondContact O-CB 3.49Å; C17-F21 PolarHBondContact O-N 2.88Å; G18-F21 PolarHBondContact O-N 3.21Å; G19-F21 PolarHBondContact O-N 3.31Å; F21-G24 PolarHBondContact O-N 2.04Å; F21-A25 HydrophobicContact CE1-CB 4.29Å; F21-A25 VanDerWaalsContact O-CB 3.24Å; F21-A25 WeakPolarHBondContact O-CB 3.34Å; F21-A25 PolarHBondContact O-N 3.05Å; F21-G63 WeakPolarHBondContact CD2-O 3.4Å; F21-A67 HydrophobicContact CB-CB 3.84Å; F21-A67 HydrophobicContact CD2-CB 4.18Å
22	T	95.9	Very high	93.4	Very high	71 Å²	71	56.3 Å²	56.3	44%	0.436	32%	0.324	S	S	.	.	H	α-helix	trans	-65.2	-45	-176.7	-56.7	0	0	0	0	110.9	G18 G19 A20 G24 A25 I26	G18-T22 WeakPolarHBondContact O-CB 3.46Å; G18-T22 PolarHBondContact O-N 3.2Å; G18-T22 PolarHBondContact O-OG1 3.03Å; G19-T22 PolarHBondContact O-N 3.5Å; A20-T22 VanDerWaalsContact C-N 3.34Å; A20-T22 PolarHBondContact O-N 3.12Å; T22-G24 VanDerWaalsContact C-N 3.35Å; T22-G24 PolarHBondContact O-N 2.91Å; T22-A25 PolarHBondContact O-N 3.28Å; T22-I26 HydrophobicContact CG2-CD1 3.68Å; T22-I26 HydrophobicContact CG2-CG1 4.36Å; T22-I26 WeakPolarHBondContact O-CB 3.31Å; T22-I26 VanDerWaalsContact O-CG1 3.3Å; T22-I26 WeakPolarHBondContact O-CG1 3.26Å; T22-I26 PolarHBondContact O-N 2.91Å
23	M	94.8	Very high	93.8	Very high	147 Å²	147	55.8 Å²	55.8	72%	0.724	33%	0.328	S	S	*	.	H	α-helix	trans	-59.1	-45.6	174.2	-69.7	-163	-170.9	0	0	111.7	G19 A20 G27	G19-M23 WeakPolarHBondContact O-CG 3.41Å; G19-M23 PolarHBondContact O-N 2.93Å; A20-M23 PolarHBondContact O-N 3.36Å; M23-G27 PolarHBondContact O-N 2.93Å
24	G	94.1	Very high	94	Very high	2 Å²	2	57.9 Å²	57.9	2%	0.021	34%	0.342	C	S	.	.	H	α-helix	trans	-67.4	-36.9	178.7	0	0	0	0	0	113.4	A20 F21 T22 G28	A20-G24 PolarHBondContact O-N 3.26Å; F21-G24 PolarHBondContact O-N 2.04Å; T22-G24 VanDerWaalsContact C-N 3.35Å; T22-G24 PolarHBondContact O-N 2.91Å; G24-G28 VanDerWaalsContact O-CA 3.29Å; G24-G28 WeakPolarHBondContact O-CA 3.19Å; G24-G28 PolarHBondContact O-N 3.48Å
25	A	95.8	Very high	94	Very high	25 Å²	25	59.2 Å²	59.2	21%	0.207	34%	0.341	C	S	.	.	H	α-helix	trans	-71.8	-43.1	178.8	0	0	0	0	0	111.9	F21 T22 G29	F21-A25 HydrophobicContact CE1-CB 4.29Å; F21-A25 VanDerWaalsContact O-CB 3.24Å; F21-A25 WeakPolarHBondContact O-CB 3.34Å; F21-A25 PolarHBondContact O-N 3.05Å; T22-A25 PolarHBondContact O-N 3.28Å; A25-G29 WeakPolarHBondContact O-CA 3.12Å; A25-G29 PolarHBondContact O-N 2.87Å
26	I	95.8	Very high	93.9	Very high	104 Å²	104	55 Å²	55	53%	0.533	32%	0.32	S	S	.	.	H	α-helix	trans	-69.6	-52.4	177.5	-65.5	172.6	0	0	0	110	T22 G28 G29 I30	T22-I26 HydrophobicContact CG2-CD1 3.68Å; T22-I26 HydrophobicContact CG2-CG1 4.36Å; T22-I26 WeakPolarHBondContact O-CB 3.31Å; T22-I26 VanDerWaalsContact O-CG1 3.3Å; T22-I26 WeakPolarHBondContact O-CG1 3.26Å; T22-I26 PolarHBondContact O-N 2.91Å; I26-G28 PolarHBondContact O-N 3.29Å; I26-G29 PolarHBondContact O-N 3.09Å; I26-I30 HydrophobicContact CG2-CD1 4.03Å; I26-I30 WeakPolarHBondContact O-CG1 3.32Å; I26-I30 PolarHBondContact O-N 2.9Å
27	G	94.4	Very high	93.8	Very high	40 Å²	40	55.9 Å²	55.9	41%	0.412	32%	0.322	S	S	.	.	H	α-helix	trans	-61.8	-44	179.4	0	0	0	0	0	112.1	M23 I30 F31	M23-G27 PolarHBondContact O-N 2.93Å; G27-I30 PolarHBondContact O-N 3.15Å; G27-F31 WeakPolarHBondContact O-CB 3.28Å; G27-F31 PolarHBondContact O-N 3.27Å
28	G	93.7	Very high	93.7	Very high	0 Å²	0	63.5 Å²	63.5	0%	0	35%	0.345	C	S	.	.	H	α-helix	trans	-63.7	-40	173.8	0	0	0	0	0	112.9	G24 I26 Q32	G24-G28 VanDerWaalsContact O-CA 3.29Å; G24-G28 WeakPolarHBondContact O-CA 3.19Å; G24-G28 PolarHBondContact O-N 3.48Å; I26-G28 PolarHBondContact O-N 3.29Å; G28-Q32 WeakPolarHBondContact O-CB 3.5Å; G28-Q32 WeakPolarHBondContact O-CG 3.47Å; G28-Q32 PolarHBondContact O-N 3.05Å
29	G	95	Very high	93.5	Very high	11 Å²	11	68.6 Å²	68.6	11%	0.113	36%	0.364	C	S	.	.	H	α-helix	trans	-59	-51.1	175.1	0	0	0	0	0	111.9	A25 I26 Q32 A33	A25-G29 WeakPolarHBondContact O-CA 3.12Å; A25-G29 PolarHBondContact O-N 2.87Å; I26-G29 PolarHBondContact O-N 3.09Å; G29-Q32 PolarHBondContact O-N 3.01Å; G29-A33 VanDerWaalsContact O-CB 3.24Å; G29-A33 WeakPolarHBondContact O-CB 3Å; G29-A33 PolarHBondContact O-N 3.05Å
30	I	95.4	Very high	93.3	Very high	111 Å²	111	68 Å²	68	57%	0.569	36%	0.355	S	S	*	.	H	α-helix	trans	-62.3	-48.7	179	-64.4	166.2	0	0	0	110.7	I26 G27 Q32 A33 V34	I26-I30 HydrophobicContact CG2-CD1 4.03Å; I26-I30 WeakPolarHBondContact O-CG1 3.32Å; I26-I30 PolarHBondContact O-N 2.9Å; G27-I30 PolarHBondContact O-N 3.15Å; I30-Q32 VanDerWaalsContact C-N 3.34Å; I30-Q32 PolarHBondContact O-N 2.62Å; I30-A33 WeakPolarHBondContact O-CB 3.37Å; I30-A33 PolarHBondContact O-N 3.28Å; I30-V34 PolarHBondContact O-N 3.5Å; I30-V34 VanDerWaalsContact O-N 3.15Å
31	F	93.9	Very high	92.8	Very high	122 Å²	122	71.5 Å²	71.5	54%	0.535	38%	0.377	S	S	.	.	H	α-helix	trans	-61.4	-44	-179.3	-178.5	-102.1	0	0	0	111.9	G27 V34 K35	G27-F31 WeakPolarHBondContact O-CB 3.28Å; G27-F31 PolarHBondContact O-N 3.27Å; F31-V34 PolarHBondContact O-N 3.07Å; F31-K35 HydrophobicContact CE1-CD 3.94Å; F31-K35 HydrophobicContact CZ-CD 4.33Å; F31-K35 VanDerWaalsContact O-CB 3.3Å; F31-K35 WeakPolarHBondContact O-CB 3.42Å; F31-K35 PolarHBondContact O-N 3.5Å
32	Q	94.3	Very high	92	Very high	34 Å²	34	71.5 Å²	71.5	16%	0.159	39%	0.393	C	S	.	.	H	α-helix	trans	-74.7	-26	179.9	-64.3	-66	101	0	0	112.5	G28 G29 I30 G36 R58	G28-Q32 WeakPolarHBondContact O-CB 3.5Å; G28-Q32 WeakPolarHBondContact O-CG 3.47Å; G28-Q32 PolarHBondContact O-N 3.05Å; G29-Q32 PolarHBondContact O-N 3.01Å; I30-Q32 VanDerWaalsContact C-N 3.34Å; I30-Q32 PolarHBondContact O-N 2.62Å; Q32-G36 WeakPolarHBondContact O-CA 3.44Å; Q32-G36 PolarHBondContact O-N 2.93Å; Q32-R58 HydrophobicContact CG-CB 3.87Å; Q32-R58 VanDerWaalsContact NE2-CB 3.27Å
33	A	92.5	Very high	91.4	Very high	26 Å²	26	69.7 Å²	69.7	22%	0.215	39%	0.388	C	S	.	.	H	α-helix	trans	-62.1	-50.7	171.2	0	0	0	0	0	110.7	G29 I30 F37 S51 I55	G29-A33 VanDerWaalsContact O-CB 3.24Å; G29-A33 WeakPolarHBondContact O-CB 3Å; G29-A33 PolarHBondContact O-N 3.05Å; I30-A33 WeakPolarHBondContact O-CB 3.37Å; I30-A33 PolarHBondContact O-N 3.28Å; A33-F37 VanDerWaalsContact O-CB 3.3Å; A33-F37 WeakPolarHBondContact O-CB 3.46Å; A33-F37 PolarHBondContact O-N 3.46Å; A33-S51 VanDerWaalsContact CA-OG 3.29Å; A33-S51 WeakPolarHBondContact CA-OG 3.43Å; A33-S51 PolarHBondContact O-OG 3.22Å; A33-I55 HydrophobicContact CB-CD1 3.54Å; A33-I55 HydrophobicContact CB-CG1 3.87Å
34	V	92.8	Very high	91	Very high	82 Å²	82	68.8 Å²	68.8	50%	0.497	38%	0.384	S	S	.	.	H	α-helix	trans	-65.7	-48.9	179	176.4	0	0	0	0	110.7	I30 F31 G36 F37 R38	I30-V34 PolarHBondContact O-N 3.5Å; I30-V34 VanDerWaalsContact O-N 3.15Å; F31-V34 PolarHBondContact O-N 3.07Å; V34-G36 PolarHBondContact O-N 3.23Å; V34-F37 PolarHBondContact O-N 3.37Å; V34-R38 WeakPolarHBondContact O-CG 3.17Å; V34-R38 PolarHBondContact O-N 3.46Å
35	K	91.2	Very high	90.6	Very high	116 Å²	116	72.1 Å²	72.1	50%	0.504	41%	0.407	S	S	.	.	H	α-helix	trans	-63	-43.5	179.6	-172.7	172.9	-178	167.7	0	111.8	F31 R38 N39	F31-K35 HydrophobicContact CE1-CD 3.94Å; F31-K35 HydrophobicContact CZ-CD 4.33Å; F31-K35 VanDerWaalsContact O-CB 3.3Å; F31-K35 WeakPolarHBondContact O-CB 3.42Å; F31-K35 PolarHBondContact O-N 3.5Å; K35-R38 PolarHBondContact O-N 3.4Å; K35-N39 VanDerWaalsContact O-CB 3.26Å; K35-N39 WeakPolarHBondContact O-CB 3.12Å; K35-N39 PolarHBondContact O-N 2.9Å
36	G	89.4	Confident	90.2	Very high	8 Å²	8	76.1 Å²	76.1	8%	0.082	42%	0.421	C	S	.	.	H	α-helix	trans	-64.4	-39.1	177.4	0	0	0	0	0	112.5	Q32 V34 S40	Q32-G36 WeakPolarHBondContact O-CA 3.44Å; Q32-G36 PolarHBondContact O-N 2.93Å; V34-G36 PolarHBondContact O-N 3.23Å; G36-S40 VanDerWaalsContact O-CB 3.31Å; G36-S40 WeakPolarHBondContact O-CB 3.31Å; G36-S40 PolarHBondContact O-N 3Å; G36-S40 PolarHBondContact O-OG 2.66Å
37	F	89.9	Confident	89.9	Confident	63 Å²	63	75.4 Å²	75.4	28%	0.276	41%	0.411	S	S	.	.	H	α-helix	trans	-66.6	-42.1	175.5	-171.8	-91.8	0	0	0	112.3	A33 V34 M44 R47 L48	A33-F37 VanDerWaalsContact O-CB 3.3Å; A33-F37 WeakPolarHBondContact O-CB 3.46Å; A33-F37 PolarHBondContact O-N 3.46Å; V34-F37 PolarHBondContact O-N 3.37Å; F37-M44 HydrophobicContact CE2-SD 3.9Å; F37-M44 HydrophobicContact CZ-SD 3.92Å; F37-R47 HydrophobicContact CD2-CB 3.62Å; F37-R47 HydrophobicContact CE2-CB 3.57Å; F37-R47 HydrophobicContact CE2-CG 4.49Å; F37-R47 HydrophobicContact CG-CB 4.25Å; F37-R47 HydrophobicContact CZ-CB 4.17Å; F37-L48 HydrophobicContact CD2-CD2 4.46Å; F37-L48 HydrophobicContact CE2-CD2 4.3Å
38	R	89.2	Confident	89.7	Confident	200 Å²	200	78.3 Å²	78.3	76%	0.755	42%	0.417	S	S	*	.	H	α-helix	trans	-71.1	-35.8	-179.8	-71.5	177.6	68.4	170.8	1.8	113.5	V34 K35	V34-R38 WeakPolarHBondContact O-CG 3.17Å; V34-R38 PolarHBondContact O-N 3.46Å; K35-R38 PolarHBondContact O-N 3.4Å
39	N	90.4	Very high	89.6	Confident	141 Å²	141	85.5 Å²	85.5	75%	0.754	45%	0.448	S	S	*	.	H	α-helix	trans	-89.6	-3.3	-175.4	-159.8	59.9	0	0	0	113.8	K35	K35-N39 VanDerWaalsContact O-CB 3.26Å; K35-N39 WeakPolarHBondContact O-CB 3.12Å; K35-N39 PolarHBondContact O-N 2.9Å
40	S	89.4	Confident	89.3	Confident	18 Å²	18	86 Å²	86	13%	0.126	45%	0.454	C	S	.	.	S	Bend	trans	-86.7	150	-179.8	-69.6	0	0	0	0	112.4	G36 G50	G36-S40 VanDerWaalsContact O-CB 3.31Å; G36-S40 WeakPolarHBondContact O-CB 3.31Å; G36-S40 PolarHBondContact O-N 3Å; G36-S40 PolarHBondContact O-OG 2.66Å; S40-G50 WeakPolarHBondContact OG-CA 3.42Å
41	P	84.3	Confident	89.2	Confident	92 Å²	92	81.3 Å²	81.3	60%	0.597	43%	0.431	S	S	*	.	P	Polyproline II helix	trans	-57.5	155.3	-179.7	21.2	-31	0	0	0	112.5	G43 H46 R47	P41-G43 PolarHBondContact O-N 3.39Å; P41-H46 HydrophobicContact CG-CB 4.31Å; P41-R47 WeakPolarHBondContact O-CG 3.48Å
42	A	79.8	Confident	89.1	Confident	89 Å²	89	81.6 Å²	81.6	74%	0.736	44%	0.435	S	S	*	.	S	Bend	trans	-58.5	134.9	-176	0	0	0	0	0	111.6
43	G	83.7	Confident	89	Confident	33 Å²	33	84.1 Å²	84.1	34%	0.34	45%	0.453	S	S	.	.	S	Bend	trans	127.5	126.1	-175.8	0	0	0	0	0	111.7	P41 S45 H46 R47	P41-G43 PolarHBondContact O-N 3.39Å; G43-S45 VanDerWaalsContact C-N 3.31Å; G43-S45 PolarHBondContact O-N 3.48Å; G43-H46 PolarHBondContact O-N 2.85Å; G43-R47 WeakPolarHBondContact O-CG 3.43Å; G43-R47 PolarHBondContact O-N 2.85Å
44	M	85.4	Confident	89	Confident	127 Å²	127	83.8 Å²	83.8	63%	0.626	45%	0.45	S	S	*	.	H	α-helix	trans	-59.2	-41.6	-174.9	-170.1	63.3	74	0	0	112.2	F37 R47 L48	F37-M44 HydrophobicContact CE2-SD 3.9Å; F37-M44 HydrophobicContact CZ-SD 3.92Å; M44-R47 PolarHBondContact O-N 3.31Å; M44-L48 HydrophobicContact CG-CD1 4.1Å; M44-L48 WeakPolarHBondContact O-CB 3.28Å; M44-L48 VanDerWaalsContact O-CG 3.27Å; M44-L48 WeakPolarHBondContact O-CG 3.25Å; M44-L48 PolarHBondContact O-N 3.5Å
45	S	86.6	Confident	89.1	Confident	72 Å²	72	82.3 Å²	82.3	50%	0.503	44%	0.439	S	S	.	.	H	α-helix	trans	-63.9	-42	177.7	55.9	0	0	0	0	112.9	G43 K49	G43-S45 VanDerWaalsContact C-N 3.31Å; G43-S45 PolarHBondContact O-N 3.48Å; S45-K49 WeakPolarHBondContact O-CB 3.24Å; S45-K49 WeakPolarHBondContact O-CG 3.22Å; S45-K49 PolarHBondContact O-N 2.94Å; S45-K49 VanDerWaalsContact O-N 3.08Å
46	H	87.3	Confident	89.2	Confident	109 Å²	109	84.9 Å²	84.9	51%	0.505	45%	0.45	S	S	.	.	H	α-helix	trans	-70.4	-38.5	177.8	-71.3	-82.8	0	0	0	111.9	P41 G43 K49 G50	P41-H46 HydrophobicContact CG-CB 4.31Å; G43-H46 PolarHBondContact O-N 2.85Å; H46-K49 PolarHBondContact O-N 3.49Å; H46-G50 PolarHBondContact O-N 3.3Å
47	R	89.7	Confident	89.4	Confident	89 Å²	89	87.8 Å²	87.8	34%	0.336	47%	0.466	S	S	.	.	H	α-helix	trans	-65.9	-42.3	175.9	-71.6	-175	166	167.6	-3.9	113.1	F37 P41 G43 M44 S51	F37-R47 HydrophobicContact CD2-CB 3.62Å; F37-R47 HydrophobicContact CE2-CB 3.57Å; F37-R47 HydrophobicContact CE2-CG 4.49Å; F37-R47 HydrophobicContact CG-CB 4.25Å; F37-R47 HydrophobicContact CZ-CB 4.17Å; P41-R47 WeakPolarHBondContact O-CG 3.48Å; G43-R47 WeakPolarHBondContact O-CG 3.43Å; G43-R47 PolarHBondContact O-N 2.85Å; M44-R47 PolarHBondContact O-N 3.31Å; R47-S51 WeakPolarHBondContact O-CB 3.36Å; R47-S51 PolarHBondContact O-N 3Å
48	L	90.1	Very high	89.5	Confident	101 Å²	101	91.2 Å²	91.2	53%	0.529	48%	0.477	S	S	.	.	H	α-helix	trans	-66.5	-43.3	176	-70.1	173.6	0	0	0	111.5	F37 M44 S51 M52	F37-L48 HydrophobicContact CD2-CD2 4.46Å; F37-L48 HydrophobicContact CE2-CD2 4.3Å; M44-L48 HydrophobicContact CG-CD1 4.1Å; M44-L48 WeakPolarHBondContact O-CB 3.28Å; M44-L48 VanDerWaalsContact O-CG 3.27Å; M44-L48 WeakPolarHBondContact O-CG 3.25Å; M44-L48 PolarHBondContact O-N 3.5Å; L48-S51 PolarHBondContact O-N 2.67Å; L48-M52 WeakPolarHBondContact O-CB 3.19Å; L48-M52 PolarHBondContact O-N 3.44Å
49	K	90.8	Very high	89.7	Confident	151 Å²	151	82.1 Å²	82.1	66%	0.657	45%	0.445	S	S	*	.	H	α-helix	trans	-63.3	-42.8	175.4	-76.6	179.5	179.2	-178.1	0	112.6	S45 H46 M52 T53	S45-K49 WeakPolarHBondContact O-CB 3.24Å; S45-K49 WeakPolarHBondContact O-CG 3.22Å; S45-K49 PolarHBondContact O-N 2.94Å; S45-K49 VanDerWaalsContact O-N 3.08Å; H46-K49 PolarHBondContact O-N 3.49Å; K49-M52 PolarHBondContact O-N 2.8Å; K49-T53 WeakPolarHBondContact O-CB 3.33Å; K49-T53 PolarHBondContact O-N 3.49Å; K49-T53 PolarHBondContact O-OG1 3.49Å
50	G	89.9	Confident	89.8	Confident	22 Å²	22	78.5 Å²	78.5	23%	0.227	43%	0.429	C	S	.	.	H	α-helix	trans	-67.4	-39.9	177.3	0	0	0	0	0	112.5	S40 H46 T53 A54	S40-G50 WeakPolarHBondContact OG-CA 3.42Å; H46-G50 PolarHBondContact O-N 3.3Å; G50-T53 PolarHBondContact O-N 2.97Å; G50-A54 WeakPolarHBondContact O-CB 3.44Å; G50-A54 PolarHBondContact O-N 3Å
51	S	91.7	Very high	90.1	Very high	13 Å²	13	82.7 Å²	82.7	9%	0.091	45%	0.447	C	S	.	.	H	α-helix	trans	-60.6	-50.3	172	-175.3	0	0	0	0	111.8	A33 R47 L48 T53 A54 I55	A33-S51 VanDerWaalsContact CA-OG 3.29Å; A33-S51 WeakPolarHBondContact CA-OG 3.43Å; A33-S51 PolarHBondContact O-OG 3.22Å; R47-S51 WeakPolarHBondContact O-CB 3.36Å; R47-S51 PolarHBondContact O-N 3Å; L48-S51 PolarHBondContact O-N 2.67Å; S51-T53 VanDerWaalsContact C-N 3.31Å; S51-T53 PolarHBondContact O-N 3.28Å; S51-A54 WeakPolarHBondContact O-CB 3.33Å; S51-A54 PolarHBondContact O-N 3.4Å; S51-A54 VanDerWaalsContact O-N 3.12Å; S51-I55 VanDerWaalsContact O-CG1 3.29Å; S51-I55 WeakPolarHBondContact O-CG1 3.34Å; S51-I55 PolarHBondContact O-N 3.01Å
52	M	92.4	Very high	90.6	Very high	128 Å²	128	81.6 Å²	81.6	63%	0.631	44%	0.436	S	S	*	.	H	α-helix	trans	-59.6	-41.2	178.1	-171.9	66.6	97.9	0	0	112.2	L48 K49 I55 K56	L48-M52 WeakPolarHBondContact O-CB 3.19Å; L48-M52 PolarHBondContact O-N 3.44Å; K49-M52 PolarHBondContact O-N 2.8Å; M52-I55 PolarHBondContact O-N 3.48Å; M52-K56 WeakPolarHBondContact O-CB 2.94Å; M52-K56 PolarHBondContact O-N 2.94Å
53	T	92.6	Very high	91.3	Very high	86 Å²	86	77.3 Å²	77.3	53%	0.528	40%	0.401	S	S	.	.	H	α-helix	trans	-65.9	-40.9	176.7	-55.3	0	0	0	0	111.3	K49 G50 S51 K56 T57	K49-T53 WeakPolarHBondContact O-CB 3.33Å; K49-T53 PolarHBondContact O-N 3.49Å; K49-T53 PolarHBondContact O-OG1 3.49Å; G50-T53 PolarHBondContact O-N 2.97Å; S51-T53 VanDerWaalsContact C-N 3.31Å; S51-T53 PolarHBondContact O-N 3.28Å; T53-K56 PolarHBondContact O-N 3.09Å; T53-T57 HydrophobicContact CG2-CG2 4.48Å; T53-T57 WeakPolarHBondContact O-CB 3.5Å; T53-T57 WeakPolarHBondContact O-CG2 3.35Å; T53-T57 PolarHBondContact O-N 3.47Å; T53-T57 PolarHBondContact O-OG1 2.87Å
54	A	92.5	Very high	91.9	Very high	19 Å²	19	77.1 Å²	77.1	16%	0.157	40%	0.399	C	S	.	.	H	α-helix	trans	-64.9	-43	177.2	0	0	0	0	0	112.1	G50 S51 T57 R58	G50-A54 WeakPolarHBondContact O-CB 3.44Å; G50-A54 PolarHBondContact O-N 3Å; S51-A54 WeakPolarHBondContact O-CB 3.33Å; S51-A54 PolarHBondContact O-N 3.4Å; S51-A54 VanDerWaalsContact O-N 3.12Å; A54-T57 PolarHBondContact O-OG1 2.98Å; A54-R58 VanDerWaalsContact O-CB 3.24Å; A54-R58 WeakPolarHBondContact O-CB 3.28Å; A54-R58 WeakPolarHBondContact O-CG 3.17Å; A54-R58 PolarHBondContact O-N 3.37Å
55	I	94.8	Very high	92.3	Very high	51 Å²	51	74.7 Å²	74.7	26%	0.262	39%	0.394	S	S	.	.	H	α-helix	trans	-60	-54.4	174.8	-63.9	164	0	0	0	109.4	A33 S51 M52 T57 R58 A59	A33-I55 HydrophobicContact CB-CD1 3.54Å; A33-I55 HydrophobicContact CB-CG1 3.87Å; S51-I55 VanDerWaalsContact O-CG1 3.29Å; S51-I55 WeakPolarHBondContact O-CG1 3.34Å; S51-I55 PolarHBondContact O-N 3.01Å; M52-I55 PolarHBondContact O-N 3.48Å; I55-T57 VanDerWaalsContact C-N 3.27Å; I55-T57 PolarHBondContact O-N 3.38Å; I55-R58 PolarHBondContact O-N 2.81Å; I55-A59 HydrophobicContact CG2-CB 4.23Å; I55-A59 WeakPolarHBondContact O-CB 3.27Å; I55-A59 PolarHBondContact O-N 3.36Å
56	K	92.9	Very high	92.7	Very high	171 Å²	171	75.7 Å²	75.7	74%	0.743	39%	0.39	S	S	*	.	H	α-helix	trans	-60.7	-35.2	-174.1	-168.3	173.9	-176.9	-179.6	0	113.3	M52 T53 P60	M52-K56 WeakPolarHBondContact O-CB 2.94Å; M52-K56 PolarHBondContact O-N 2.94Å; T53-K56 PolarHBondContact O-N 3.09Å; K56-P60 WeakPolarHBondContact O-CD 3.29Å; K56-P60 WeakPolarHBondContact O-CG 3.1Å
57	T	93.1	Very high	93.1	Very high	68 Å²	68	71.4 Å²	71.4	42%	0.417	37%	0.373	S	S	.	.	H	α-helix	trans	-88.3	-30.8	-177.3	53.6	0	0	0	0	113.6	T53 A54 I55 Q61	T53-T57 HydrophobicContact CG2-CG2 4.48Å; T53-T57 WeakPolarHBondContact O-CB 3.5Å; T53-T57 WeakPolarHBondContact O-CG2 3.35Å; T53-T57 PolarHBondContact O-N 3.47Å; T53-T57 PolarHBondContact O-OG1 2.87Å; A54-T57 PolarHBondContact O-OG1 2.98Å; I55-T57 VanDerWaalsContact C-N 3.27Å; I55-T57 PolarHBondContact O-N 3.38Å; T57-Q61 VanDerWaalsContact O-CD 3.26Å; T57-Q61 WeakPolarHBondContact O-CG 3.33Å
58	R	93.2	Very high	93.4	Very high	135 Å²	135	71.3 Å²	71.3	51%	0.509	38%	0.382	S	S	.	.	H	α-helix	trans	-110.3	-30.2	-169.6	-57.6	-62.2	-165.3	166.4	3.7	114.4	Q32 A54 I55 Q61 L62	Q32-R58 HydrophobicContact CG-CB 3.87Å; Q32-R58 VanDerWaalsContact NE2-CB 3.27Å; A54-R58 VanDerWaalsContact O-CB 3.24Å; A54-R58 WeakPolarHBondContact O-CB 3.28Å; A54-R58 WeakPolarHBondContact O-CG 3.17Å; A54-R58 PolarHBondContact O-N 3.37Å; I55-R58 PolarHBondContact O-N 2.81Å; R58-Q61 VanDerWaalsContact CD-OE1 3.24Å; R58-Q61 VanDerWaalsContact NH1-OE1 3.08Å; R58-Q61 PolarHBondContact O-N 2.98Å; R58-L62 PolarHBondContact O-N 2.83Å
59	A	93.1	Very high	93.6	Very high	9 Å²	9	70.8 Å²	70.8	7%	0.074	37%	0.373	C	S	.	.	H	α-helix	trans	-58.7	-47	176.7	0	0	0	0	0	113.1	I55 Q61 L62 G63	I55-A59 HydrophobicContact CG2-CB 4.23Å; I55-A59 WeakPolarHBondContact O-CB 3.27Å; I55-A59 PolarHBondContact O-N 3.36Å; A59-Q61 VanDerWaalsContact C-N 3.33Å; A59-Q61 PolarHBondContact O-N 2.85Å; A59-L62 PolarHBondContact O-N 3.45Å; A59-G63 PolarHBondContact O-N 2.99Å
60	P	93.4	Very high	93.7	Very high	65 Å²	65	63.8 Å²	63.8	42%	0.422	34%	0.344	S	S	.	.	H	α-helix	trans	-69.6	-29.2	177.5	26.8	-34.9	0	0	0	113	K56 G64	K56-P60 WeakPolarHBondContact O-CD 3.29Å; K56-P60 WeakPolarHBondContact O-CG 3.1Å; P60-G64 PolarHBondContact O-N 3.05Å
61	Q	94.4	Very high	93.9	Very high	107 Å²	107	62.9 Å²	62.9	50%	0.5	33%	0.334	S	S	.	.	H	α-helix	trans	-64.8	-42.9	174.3	-68.7	-178.2	-18.1	0	0	111.3	T57 R58 A59 S65	T57-Q61 VanDerWaalsContact O-CD 3.26Å; T57-Q61 WeakPolarHBondContact O-CG 3.33Å; R58-Q61 VanDerWaalsContact CD-OE1 3.24Å; R58-Q61 VanDerWaalsContact NH1-OE1 3.08Å; R58-Q61 PolarHBondContact O-N 2.98Å; A59-Q61 VanDerWaalsContact C-N 3.33Å; A59-Q61 PolarHBondContact O-N 2.85Å; Q61-S65 PolarHBondContact O-N 3.45Å; Q61-S65 VanDerWaalsContact O-N 3.13Å; Q61-S65 PolarHBondContact O-OG 2.93Å
62	L	94.5	Very high	94	Very high	68 Å²	68	63.6 Å²	63.6	36%	0.356	34%	0.337	S	S	.	.	H	α-helix	trans	-68.5	-47.4	176.2	-166.4	67.3	0	0	0	110.9	R58 A59 G64 S65 F66	R58-L62 PolarHBondContact O-N 2.83Å; A59-L62 PolarHBondContact O-N 3.45Å; L62-G64 VanDerWaalsContact C-N 3.32Å; L62-G64 PolarHBondContact O-N 3.4Å; L62-S65 WeakPolarHBondContact O-CB 3.39Å; L62-S65 PolarHBondContact O-N 2.91Å; L62-F66 HydrophobicContact CD1-CD2 4.28Å; L62-F66 HydrophobicContact CD1-CE2 3.93Å; L62-F66 HydrophobicContact CD2-CE2 4.2Å; L62-F66 HydrophobicContact CG-CD2 3.95Å; L62-F66 HydrophobicContact CG-CE2 3.81Å; L62-F66 WeakPolarHBondContact O-CD2 3.36Å; L62-F66 PolarHBondContact O-N 2.98Å
63	G	95.1	Very high	94.1	Very high	0 Å²	0	59 Å²	59	0%	0	31%	0.313	C	S	.	.	H	α-helix	trans	-53.1	-47	174.3	0	0	0	0	0	112.5	F21 A59 S65 F66 A67	F21-G63 WeakPolarHBondContact CD2-O 3.4Å; A59-G63 PolarHBondContact O-N 2.99Å; G63-S65 VanDerWaalsContact C-N 3.32Å; G63-S65 PolarHBondContact O-N 2.52Å; G63-F66 PolarHBondContact O-N 3.04Å; G63-A67 WeakPolarHBondContact O-CB 3.38Å; G63-A67 PolarHBondContact O-N 2.93Å
64	G	95.5	Very high	94	Very high	29 Å²	29	54.9 Å²	54.9	30%	0.299	29%	0.288	S	S	.	.	H	α-helix	trans	-61.9	-37.3	176.2	0	0	0	0	0	113.3	P60 L62 A67 V68	P60-G64 PolarHBondContact O-N 3.05Å; L62-G64 VanDerWaalsContact C-N 3.32Å; L62-G64 PolarHBondContact O-N 3.4Å; G64-A67 PolarHBondContact O-N 2.93Å; G64-V68 WeakPolarHBondContact O-CG2 3.25Å; G64-V68 PolarHBondContact O-N 3.23Å
65	S	94.6	Very high	94	Very high	76 Å²	76	58.8 Å²	58.8	53%	0.531	30%	0.304	S	S	.	.	H	α-helix	trans	-65.7	-41.4	176.6	-56.1	0	0	0	0	111.7	Q61 L62 G63 W69	Q61-S65 PolarHBondContact O-N 3.45Å; Q61-S65 VanDerWaalsContact O-N 3.13Å; Q61-S65 PolarHBondContact O-OG 2.93Å; L62-S65 WeakPolarHBondContact O-CB 3.39Å; L62-S65 PolarHBondContact O-N 2.91Å; G63-S65 VanDerWaalsContact C-N 3.32Å; G63-S65 PolarHBondContact O-N 2.52Å; S65-W69 PolarHBondContact O-N 3.16Å; S65-W69 VanDerWaalsContact O-N 3.09Å
66	F	94.6	Very high	93.9	Very high	93 Å²	93	57.3 Å²	57.3	41%	0.408	30%	0.297	S	S	.	.	H	α-helix	trans	-67.2	-38.8	173.9	-85	-83.3	0	0	0	112.3	A20 L62 G63 W69 G70	A20-F66 HydrophobicContact CB-CB 4.33Å; A20-F66 VanDerWaalsContact CB-O 3.31Å; A20-F66 WeakPolarHBondContact CB-O 3.19Å; A20-F66 VanDerWaalsContact O-CB 3.29Å; A20-F66 WeakPolarHBondContact O-CB 3.39Å; L62-F66 HydrophobicContact CD1-CD2 4.28Å; L62-F66 HydrophobicContact CD1-CE2 3.93Å; L62-F66 HydrophobicContact CD2-CE2 4.2Å; L62-F66 HydrophobicContact CG-CD2 3.95Å; L62-F66 HydrophobicContact CG-CE2 3.81Å; L62-F66 WeakPolarHBondContact O-CD2 3.36Å; L62-F66 PolarHBondContact O-N 2.98Å; G63-F66 PolarHBondContact O-N 3.04Å; F66-W69 PolarHBondContact O-N 3.02Å; F66-G70 PolarHBondContact O-N 2.91Å
67	A	95.8	Very high	93.7	Very high	18 Å²	18	49.4 Å²	49.4	15%	0.149	26%	0.263	C	S	.	.	H	α-helix	trans	-60.6	-46.1	176.2	0	0	0	0	0	111.9	F21 G63 G64 W69 G70 G71	F21-A67 HydrophobicContact CB-CB 3.84Å; F21-A67 HydrophobicContact CD2-CB 4.18Å; G63-A67 WeakPolarHBondContact O-CB 3.38Å; G63-A67 PolarHBondContact O-N 2.93Å; G64-A67 PolarHBondContact O-N 2.93Å; A67-W69 VanDerWaalsContact C-N 3.33Å; A67-W69 PolarHBondContact O-N 3.43Å; A67-G70 PolarHBondContact O-N 3.06Å; A67-G71 PolarHBondContact O-N 3.04Å
68	V	95.9	Very high	93.5	Very high	87 Å²	87	46.9 Å²	46.9	53%	0.527	25%	0.248	S	C	.	.	H	α-helix	trans	-63.5	-41.4	177	171.3	0	0	0	0	110.9	G64 L72 L103	G64-V68 WeakPolarHBondContact O-CG2 3.25Å; G64-V68 PolarHBondContact O-N 3.23Å; V68-L72 WeakPolarHBondContact O-CB 3.42Å; V68-L72 PolarHBondContact O-N 3.41Å; V68-L103 HydrophobicContact CG1-CD2 3.67Å
69	W	94.2	Very high	93.2	Very high	91 Å²	91	42 Å²	42	35%	0.345	24%	0.24	S	C	.	.	H	α-helix	trans	-63.8	-51.3	176.8	-177.1	88.4	0	0	0	112	S65 F66 A67 L72 F73 T99 L103 L123	S65-W69 PolarHBondContact O-N 3.16Å; S65-W69 VanDerWaalsContact O-N 3.09Å; F66-W69 PolarHBondContact O-N 3.02Å; A67-W69 VanDerWaalsContact C-N 3.33Å; A67-W69 PolarHBondContact O-N 3.43Å; W69-L72 PolarHBondContact O-N 3.4Å; W69-F73 WeakPolarHBondContact O-CB 3.36Å; W69-F73 PolarHBondContact O-N 2.9Å; W69-T99 HydrophobicContact CG-CG2 4.18Å; W69-L103 HydrophobicContact CB-CD1 4.18Å; W69-L103 HydrophobicContact CG-CD1 4.32Å; W69-L123 HydrophobicContact CH2-CD2 4.41Å
70	G	93.3	Very high	92.9	Very high	4 Å²	4	43.3 Å²	43.3	4%	0.041	25%	0.245	C	C	.	.	H	α-helix	trans	-62.7	-44.4	179.6	0	0	0	0	0	112.4	F66 A67 L72 F73 S74	F66-G70 PolarHBondContact O-N 2.91Å; A67-G70 PolarHBondContact O-N 3.06Å; G70-L72 PolarHBondContact O-N 2.88Å; G70-F73 PolarHBondContact O-N 3.43Å; G70-S74 PolarHBondContact O-N 3.47Å; G70-S74 PolarHBondContact O-OG 2.94Å
71	G	94	Very high	92.5	Very high	3 Å²	3	41.8 Å²	41.8	3%	0.031	24%	0.235	C	C	.	.	H	α-helix	trans	-62.5	-43.8	176.7	0	0	0	0	0	113.7	C17 A67 S74 M75	C17-G71 WeakPolarHBondContact SG-CA 3.35Å; A67-G71 PolarHBondContact O-N 3.04Å; G71-S74 PolarHBondContact O-N 3.07Å; G71-M75 WeakPolarHBondContact O-CB 3.26Å; G71-M75 VanDerWaalsContact O-CG 3.28Å; G71-M75 WeakPolarHBondContact O-CG 3.11Å; G71-M75 PolarHBondContact O-N 2.91Å
72	L	94.2	Very high	91.9	Very high	28 Å²	28	45.8 Å²	45.8	15%	0.147	25%	0.25	C	S	.	.	H	α-helix	trans	-67.4	-41	178.5	-177.8	60.6	0	0	0	111.8	V68 W69 G70 M75 I76 T99 I102 L103	V68-L72 WeakPolarHBondContact O-CB 3.42Å; V68-L72 PolarHBondContact O-N 3.41Å; W69-L72 PolarHBondContact O-N 3.4Å; G70-L72 PolarHBondContact O-N 2.88Å; L72-M75 HydrophobicContact CB-CE 4.39Å; L72-M75 HydrophobicContact CD1-CE 4.1Å; L72-M75 PolarHBondContact O-N 3.49Å; L72-I76 HydrophobicContact CD1-CD1 3.89Å; L72-I76 HydrophobicContact CD1-CG1 4.29Å; L72-I76 HydrophobicContact CG-CD1 3.87Å; L72-I76 WeakPolarHBondContact O-CD1 3.4Å; L72-I76 VanDerWaalsContact O-CG1 3.26Å; L72-I76 WeakPolarHBondContact O-CG1 3.37Å; L72-I76 PolarHBondContact O-N 3.16Å; L72-T99 HydrophobicContact CB-CG2 4.08Å; L72-T99 HydrophobicContact CD2-CG2 3.97Å; L72-T99 HydrophobicContact CG-CG2 4.03Å; L72-I102 HydrophobicContact CD1-CD1 4.32Å; L72-I102 HydrophobicContact CD2-CB 3.89Å; L72-I102 HydrophobicContact CD2-CD1 4.42Å; L72-I102 HydrophobicContact CD2-CG2 3.62Å; L72-L103 HydrophobicContact CD2-CD2 3.87Å; L72-L103 HydrophobicContact CD2-CG 3.93Å
73	F	93.9	Very high	91.4	Very high	30 Å²	30	48.5 Å²	48.5	13%	0.132	27%	0.27	C	S	.	.	H	α-helix	trans	-55.2	-52.3	173	171.8	-99	0	0	0	111.4	W69 G70 M75 I76 D77 S95 T99 L123	W69-F73 WeakPolarHBondContact O-CB 3.36Å; W69-F73 PolarHBondContact O-N 2.9Å; G70-F73 PolarHBondContact O-N 3.43Å; F73-M75 PolarHBondContact O-N 2.87Å; F73-I76 PolarHBondContact O-N 3.44Å; F73-D77 PolarHBondContact O-N 3.28Å; F73-S95 WeakPolarHBondContact CD2-OG 3.37Å; F73-S95 WeakPolarHBondContact CE2-OG 3.43Å; F73-T99 VanDerWaalsContact CA-OG1 3.25Å; F73-T99 WeakPolarHBondContact CA-OG1 3.3Å; F73-T99 HydrophobicContact CB-CG2 4.41Å; F73-T99 PolarHBondContact N-OG1 2.89Å; F73-L123 HydrophobicContact CD2-CD1 3.73Å; F73-L123 HydrophobicContact CE2-CD1 3.1Å; F73-L123 HydrophobicContact CZ-CD1 3.81Å
74	S	91.6	Very high	90.7	Very high	0 Å²	0	54.1 Å²	54.1	0%	0	29%	0.291	C	S	.	.	H	α-helix	trans	-69.1	-33.8	-177.6	-52.4	0	0	0	0	113	D16 G70 G71 I76 C78	D16-S74 WeakPolarHBondContact CB-OG 3.21Å; D16-S74 WeakPolarHBondContact OD2-CB 3.31Å; D16-S74 PolarHBondContact OD2-OG 2.87Å; G70-S74 PolarHBondContact O-N 3.47Å; G70-S74 PolarHBondContact O-OG 2.94Å; G71-S74 PolarHBondContact O-N 3.07Å; S74-I76 VanDerWaalsContact C-N 3.34Å; S74-C78 WeakPolarHBondContact O-CB 3.29Å; S74-C78 PolarHBondContact O-N 3.42Å; S74-C78 PolarHBondContact O-SG 2.91Å; S74-C78 VanDerWaalsContact O-SG 3.36Å
75	M	91.3	Very high	89.7	Confident	101 Å²	101	56 Å²	56	50%	0.498	31%	0.31	S	S	.	.	H	α-helix	trans	-61.2	-43.3	171.8	-79.3	-171.9	-67.6	0	0	111.7	I13 G71 L72 F73 G79	I13-M75 HydrophobicContact CD1-CG 3.82Å; I13-M75 HydrophobicContact CG1-CG 4.19Å; I13-M75 HydrophobicContact CG2-CG 3.89Å; G71-M75 WeakPolarHBondContact O-CB 3.26Å; G71-M75 VanDerWaalsContact O-CG 3.28Å; G71-M75 WeakPolarHBondContact O-CG 3.11Å; G71-M75 PolarHBondContact O-N 2.91Å; L72-M75 HydrophobicContact CB-CE 4.39Å; L72-M75 HydrophobicContact CD1-CE 4.1Å; L72-M75 PolarHBondContact O-N 3.49Å; F73-M75 PolarHBondContact O-N 2.87Å; M75-G79 PolarHBondContact O-N 3.5Å
76	I	92.3	Very high	88.9	Confident	21 Å²	21	58.8 Å²	58.8	11%	0.108	31%	0.313	C	S	.	.	H	α-helix	trans	-72	-42.8	180	-63.5	161.7	0	0	0	110.5	L72 F73 S74 G79 L80 M98 T99 I102	L72-I76 HydrophobicContact CD1-CD1 3.89Å; L72-I76 HydrophobicContact CD1-CG1 4.29Å; L72-I76 HydrophobicContact CG-CD1 3.87Å; L72-I76 WeakPolarHBondContact O-CD1 3.4Å; L72-I76 VanDerWaalsContact O-CG1 3.26Å; L72-I76 WeakPolarHBondContact O-CG1 3.37Å; L72-I76 PolarHBondContact O-N 3.16Å; F73-I76 PolarHBondContact O-N 3.44Å; S74-I76 VanDerWaalsContact C-N 3.34Å; I76-G79 PolarHBondContact O-N 3.12Å; I76-L80 HydrophobicContact CG2-CD1 4.07Å; I76-L80 HydrophobicContact CG2-CG 4.31Å; I76-L80 WeakPolarHBondContact O-CG 3.39Å; I76-L80 PolarHBondContact O-N 3.02Å; I76-M98 HydrophobicContact CD1-CB 3.89Å; I76-M98 HydrophobicContact CD1-CE 4.46Å; I76-M98 HydrophobicContact CG1-CE 4.43Å; I76-M98 HydrophobicContact CG2-CB 4.21Å; I76-M98 HydrophobicContact CG2-CE 3.8Å; I76-M98 HydrophobicContact CG2-SD 3.77Å; I76-T99 WeakPolarHBondContact CD1-OG1 3.48Å; I76-I102 HydrophobicContact CD1-CD1 3.8Å
77	D	90.5	Very high	87.9	Confident	4 Å²	4	60.2 Å²	60.2	2%	0.021	32%	0.321	C	S	.	.	H	α-helix	trans	-60.4	-51.4	177.3	-168.5	51.9	0	0	0	111.3	R6 F73 G79 L80 V81 N91	R6-D77 IonicContact NH2-OD2 3.6Å; R6-D77 PolarHBondContact NH2-OD2 3.05Å; F73-D77 PolarHBondContact O-N 3.28Å; D77-G79 VanDerWaalsContact C-N 3.26Å; D77-G79 PolarHBondContact O-N 3.39Å; D77-L80 PolarHBondContact O-N 3.35Å; D77-L80 VanDerWaalsContact O-N 3.12Å; D77-V81 WeakPolarHBondContact O-CG2 3.45Å; D77-V81 PolarHBondContact O-N 3.44Å; D77-N91 WeakPolarHBondContact OD1-CB 3.35Å
78	C	88.4	Confident	87.2	Confident	15 Å²	15	62.4 Å²	62.4	10%	0.101	33%	0.33	C	S	.	.	H	α-helix	trans	-55.2	-40.8	173.6	-81.1	0	0	0	0	112.4	C9 S74 K82	C9-C78 HydrophobicContact CB-CB 3.84Å; C9-C78 WeakPolarHBondContact CB-SG 3.42Å; C9-C78 WeakPolarHBondContact SG-CB 3.12Å; C9-C78 CovalentContact SG-SG 2.04Å; C9-C78 PolarHBondContact SG-SG 3.13Å; S74-C78 WeakPolarHBondContact O-CB 3.29Å; S74-C78 PolarHBondContact O-N 3.42Å; S74-C78 PolarHBondContact O-SG 2.91Å; S74-C78 VanDerWaalsContact O-SG 3.36Å; C78-K82 WeakPolarHBondContact O-CB 3.38Å; C78-K82 PolarHBondContact O-N 3.47Å
79	G	86.4	Confident	86.6	Confident	34 Å²	34	60.8 Å²	60.8	35%	0.351	32%	0.321	S	S	.	.	H	α-helix	trans	-64.5	-44.7	176.5	0	0	0	0	0	112.6	M75 I76 D77 K82 V83	M75-G79 PolarHBondContact O-N 3.5Å; I76-G79 PolarHBondContact O-N 3.12Å; D77-G79 VanDerWaalsContact C-N 3.26Å; D77-G79 PolarHBondContact O-N 3.39Å; G79-K82 PolarHBondContact O-N 3.35Å; G79-V83 WeakPolarHBondContact O-CG2 3.44Å; G79-V83 PolarHBondContact O-N 2.85Å
80	L	85.9	Confident	86.2	Confident	36 Å²	36	64.4 Å²	64.4	19%	0.188	34%	0.335	C	S	.	.	H	α-helix	trans	-65.4	-42.2	178.4	-72.1	175.8	0	0	0	111.8	I76 D77 K82 V83 R84 T94	I76-L80 HydrophobicContact CG2-CD1 4.07Å; I76-L80 HydrophobicContact CG2-CG 4.31Å; I76-L80 WeakPolarHBondContact O-CG 3.39Å; I76-L80 PolarHBondContact O-N 3.02Å; D77-L80 PolarHBondContact O-N 3.35Å; D77-L80 VanDerWaalsContact O-N 3.12Å; L80-K82 VanDerWaalsContact C-N 3.34Å; L80-K82 PolarHBondContact O-N 2.87Å; L80-V83 PolarHBondContact O-N 2.83Å; L80-R84 WeakPolarHBondContact O-CB 3.22Å; L80-R84 PolarHBondContact O-N 2.9Å; L80-T94 HydrophobicContact CD1-CG2 4.24Å
81	V	85.2	Confident	86	Confident	33 Å²	33	64.3 Å²	64.3	20%	0.2	33%	0.333	C	S	.	.	H	α-helix	trans	-61.4	-44	175	174	0	0	0	0	110.6	D77 V83 G85 E87	D77-V81 WeakPolarHBondContact O-CG2 3.45Å; D77-V81 PolarHBondContact O-N 3.44Å; V81-V83 VanDerWaalsContact C-N 3.34Å; V81-V83 PolarHBondContact O-N 2.69Å; V81-G85 WeakPolarHBondContact O-CA 3.46Å; V81-G85 PolarHBondContact O-N 3.25Å; V81-E87 HydrophobicContact CG1-CG 4Å; V81-E87 HydrophobicContact CG2-CG 4.02Å
82	K	82.5	Confident	85.6	Confident	190 Å²	190	64.7 Å²	64.7	83%	0.826	34%	0.336	S	S	*	.	H	α-helix	trans	-63.3	-36.7	177.6	-175.6	168.1	-176.4	161.5	0	113.3	C78 G79 L80	C78-K82 WeakPolarHBondContact O-CB 3.38Å; C78-K82 PolarHBondContact O-N 3.47Å; G79-K82 PolarHBondContact O-N 3.35Å; L80-K82 VanDerWaalsContact C-N 3.34Å; L80-K82 PolarHBondContact O-N 2.87Å
83	V	83.7	Confident	85.5	Confident	126 Å²	126	65.1 Å²	65.1	76%	0.764	34%	0.338	S	S	*	.	H	α-helix	trans	-79.2	-40.6	-179.7	172	0	0	0	0	112	G79 L80 V81	G79-V83 WeakPolarHBondContact O-CG2 3.44Å; G79-V83 PolarHBondContact O-N 2.85Å; L80-V83 PolarHBondContact O-N 2.83Å; V81-V83 VanDerWaalsContact C-N 3.34Å; V81-V83 PolarHBondContact O-N 2.69Å
84	R	80.8	Confident	85.4	Confident	118 Å²	118	66 Å²	66	45%	0.445	35%	0.346	S	S	.	.	H	α-helix	trans	-93.1	-20.4	-172.7	-67	177.4	59.7	157.5	-6	113.8	L80 K86 D88	L80-R84 WeakPolarHBondContact O-CB 3.22Å; L80-R84 PolarHBondContact O-N 2.9Å; R84-K86 PolarHBondContact O-N 3.44Å; R84-K86 VanDerWaalsContact O-N 3.1Å; R84-D88 IonicContact NH2-OD2 3.67Å
85	G	75.1	Confident	85.4	Confident	68 Å²	68	66 Å²	66	70%	0.701	35%	0.346	S	S	*	.	S	Bend	trans	59.1	18.6	-176.1	0	0	0	0	0	113.8	V81	V81-G85 WeakPolarHBondContact O-CA 3.46Å; V81-G85 PolarHBondContact O-N 3.25Å
86	K	76.8	Confident	85.4	Confident	135 Å²	135	61.2 Å²	61.2	59%	0.587	32%	0.322	S	S	*	.			trans	-136.1	138.4	179.6	-64.9	-167.3	-179.6	75	0	109.3	R84 N91	R84-K86 PolarHBondContact O-N 3.44Å; R84-K86 VanDerWaalsContact O-N 3.1Å; K86-N91 PolarHBondContact O-ND2 2.95Å
87	E	74.3	Confident	85.6	Confident	122 Å²	122	61.4 Å²	61.4	57%	0.57	33%	0.327	S	S	*	.			trans	-103.3	96.3	174.5	-59.3	-158.8	149.3	0	0	109.1	R6 V81	R6-E87 IonicContact NE-OE1 3.98Å; R6-E87 IonicContact NE-OE2 2.93Å; V81-E87 HydrophobicContact CG1-CG 4Å; V81-E87 HydrophobicContact CG2-CG 4.02Å
88	D	81.8	Confident	85.7	Confident	64 Å²	64	64.9 Å²	64.9	34%	0.342	34%	0.344	S	S	.	.			trans	-114.3	154.2	177.4	-62.9	-51.1	0	0	0	109.9	R84 W90 N91	R84-D88 IonicContact NH2-OD2 3.67Å; D88-W90 HydrophobicContact CB-CB 4.33Å; D88-W90 PolarHBondContact O-N 3.41Å; D88-N91 WeakPolarHBondContact O-CB 3.36Å; D88-N91 PolarHBondContact O-N 2.96Å
89	P	83.2	Confident	86	Confident	54 Å²	54	64.2 Å²	64.2	35%	0.351	34%	0.339	S	S	.	.	H	α-helix	trans	-54	-24	171.9	-26.6	34.6	0	0	0	113.6	N91 S92 I93 E127 I131	P89-N91 PolarHBondContact O-N 2.82Å; P89-S92 PolarHBondContact O-N 3.22Å; P89-I93 WeakPolarHBondContact O-CG1 3.38Å; P89-I93 PolarHBondContact O-N 3.01Å; P89-I93 VanDerWaalsContact O-N 3.12Å; P89-E127 HydrophobicContact CB-CB 4.34Å; P89-I131 HydrophobicContact CG-CD1 4.19Å
90	W	84.8	Confident	86.4	Confident	166 Å²	166	63 Å²	63	63%	0.629	33%	0.327	S	S	*	.	H	α-helix	trans	-61.9	-28.3	172.8	-84.1	104.2	0	0	0	113.9	D88 T94	D88-W90 HydrophobicContact CB-CB 4.33Å; D88-W90 PolarHBondContact O-N 3.41Å; W90-T94 WeakPolarHBondContact O-CB 3.46Å; W90-T94 PolarHBondContact O-N 3Å; W90-T94 PolarHBondContact O-OG1 3.44Å
91	N	88.8	Confident	86.8	Confident	2 Å²	2	62.2 Å²	62.2	1%	0.011	33%	0.326	C	S	.	.	H	α-helix	trans	-66.8	-50	176.4	-67.2	-9.1	0	0	0	109.9	D77 K86 D88 P89 I93 T94 S95	D77-N91 WeakPolarHBondContact OD1-CB 3.35Å; K86-N91 PolarHBondContact O-ND2 2.95Å; D88-N91 WeakPolarHBondContact O-CB 3.36Å; D88-N91 PolarHBondContact O-N 2.96Å; P89-N91 PolarHBondContact O-N 2.82Å; N91-I93 PolarHBondContact O-N 3.34Å; N91-T94 PolarHBondContact O-N 3.42Å; N91-S95 VanDerWaalsContact O-CB 3.29Å; N91-S95 WeakPolarHBondContact O-CB 3.24Å; N91-S95 PolarHBondContact O-N 3.04Å; N91-S95 PolarHBondContact O-OG 2.9Å
92	S	86.5	Confident	87.3	Confident	12 Å²	12	64.7 Å²	64.7	8%	0.084	34%	0.337	C	S	.	.	H	α-helix	trans	-57.6	-45.6	174.7	-60.3	0	0	0	0	112.4	P89 T94 S95 G96 L123 E127	P89-S92 PolarHBondContact O-N 3.22Å; S92-T94 PolarHBondContact O-N 3.31Å; S92-S95 WeakPolarHBondContact CA-OG 3.36Å; S92-S95 PolarHBondContact O-OG 3.43Å; S92-G96 PolarHBondContact O-N 2.74Å; S92-L123 VanDerWaalsContact O-CD1 3.26Å; S92-L123 WeakPolarHBondContact O-CD1 3.21Å; S92-E127 WeakPolarHBondContact CB-OE1 3.48Å; S92-E127 PolarHBondContact OG-OE1 2.77Å
93	I	91.4	Very high	87.8	Confident	37 Å²	37	58.8 Å²	58.8	19%	0.19	31%	0.314	C	S	.	.	H	α-helix	trans	-64	-45.5	179.9	-64.2	168.3	0	0	0	110.8	P89 N91 G96 A97 A124	P89-I93 WeakPolarHBondContact O-CG1 3.38Å; P89-I93 PolarHBondContact O-N 3.01Å; P89-I93 VanDerWaalsContact O-N 3.12Å; N91-I93 PolarHBondContact O-N 3.34Å; I93-G96 PolarHBondContact O-N 3.07Å; I93-A97 PolarHBondContact O-N 2.92Å; I93-A124 HydrophobicContact CD1-CB 3.89Å; I93-A124 HydrophobicContact CG1-CB 4.01Å; I93-A124 HydrophobicContact CG2-CB 4.48Å
94	T	91.5	Very high	88.3	Confident	48 Å²	48	53.1 Å²	53.1	29%	0.294	28%	0.281	S	S	.	.	H	α-helix	trans	-68.8	-41.6	-178.5	-54	0	0	0	0	111.1	L80 W90 N91 S92 G96 A97 M98	L80-T94 HydrophobicContact CD1-CG2 4.24Å; W90-T94 WeakPolarHBondContact O-CB 3.46Å; W90-T94 PolarHBondContact O-N 3Å; W90-T94 PolarHBondContact O-OG1 3.44Å; N91-T94 PolarHBondContact O-N 3.42Å; S92-T94 PolarHBondContact O-N 3.31Å; T94-G96 VanDerWaalsContact C-N 3.34Å; T94-G96 PolarHBondContact O-N 3.23Å; T94-A97 PolarHBondContact O-N 3.02Å; T94-M98 HydrophobicContact CG2-CG 4.36Å; T94-M98 HydrophobicContact CG2-SD 4.12Å; T94-M98 WeakPolarHBondContact O-CB 3.08Å; T94-M98 VanDerWaalsContact O-CG 3.31Å; T94-M98 WeakPolarHBondContact O-CG 3.24Å; T94-M98 PolarHBondContact O-N 3.02Å
95	S	92	Very high	88.9	Confident	0 Å²	0	49.9 Å²	49.9	0%	0	28%	0.279	C	S	.	.	H	α-helix	trans	-66	-37	177.1	59.4	0	0	0	0	111.5	F73 N91 S92 M98 T99	F73-S95 WeakPolarHBondContact CD2-OG 3.37Å; F73-S95 WeakPolarHBondContact CE2-OG 3.43Å; N91-S95 VanDerWaalsContact O-CB 3.29Å; N91-S95 WeakPolarHBondContact O-CB 3.24Å; N91-S95 PolarHBondContact O-N 3.04Å; N91-S95 PolarHBondContact O-OG 2.9Å; S92-S95 WeakPolarHBondContact CA-OG 3.36Å; S92-S95 PolarHBondContact O-OG 3.43Å; S95-M98 PolarHBondContact O-N 2.91Å; S95-T99 VanDerWaalsContact O-CB 3.24Å; S95-T99 WeakPolarHBondContact O-CB 3.38Å; S95-T99 PolarHBondContact O-N 3.33Å; S95-T99 PolarHBondContact O-OG1 3.2Å
96	G	92.4	Very high	89.8	Confident	0 Å²	0	57.3 Å²	57.3	0%	0	29%	0.286	C	S	.	.	H	α-helix	trans	-61.7	-46.8	170.9	0	0	0	0	0	113.2	S92 I93 T94 T99 G100	S92-G96 PolarHBondContact O-N 2.74Å; I93-G96 PolarHBondContact O-N 3.07Å; T94-G96 VanDerWaalsContact C-N 3.34Å; T94-G96 PolarHBondContact O-N 3.23Å; G96-T99 PolarHBondContact O-N 3.25Å; G96-G100 PolarHBondContact O-N 3.47Å
97	A	94.8	Very high	90.6	Very high	26 Å²	26	56 Å²	56	22%	0.215	29%	0.285	C	S	.	.	H	α-helix	trans	-63.3	-45	176.7	0	0	0	0	0	111.9	I93 T94 G100 A101 A116	I93-A97 PolarHBondContact O-N 2.92Å; T94-A97 PolarHBondContact O-N 3.02Å; A97-G100 PolarHBondContact O-N 3.37Å; A97-A101 WeakPolarHBondContact O-CB 3.41Å; A97-A101 PolarHBondContact O-N 2.9Å; A97-A116 WeakPolarHBondContact CA-O 3.47Å; A97-A116 WeakPolarHBondContact O-CA 3.35Å; A97-A116 WeakPolarHBondContact O-CB 3.42Å
98	M	94.1	Very high	91.6	Very high	77 Å²	77	51.4 Å²	51.4	38%	0.379	27%	0.27	S	S	.	.	H	α-helix	trans	-64.6	-43.2	177.5	-74.9	-178.5	57.9	0	0	112.1	I76 T94 S95 G100 A101 I102	I76-M98 HydrophobicContact CD1-CB 3.89Å; I76-M98 HydrophobicContact CD1-CE 4.46Å; I76-M98 HydrophobicContact CG1-CE 4.43Å; I76-M98 HydrophobicContact CG2-CB 4.21Å; I76-M98 HydrophobicContact CG2-CE 3.8Å; I76-M98 HydrophobicContact CG2-SD 3.77Å; T94-M98 HydrophobicContact CG2-CG 4.36Å; T94-M98 HydrophobicContact CG2-SD 4.12Å; T94-M98 WeakPolarHBondContact O-CB 3.08Å; T94-M98 VanDerWaalsContact O-CG 3.31Å; T94-M98 WeakPolarHBondContact O-CG 3.24Å; T94-M98 PolarHBondContact O-N 3.02Å; S95-M98 PolarHBondContact O-N 2.91Å; M98-G100 VanDerWaalsContact C-N 3.33Å; M98-G100 PolarHBondContact O-N 2.93Å; M98-A101 PolarHBondContact O-N 3.39Å; M98-I102 WeakPolarHBondContact O-CB 3.48Å; M98-I102 WeakPolarHBondContact O-CD1 3.29Å; M98-I102 VanDerWaalsContact O-CG1 3.25Å; M98-I102 WeakPolarHBondContact O-CG1 3.34Å; M98-I102 PolarHBondContact O-N 2.79Å
99	T	94.6	Very high	92.1	Very high	0 Å²	0	53.2 Å²	53.2	0%	0	29%	0.286	C	S	.	.	H	α-helix	trans	-58	-48.2	175.6	-60.5	0	0	0	0	110.4	W69 L72 F73 I76 S95 G96 A101 I102 L103	W69-T99 HydrophobicContact CG-CG2 4.18Å; L72-T99 HydrophobicContact CB-CG2 4.08Å; L72-T99 HydrophobicContact CD2-CG2 3.97Å; L72-T99 HydrophobicContact CG-CG2 4.03Å; F73-T99 VanDerWaalsContact CA-OG1 3.25Å; F73-T99 WeakPolarHBondContact CA-OG1 3.3Å; F73-T99 HydrophobicContact CB-CG2 4.41Å; F73-T99 PolarHBondContact N-OG1 2.89Å; I76-T99 WeakPolarHBondContact CD1-OG1 3.48Å; S95-T99 VanDerWaalsContact O-CB 3.24Å; S95-T99 WeakPolarHBondContact O-CB 3.38Å; S95-T99 PolarHBondContact O-N 3.33Å; S95-T99 PolarHBondContact O-OG1 3.2Å; G96-T99 PolarHBondContact O-N 3.25Å; T99-A101 PolarHBondContact O-N 3.34Å; T99-I102 PolarHBondContact O-N 2.83Å; T99-L103 HydrophobicContact CG2-CD1 3.99Å; T99-L103 VanDerWaalsContact O-CG 3.28Å; T99-L103 WeakPolarHBondContact O-CG 3.06Å; T99-L103 PolarHBondContact O-N 2.9Å
100	G	93.5	Very high	92.7	Very high	9 Å²	9	56.8 Å²	56.8	9%	0.093	31%	0.306	C	S	.	.	H	α-helix	trans	-57.2	-48.3	175.5	0	0	0	0	0	112.2	G96 A97 M98 I102 A104 S115	G96-G100 PolarHBondContact O-N 3.47Å; A97-G100 PolarHBondContact O-N 3.37Å; M98-G100 VanDerWaalsContact C-N 3.33Å; M98-G100 PolarHBondContact O-N 2.93Å; G100-I102 PolarHBondContact O-N 3.29Å; G100-A104 PolarHBondContact O-N 2.92Å; G100-S115 VanDerWaalsContact O-CB 3.31Å; G100-S115 WeakPolarHBondContact O-CB 3.43Å; G100-S115 PolarHBondContact O-OG 3.19Å
101	A	95.3	Very high	93.2	Very high	20 Å²	20	50.6 Å²	50.6	17%	0.165	29%	0.29	C	S	.	.	H	α-helix	trans	-59	-48.8	179.4	0	0	0	0	0	112	A97 M98 T99 L103 A104 A105 A116	A97-A101 WeakPolarHBondContact O-CB 3.41Å; A97-A101 PolarHBondContact O-N 2.9Å; M98-A101 PolarHBondContact O-N 3.39Å; T99-A101 PolarHBondContact O-N 3.34Å; A101-L103 PolarHBondContact O-N 3.47Å; A101-A104 CarbonylContact O-C 3.54Å; A101-A104 PolarHBondContact O-N 3.45Å; A101-A105 PolarHBondContact O-N 3.21Å; A101-A116 HydrophobicContact CB-CB 3.98Å
102	I	95.5	Very high	93.5	Very high	84 Å²	84	53.6 Å²	53.6	43%	0.431	31%	0.305	S	S	.	.	H	α-helix	trans	-64.3	-43.8	-176.4	-69.7	163.2	0	0	0	110.8	L72 I76 M98 T99 G100 A104 A105	L72-I102 HydrophobicContact CD1-CD1 4.32Å; L72-I102 HydrophobicContact CD2-CB 3.89Å; L72-I102 HydrophobicContact CD2-CD1 4.42Å; L72-I102 HydrophobicContact CD2-CG2 3.62Å; I76-I102 HydrophobicContact CD1-CD1 3.8Å; M98-I102 WeakPolarHBondContact O-CB 3.48Å; M98-I102 WeakPolarHBondContact O-CD1 3.29Å; M98-I102 VanDerWaalsContact O-CG1 3.25Å; M98-I102 WeakPolarHBondContact O-CG1 3.34Å; M98-I102 PolarHBondContact O-N 2.79Å; T99-I102 PolarHBondContact O-N 2.83Å; G100-I102 PolarHBondContact O-N 3.29Å; I102-A104 VanDerWaalsContact C-N 3.25Å; I102-A104 PolarHBondContact O-N 2.91Å; I102-A105 WeakPolarHBondContact O-CB 3.14Å; I102-A105 PolarHBondContact O-N 3.45Å; I102-A105 VanDerWaalsContact O-N 3.15Å
103	L	93.9	Very high	93.9	Very high	67 Å²	67	57.9 Å²	57.9	35%	0.351	33%	0.331	S	S	.	.	H	α-helix	trans	-67.3	-27.6	-179.7	-65.4	176.2	0	0	0	113.1	V68 W69 L72 T99 A101	V68-L103 HydrophobicContact CG1-CD2 3.67Å; W69-L103 HydrophobicContact CB-CD1 4.18Å; W69-L103 HydrophobicContact CG-CD1 4.32Å; L72-L103 HydrophobicContact CD2-CD2 3.87Å; L72-L103 HydrophobicContact CD2-CG 3.93Å; T99-L103 HydrophobicContact CG2-CD1 3.99Å; T99-L103 VanDerWaalsContact O-CG 3.28Å; T99-L103 WeakPolarHBondContact O-CG 3.06Å; T99-L103 PolarHBondContact O-N 2.9Å; A101-L103 PolarHBondContact O-N 3.47Å
104	A	94.3	Very high	94.1	Very high	7 Å²	7	58.2 Å²	58.2	6%	0.058	34%	0.343	C	S	.	.	T	Hydrogen-bonded Turn	trans	-93.2	0.9	176.1	0	0	0	0	0	113.7	G100 A101 I102 R106 N107 A111 S115	G100-A104 PolarHBondContact O-N 2.92Å; A101-A104 CarbonylContact O-C 3.54Å; A101-A104 PolarHBondContact O-N 3.45Å; I102-A104 VanDerWaalsContact C-N 3.25Å; I102-A104 PolarHBondContact O-N 2.91Å; A104-R106 PolarHBondContact O-N 2.91Å; A104-R106 VanDerWaalsContact O-N 3.14Å; A104-N107 WeakPolarHBondContact O-CB 3.29Å; A104-N107 PolarHBondContact O-N 3.47Å; A104-A111 HydrophobicContact CB-CB 4.37Å; A104-S115 WeakPolarHBondContact CB-OG 3.24Å
105	A	93.4	Very high	94.3	Very high	49 Å²	49	57 Å²	57	41%	0.405	34%	0.337	S	S	.	.	G	3₁₀ helix	trans	-53.4	-39.9	-175.1	0	0	0	0	0	113.3	A101 I102 N107 G108 M112	A101-A105 PolarHBondContact O-N 3.21Å; I102-A105 WeakPolarHBondContact O-CB 3.14Å; I102-A105 PolarHBondContact O-N 3.45Å; I102-A105 VanDerWaalsContact O-N 3.15Å; A105-N107 PolarHBondContact O-N 3.33Å; A105-G108 PolarHBondContact O-N 2.77Å; A105-M112 HydrophobicContact CB-CE 4.24Å; A105-M112 HydrophobicContact CB-CG 4.42Å; A105-M112 HydrophobicContact CB-SD 4.19Å
106	R	93.4	Very high	94.4	Very high	224 Å²	224	58.1 Å²	58.1	85%	0.845	35%	0.345	S	S	*	.	G	3₁₀ helix	trans	-70.3	-16.4	178.6	70.7	179	-176.2	-174.5	-2	114.8	A104 G108	A104-R106 PolarHBondContact O-N 2.91Å; A104-R106 VanDerWaalsContact O-N 3.14Å; R106-G108 VanDerWaalsContact C-N 3.33Å
107	N	93.3	Very high	94.5	Very high	108 Å²	108	60.5 Å²	60.5	58%	0.578	37%	0.366	S	S	*	.	G	3₁₀ helix	trans	-92.4	2.6	-177.9	-58.6	-36.8	0	0	0	112.2	A104 A105 A111	A104-N107 WeakPolarHBondContact O-CB 3.29Å; A104-N107 PolarHBondContact O-N 3.47Å; A105-N107 PolarHBondContact O-N 3.33Å; N107-A111 HydrophobicContact CB-CB 3.55Å
108	G	94.4	Very high	94.5	Very high	25 Å²	25	65.2 Å²	65.2	26%	0.258	38%	0.384	S	S	.	.			trans	95.5	168.1	176.9	0	0	0	0	0	114.5	A105 R106 V110 A111 M112	A105-G108 PolarHBondContact O-N 2.77Å; R106-G108 VanDerWaalsContact C-N 3.33Å; G108-V110 VanDerWaalsContact C-N 3.34Å; G108-V110 PolarHBondContact O-N 3.47Å; G108-A111 PolarHBondContact O-N 2.98Å; G108-A111 VanDerWaalsContact O-N 3.15Å; G108-M112 WeakPolarHBondContact O-CG 3.39Å; G108-M112 PolarHBondContact O-N 3.26Å; G108-M112 VanDerWaalsContact O-N 3.09Å
109	P	93.8	Very high	94.3	Very high	103 Å²	103	62 Å²	62	67%	0.669	37%	0.371	S	S	*	.	H	α-helix	trans	-61.5	-36.8	-169	-24.8	34.2	0	0	0	114.3	M112 V113	P109-M112 WeakPolarHBondContact O-CB 3.37Å; P109-M112 PolarHBondContact O-N 3.12Å; P109-V113 WeakPolarHBondContact O-CG2 3.3Å; P109-V113 PolarHBondContact O-N 2.91Å
110	V	95.4	Very high	94.2	Very high	129 Å²	129	62.4 Å²	62.4	78%	0.782	38%	0.376	S	S	*	.	H	α-helix	trans	-65.4	-42	179	179.4	0	0	0	0	110.9	G108 M112 V113 G114	G108-V110 VanDerWaalsContact C-N 3.34Å; G108-V110 PolarHBondContact O-N 3.47Å; V110-M112 VanDerWaalsContact C-N 3.33Å; V110-V113 PolarHBondContact O-N 3.33Å; V110-G114 PolarHBondContact O-N 2.87Å
111	A	94.4	Very high	94.3	Very high	35 Å²	35	67 Å²	67	29%	0.289	40%	0.397	S	S	.	.	H	α-helix	trans	-66.2	-37.1	176.8	0	0	0	0	0	111.6	A104 N107 G108 G114 S115	A104-A111 HydrophobicContact CB-CB 4.37Å; N107-A111 HydrophobicContact CB-CB 3.55Å; G108-A111 PolarHBondContact O-N 2.98Å; G108-A111 VanDerWaalsContact O-N 3.15Å; A111-G114 PolarHBondContact O-N 3.45Å; A111-S115 WeakPolarHBondContact O-CB 3.41Å; A111-S115 PolarHBondContact O-N 2.96Å; A111-S115 PolarHBondContact O-OG 2.86Å; A111-S115 VanDerWaalsContact O-OG 3.06Å
112	M	95.6	Very high	94.1	Very high	65 Å²	65	70.6 Å²	70.6	32%	0.32	41%	0.413	S	S	.	.	H	α-helix	trans	-60.9	-47.8	174.5	-66.3	175.2	69.1	0	0	112.5	A105 G108 P109 V110 S115 A116	A105-M112 HydrophobicContact CB-CE 4.24Å; A105-M112 HydrophobicContact CB-CG 4.42Å; A105-M112 HydrophobicContact CB-SD 4.19Å; G108-M112 WeakPolarHBondContact O-CG 3.39Å; G108-M112 PolarHBondContact O-N 3.26Å; G108-M112 VanDerWaalsContact O-N 3.09Å; P109-M112 WeakPolarHBondContact O-CB 3.37Å; P109-M112 PolarHBondContact O-N 3.12Å; V110-M112 VanDerWaalsContact C-N 3.33Å; M112-S115 PolarHBondContact O-OG 2.86Å; M112-A116 WeakPolarHBondContact O-CB 3.22Å; M112-A116 PolarHBondContact O-N 3.08Å
113	V	95.7	Very high	94	Very high	103 Å²	103	67.2 Å²	67.2	62%	0.624	40%	0.396	S	S	*	.	H	α-helix	trans	-66.1	-42.5	179.7	175.3	0	0	0	0	110.3	P109 V110 A116 A117	P109-V113 WeakPolarHBondContact O-CG2 3.3Å; P109-V113 PolarHBondContact O-N 2.91Å; V110-V113 PolarHBondContact O-N 3.33Å; V113-A116 PolarHBondContact O-N 3.42Å; V113-A117 WeakPolarHBondContact O-CB 3.39Å; V113-A117 PolarHBondContact O-N 3.46Å
114	G	94.9	Very high	93.9	Very high	43 Å²	43	65.9 Å²	65.9	44%	0.443	39%	0.394	S	S	.	.	H	α-helix	trans	-61.4	-45.3	177.2	0	0	0	0	0	113.1	V110 A111 M118	V110-G114 PolarHBondContact O-N 2.87Å; A111-G114 PolarHBondContact O-N 3.45Å; G114-M118 PolarHBondContact O-N 2.98Å
115	S	94.8	Very high	93.7	Very high	24 Å²	24	71.1 Å²	71.1	17%	0.168	42%	0.421	C	S	.	.	H	α-helix	trans	-70.9	-36	178.2	64.6	0	0	0	0	112.6	G100 A104 A111 M112 M118 G119	G100-S115 VanDerWaalsContact O-CB 3.31Å; G100-S115 WeakPolarHBondContact O-CB 3.43Å; G100-S115 PolarHBondContact O-OG 3.19Å; A104-S115 WeakPolarHBondContact CB-OG 3.24Å; A111-S115 WeakPolarHBondContact O-CB 3.41Å; A111-S115 PolarHBondContact O-N 2.96Å; A111-S115 PolarHBondContact O-OG 2.86Å; A111-S115 VanDerWaalsContact O-OG 3.06Å; M112-S115 PolarHBondContact O-OG 2.86Å; S115-M118 PolarHBondContact O-N 3.11Å; S115-G119 PolarHBondContact O-N 3.37Å
116	A	94.3	Very high	93.6	Very high	22 Å²	22	74 Å²	74	18%	0.182	43%	0.428	C	S	.	.	H	α-helix	trans	-62.8	-45.8	174.8	0	0	0	0	0	111.4	A97 A101 M112 V113 G119 G120	A97-A116 WeakPolarHBondContact CA-O 3.47Å; A97-A116 WeakPolarHBondContact O-CA 3.35Å; A97-A116 WeakPolarHBondContact O-CB 3.42Å; A101-A116 HydrophobicContact CB-CB 3.98Å; M112-A116 WeakPolarHBondContact O-CB 3.22Å; M112-A116 PolarHBondContact O-N 3.08Å; V113-A116 PolarHBondContact O-N 3.42Å; A116-G119 PolarHBondContact O-N 2.93Å; A116-G120 PolarHBondContact O-N 2.82Å
117	A	95.4	Very high	93.3	Very high	51 Å²	51	66.3 Å²	66.3	42%	0.421	40%	0.402	S	S	.	.	H	α-helix	trans	-60.6	-47.5	176.3	0	0	0	0	0	111.1	V113 G119 G120 I121	V113-A117 WeakPolarHBondContact O-CB 3.39Å; V113-A117 PolarHBondContact O-N 3.46Å; A117-G119 PolarHBondContact O-N 3.46Å; A117-G120 PolarHBondContact O-N 3.47Å; A117-I121 WeakPolarHBondContact O-CB 3.47Å; A117-I121 WeakPolarHBondContact O-CD1 3.31Å; A117-I121 WeakPolarHBondContact O-CG1 3.17Å; A117-I121 PolarHBondContact O-N 2.92Å
118	M	93.8	Very high	93	Very high	124 Å²	124	63 Å²	63	61%	0.611	39%	0.393	S	S	*	.	H	α-helix	trans	-62.7	-44.4	178.5	-169.9	162	71.4	0	0	112.1	G114 S115 L122	G114-M118 PolarHBondContact O-N 2.98Å; S115-M118 PolarHBondContact O-N 3.11Å; M118-L122 HydrophobicContact CG-CD1 4.02Å; M118-L122 HydrophobicContact CG-CG 4.49Å; M118-L122 WeakPolarHBondContact O-CB 3.39Å; M118-L122 VanDerWaalsContact O-CG 3.22Å; M118-L122 WeakPolarHBondContact O-CG 3.45Å; M118-L122 PolarHBondContact O-N 2.95Å
119	G	91.3	Very high	92.7	Very high	9 Å²	9	64 Å²	64	9%	0.093	40%	0.399	C	S	.	.	H	α-helix	trans	-62.4	-45.3	176.9	0	0	0	0	0	113	S115 A116 A117 L123	S115-G119 PolarHBondContact O-N 3.37Å; A116-G119 PolarHBondContact O-N 2.93Å; A117-G119 PolarHBondContact O-N 3.46Å; G119-L123 PolarHBondContact O-N 3.33Å; G119-L123 VanDerWaalsContact O-N 3.16Å
120	G	92.5	Very high	92.3	Very high	10 Å²	10	60.6 Å²	60.6	10%	0.103	38%	0.382	C	S	.	.	H	α-helix	trans	-64.8	-44	177.6	0	0	0	0	0	112.9	A116 A117 L123 A124	A116-G120 PolarHBondContact O-N 2.82Å; A117-G120 PolarHBondContact O-N 3.47Å; G120-L123 PolarHBondContact O-N 3.47Å; G120-A124 VanDerWaalsContact O-CB 3.25Å; G120-A124 WeakPolarHBondContact O-CB 3.32Å; G120-A124 PolarHBondContact O-N 2.87Å
121	I	94.2	Very high	91.9	Very high	104 Å²	104	58.7 Å²	58.7	53%	0.533	37%	0.367	S	S	.	.	H	α-helix	trans	-63.5	-46.1	177.9	-69	165.3	0	0	0	110.8	A117 L123 A124 L125	A117-I121 WeakPolarHBondContact O-CB 3.47Å; A117-I121 WeakPolarHBondContact O-CD1 3.31Å; A117-I121 WeakPolarHBondContact O-CG1 3.17Å; A117-I121 PolarHBondContact O-N 2.92Å; I121-L123 PolarHBondContact O-N 3.01Å; I121-A124 PolarHBondContact O-N 2.95Å; I121-L125 HydrophobicContact CG2-CD1 4.21Å; I121-L125 WeakPolarHBondContact O-CG 3.43Å; I121-L125 PolarHBondContact O-N 2.88Å
122	L	92.8	Very high	91.4	Very high	96 Å²	96	62.9 Å²	62.9	50%	0.503	38%	0.384	S	S	.	.	H	α-helix	trans	-60.4	-44.9	-179.4	-74.8	171.6	0	0	0	111.8	M118 L125 I126	M118-L122 HydrophobicContact CG-CD1 4.02Å; M118-L122 HydrophobicContact CG-CG 4.49Å; M118-L122 WeakPolarHBondContact O-CB 3.39Å; M118-L122 VanDerWaalsContact O-CG 3.22Å; M118-L122 WeakPolarHBondContact O-CG 3.45Å; M118-L122 PolarHBondContact O-N 2.95Å; L122-L125 PolarHBondContact O-N 2.98Å; L122-I126 WeakPolarHBondContact O-CG1 3.26Å; L122-I126 PolarHBondContact O-N 3.25Å
123	L	91.9	Very high	91	Very high	14 Å²	14	65.6 Å²	65.6	7%	0.073	40%	0.399	C	S	.	.	H	α-helix	trans	-75.4	-30.1	179.4	-63.2	-155.7	0	0	0	112.9	W69 F73 S92 G119 G120 I121 L125 I126 E127	W69-L123 HydrophobicContact CH2-CD2 4.41Å; F73-L123 HydrophobicContact CD2-CD1 3.73Å; F73-L123 HydrophobicContact CE2-CD1 3.1Å; F73-L123 HydrophobicContact CZ-CD1 3.81Å; S92-L123 VanDerWaalsContact O-CD1 3.26Å; S92-L123 WeakPolarHBondContact O-CD1 3.21Å; G119-L123 PolarHBondContact O-N 3.33Å; G119-L123 VanDerWaalsContact O-N 3.16Å; G120-L123 PolarHBondContact O-N 3.47Å; I121-L123 PolarHBondContact O-N 3.01Å; L123-L125 VanDerWaalsContact C-N 3.27Å; L123-L125 PolarHBondContact O-N 3.49Å; L123-I126 HydrophobicContact CD2-CD1 3.67Å; L123-I126 PolarHBondContact O-N 2.88Å; L123-E127 WeakPolarHBondContact O-CB 3.3Å; L123-E127 WeakPolarHBondContact O-CG 3.29Å; L123-E127 PolarHBondContact O-N 2.62Å
124	A	91.9	Very high	90.4	Very high	39 Å²	39	65.4 Å²	65.4	32%	0.322	40%	0.398	S	S	.	.	H	α-helix	trans	-61	-38.7	170.3	0	0	0	0	0	111.8	I93 G120 I121 G128	I93-A124 HydrophobicContact CD1-CB 3.89Å; I93-A124 HydrophobicContact CG1-CB 4.01Å; I93-A124 HydrophobicContact CG2-CB 4.48Å; G120-A124 VanDerWaalsContact O-CB 3.25Å; G120-A124 WeakPolarHBondContact O-CB 3.32Å; G120-A124 PolarHBondContact O-N 2.87Å; I121-A124 PolarHBondContact O-N 2.95Å; A124-G128 WeakPolarHBondContact O-CA 3.36Å; A124-G128 PolarHBondContact O-N 3.37Å
125	L	91.5	Very high	89.8	Confident	117 Å²	117	72 Å²	72	61%	0.613	41%	0.41	S	S	*	.	H	α-helix	trans	-68.9	-40.4	174.5	-69.1	174	0	0	0	112.2	I121 L122 L123 A129	I121-L125 HydrophobicContact CG2-CD1 4.21Å; I121-L125 WeakPolarHBondContact O-CG 3.43Å; I121-L125 PolarHBondContact O-N 2.88Å; L122-L125 PolarHBondContact O-N 2.98Å; L123-L125 VanDerWaalsContact C-N 3.27Å; L123-L125 PolarHBondContact O-N 3.49Å; L125-A129 WeakPolarHBondContact O-CB 3.41Å; L125-A129 PolarHBondContact O-N 2.78Å
126	I	90.4	Very high	89.1	Confident	109 Å²	109	77 Å²	77	56%	0.559	43%	0.429	S	S	*	.	H	α-helix	trans	-65.7	-49.7	179.1	-71.2	164.8	0	0	0	111	L122 L123 A129 G130	L122-I126 WeakPolarHBondContact O-CG1 3.26Å; L122-I126 PolarHBondContact O-N 3.25Å; L123-I126 HydrophobicContact CD2-CD1 3.67Å; L123-I126 PolarHBondContact O-N 2.88Å; I126-A129 PolarHBondContact O-N 3.49Å; I126-G130 PolarHBondContact O-N 3.43Å
127	E	88	Confident	88.4	Confident	62 Å²	62	78.4 Å²	78.4	29%	0.29	44%	0.44	S	S	.	.	H	α-helix	trans	-65.2	-41	177.1	-67.1	-66.6	167.3	0	0	111.4	P89 S92 L123 A129 G130 I131	P89-E127 HydrophobicContact CB-CB 4.34Å; S92-E127 WeakPolarHBondContact CB-OE1 3.48Å; S92-E127 PolarHBondContact OG-OE1 2.77Å; L123-E127 WeakPolarHBondContact O-CB 3.3Å; L123-E127 WeakPolarHBondContact O-CG 3.29Å; L123-E127 PolarHBondContact O-N 2.62Å; E127-A129 PolarHBondContact O-N 3.43Å; E127-G130 PolarHBondContact O-N 3.34Å; E127-I131 WeakPolarHBondContact O-CG1 3.3Å; E127-I131 PolarHBondContact O-N 2.95Å
128	G	86.6	Confident	87.2	Confident	38 Å²	38	79.2 Å²	79.2	39%	0.392	44%	0.443	S	S	.	.	H	α-helix	trans	-61.7	-42.1	176	0	0	0	0	0	112.9	A124 L132	A124-G128 WeakPolarHBondContact O-CA 3.36Å; A124-G128 PolarHBondContact O-N 3.37Å; G128-L132 PolarHBondContact O-N 2.82Å; G128-L132 VanDerWaalsContact O-N 3.08Å
129	A	88	Confident	85.7	Confident	47 Å²	47	76.8 Å²	76.8	39%	0.388	44%	0.438	S	S	.	.	H	α-helix	trans	-66.8	-39	173.5	0	0	0	0	0	111.7	L125 I126 E127 L132 L133	L125-A129 WeakPolarHBondContact O-CB 3.41Å; L125-A129 PolarHBondContact O-N 2.78Å; I126-A129 PolarHBondContact O-N 3.49Å; E127-A129 PolarHBondContact O-N 3.43Å; A129-L132 PolarHBondContact O-N 3.49Å; A129-L133 WeakPolarHBondContact O-CB 3.35Å; A129-L133 VanDerWaalsContact O-CG 3.3Å; A129-L133 WeakPolarHBondContact O-CG 3.44Å; A129-L133 PolarHBondContact O-N 2.92Å
130	G	85.8	Confident	84.3	Confident	31 Å²	31	82.3 Å²	82.3	32%	0.32	46%	0.461	S	S	.	.	H	α-helix	trans	-57.8	-48.9	174.3	0	0	0	0	0	112.1	I126 E127 L132 L133 T134	I126-G130 PolarHBondContact O-N 3.43Å; E127-G130 PolarHBondContact O-N 3.34Å; G130-L132 VanDerWaalsContact C-N 3.33Å; G130-L132 PolarHBondContact O-N 3.25Å; G130-L133 PolarHBondContact O-N 3.45Å; G130-T134 WeakPolarHBondContact O-CB 3.48Å; G130-T134 PolarHBondContact O-N 3.15Å; G130-T134 PolarHBondContact O-OG1 2.8Å; G130-T134 VanDerWaalsContact O-OG1 3.11Å
131	I	86.3	Confident	82.5	Confident	90 Å²	90	89.6 Å²	89.6	46%	0.462	49%	0.491	S	S	.	.	H	α-helix	trans	-60.1	-44.4	176.2	-65.5	166.2	0	0	0	110.8	P89 E127 T134 R135	P89-I131 HydrophobicContact CG-CD1 4.19Å; E127-I131 WeakPolarHBondContact O-CG1 3.3Å; E127-I131 PolarHBondContact O-N 2.95Å; I131-T134 PolarHBondContact O-N 3.42Å; I131-R135 HydrophobicContact CG2-CG 4.35Å; I131-R135 WeakPolarHBondContact O-CB 3.34Å; I131-R135 WeakPolarHBondContact O-CG 3.43Å; I131-R135 PolarHBondContact O-N 2.89Å
132	L	84.4	Confident	80.6	Confident	123 Å²	123	90.2 Å²	90.2	64%	0.644	50%	0.502	S	S	*	.	H	α-helix	trans	-64.4	-44.1	-179.8	-177.2	63.3	0	0	0	112.3	G128 A129 G130 R135 F136	G128-L132 PolarHBondContact O-N 2.82Å; G128-L132 VanDerWaalsContact O-N 3.08Å; A129-L132 PolarHBondContact O-N 3.49Å; G130-L132 VanDerWaalsContact C-N 3.33Å; G130-L132 PolarHBondContact O-N 3.25Å; L132-R135 PolarHBondContact O-N 2.83Å; L132-F136 WeakPolarHBondContact O-CB 3.27Å; L132-F136 PolarHBondContact O-N 3.11Å
133	L	85.8	Confident	78.7	Confident	122 Å²	122	92.2 Å²	92.2	64%	0.639	52%	0.518	S	S	*	.	H	α-helix	trans	-64.5	-43.7	177.8	-73.1	172.3	0	0	0	111.3	A129 G130 R135 F136 A137	A129-L133 WeakPolarHBondContact O-CB 3.35Å; A129-L133 VanDerWaalsContact O-CG 3.3Å; A129-L133 WeakPolarHBondContact O-CG 3.44Å; A129-L133 PolarHBondContact O-N 2.92Å; G130-L133 PolarHBondContact O-N 3.45Å; L133-R135 VanDerWaalsContact C-N 3.33Å; L133-R135 PolarHBondContact O-N 2.63Å; L133-F136 PolarHBondContact O-N 3.27Å; L133-A137 WeakPolarHBondContact O-CB 3.44Å; L133-A137 PolarHBondContact O-N 3.44Å
134	T	84.3	Confident	76.6	Confident	98 Å²	98	94.3 Å²	94.3	60%	0.601	54%	0.543	S	S	*	.	H	α-helix	trans	-62.6	-41.1	175.5	-62.5	0	0	0	0	111.2	G130 I131 A137 S138	G130-T134 WeakPolarHBondContact O-CB 3.48Å; G130-T134 PolarHBondContact O-N 3.15Å; G130-T134 PolarHBondContact O-OG1 2.8Å; G130-T134 VanDerWaalsContact O-OG1 3.11Å; I131-T134 PolarHBondContact O-N 3.42Å; T134-A137 PolarHBondContact O-N 3.08Å; T134-S138 WeakPolarHBondContact O-CB 3.35Å; T134-S138 PolarHBondContact O-N 2.9Å; T134-S138 PolarHBondContact O-OG 3.29Å
135	R	81.6	Confident	74.5	Confident	182 Å²	182	97.4 Å²	97.4	69%	0.687	56%	0.559	S	S	*	*	H	α-helix	trans	-62.3	-45.5	174.8	-73.2	-74.7	-175.9	176.3	0.1	111.7	I131 L132 L133 S138 S139	I131-R135 HydrophobicContact CG2-CG 4.35Å; I131-R135 WeakPolarHBondContact O-CB 3.34Å; I131-R135 WeakPolarHBondContact O-CG 3.43Å; I131-R135 PolarHBondContact O-N 2.89Å; L132-R135 PolarHBondContact O-N 2.83Å; L133-R135 VanDerWaalsContact C-N 3.33Å; L133-R135 PolarHBondContact O-N 2.63Å; R135-S138 WeakPolarHBondContact CA-OG 3.36Å; R135-S138 PolarHBondContact O-N 3.05Å; R135-S138 PolarHBondContact O-OG 3.38Å; R135-S139 PolarHBondContact O-N 2.73Å
136	F	80.6	Confident	72.4	Confident	129 Å²	129	101.2 Å²	101.2	57%	0.566	57%	0.574	S	S	*	*	H	α-helix	trans	-64.4	-45.8	177.4	-171	-99.8	0	0	0	111.8	L132 L133 S138 S139 Q140	L132-F136 WeakPolarHBondContact O-CB 3.27Å; L132-F136 PolarHBondContact O-N 3.11Å; L133-F136 PolarHBondContact O-N 3.27Å; F136-S138 VanDerWaalsContact C-N 3.33Å; F136-S138 PolarHBondContact O-N 3.08Å; F136-S139 PolarHBondContact O-N 3.41Å; F136-S139 VanDerWaalsContact O-N 3.08Å; F136-S139 PolarHBondContact O-OG 3.09Å; F136-Q140 HydrophobicContact CD1-CG 4.44Å; F136-Q140 HydrophobicContact CE1-CG 4.18Å; F136-Q140 WeakPolarHBondContact O-CG 3.46Å; F136-Q140 PolarHBondContact O-N 3.46Å
137	A	80.3	Confident	69.9	Low	52 Å²	52	104.7 Å²	104.7	43%	0.43	59%	0.586	S	S	.	*	H	α-helix	trans	-60.3	-41.7	175.6	0	0	0	0	0	112.1	L133 T134 S139 Q140 F141	L133-A137 WeakPolarHBondContact O-CB 3.44Å; L133-A137 PolarHBondContact O-N 3.44Å; T134-A137 PolarHBondContact O-N 3.08Å; A137-S139 VanDerWaalsContact C-N 3.26Å; A137-S139 PolarHBondContact O-N 3.38Å; A137-Q140 PolarHBondContact O-N 3.29Å; A137-Q140 VanDerWaalsContact O-N 3.11Å; A137-F141 PolarHBondContact O-N 3.34Å
138	S	68.4	Low	67.4	Low	67 Å²	67	106.4 Å²	106.4	47%	0.469	61%	0.61	S	S	.	*	H	α-helix	trans	-65.4	-27	175.6	71.8	0	0	0	0	113.3	T134 R135 F136 Q140 F141	T134-S138 WeakPolarHBondContact O-CB 3.35Å; T134-S138 PolarHBondContact O-N 2.9Å; T134-S138 PolarHBondContact O-OG 3.29Å; R135-S138 WeakPolarHBondContact CA-OG 3.36Å; R135-S138 PolarHBondContact O-N 3.05Å; R135-S138 PolarHBondContact O-OG 3.38Å; F136-S138 VanDerWaalsContact C-N 3.33Å; F136-S138 PolarHBondContact O-N 3.08Å; S138-Q140 VanDerWaalsContact C-N 3.32Å; S138-F141 CarbonylContact O-C 3.57Å; S138-F141 VanDerWaalsContact O-O 3.08Å
139	S	63.1	Low	65.2	Low	74 Å²	74	112.8 Å²	112.8	52%	0.517	63%	0.63	S	S	.	*	H	α-helix	trans	-77.1	-18.1	174.6	74.2	0	0	0	0	113.6	R135 F136 A137	R135-S139 PolarHBondContact O-N 2.73Å; F136-S139 PolarHBondContact O-N 3.41Å; F136-S139 VanDerWaalsContact O-N 3.08Å; F136-S139 PolarHBondContact O-OG 3.09Å; A137-S139 VanDerWaalsContact C-N 3.26Å; A137-S139 PolarHBondContact O-N 3.38Å
140	Q	61.4	Low	62.8	Low	124 Å²	124	118.7 Å²	118.7	58%	0.579	65%	0.65	S	S	*	*	H	α-helix	trans	-87.6	-20.5	177.5	-63.4	-74.3	-94.2	0	0	112.4	F136 A137 S138	F136-Q140 HydrophobicContact CD1-CG 4.44Å; F136-Q140 HydrophobicContact CE1-CG 4.18Å; F136-Q140 WeakPolarHBondContact O-CG 3.46Å; F136-Q140 PolarHBondContact O-N 3.46Å; A137-Q140 PolarHBondContact O-N 3.29Å; A137-Q140 VanDerWaalsContact O-N 3.11Å; S138-Q140 VanDerWaalsContact C-N 3.32Å
141	F	56.1	Low	60.6	Low	164 Å²	164	123 Å²	123	72%	0.719	67%	0.671	S	S	*	*	S	Bend	trans	-124.4	93.9	173.8	-61.5	-77.8	0	0	0	110.3	A137 S138 T143	A137-F141 PolarHBondContact O-N 3.34Å; S138-F141 CarbonylContact O-C 3.57Å; S138-F141 VanDerWaalsContact O-O 3.08Å; F141-T143 PolarHBondContact O-N 3.22Å
142	P	52.7	Low	58.2	Low	117 Å²	117	122.7 Å²	122.7	76%	0.76	68%	0.683	S	S	*	*			trans	-60.2	112.5	170	-14.8	27.7	0	0	0	108.3	G144	P142-G144 PolarHBondContact O-N 3Å; P142-G144 VanDerWaalsContact O-N 3.09Å
143	T	54	Low	56.4	Low	138 Å²	138	123.1 Å²	123.1	85%	0.847	69%	0.693	S	S	*	*	P	Polyproline II helix	trans	-56.1	116.8	168	44.5	0	0	0	0	107.9	F141	F141-T143 PolarHBondContact O-N 3.22Å
144	G	48.1	Very low	54.2	Low	58 Å²	58	125.6 Å²	125.6	60%	0.598	70%	0.704	S	S	*	*	P	Polyproline II helix	trans	-56.1	159.4	171.3	0	0	0	0	0	111.5	P142	P142-G144 PolarHBondContact O-N 3Å; P142-G144 VanDerWaalsContact O-N 3.09Å
145	P	46.9	Very low	52.2	Low	103 Å²	103	127 Å²	127	67%	0.669	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-63	139.1	-162.6	25	-34.1	0	0	0	113.4	F147	P145-F147 HydrophobicContact CB-CD2 4.04Å; P145-F147 HydrophobicContact CB-CE2 3.6Å; P145-F147 HydrophobicContact CB-CZ 4.29Å; P145-F147 HydrophobicContact CG-CD2 4.04Å; P145-F147 HydrophobicContact CG-CE2 3.5Å; P145-F147 HydrophobicContact CG-CZ 4.45Å; P145-F147 PolarHBondContact O-N 2.92Å
146	Q	47.4	Very low	50.2	Low	198 Å²	198	122.7 Å²	122.7	93%	0.925	72%	0.718	S	S	*	*			trans	-68.9	111.9	167.9	-59.4	-167.8	-65.6	0	0	109.7
147	F	38.7	Very low	47.9	Very low	182 Å²	182	122.4 Å²	122.4	80%	0.798	73%	0.729	S	S	*	*			trans	-131.5	131.9	161.4	-61.7	-80.2	0	0	0	105.4	P145	P145-F147 HydrophobicContact CB-CD2 4.04Å; P145-F147 HydrophobicContact CB-CE2 3.6Å; P145-F147 HydrophobicContact CB-CZ 4.29Å; P145-F147 HydrophobicContact CG-CD2 4.04Å; P145-F147 HydrophobicContact CG-CE2 3.5Å; P145-F147 HydrophobicContact CG-CZ 4.45Å; P145-F147 PolarHBondContact O-N 2.92Å
148	A	34.8	Very low	46.2	Very low	98 Å²	98	125.6 Å²	125.6	81%	0.81	75%	0.748	S	S	*	*			cis	-160.4	159.5	-3.2	0	0	0	0	0	106.1
149	E	41.4	Very low	44.4	Very low	172 Å²	172	133.4 Å²	133.4	80%	0.804	77%	0.769	S	S	*	*			trans	-70.5	145	175.3	-159.6	118.8	79.5	0	0	112.5
150	E	36.9	Very low	43.1	Very low	171 Å²	171	133.7 Å²	133.7	80%	0.799	78%	0.783	S	S	*	*			trans	77.2	149.2	150.9	-122.6	136.1	84.1	0	0	120.5
151	P	38.9	Very low	41.7	Very low	120 Å²	120	131.2 Å²	131.2	78%	0.779	79%	0.791	S	S	*	*			cis	-140.2	172.4	24.9	39.8	-17.2	0	0	0	120.3
152	A	36.7	Very low	40.8	Very low	85 Å²	85	129.8 Å²	129.8	70%	0.702	79%	0.791	S	S	*	*			trans	-2.5	150.1	166.7	0	0	0	0	0	122.3
153	P	47.2	Very low	40.2	Very low	132 Å²	132	135.2 Å²	135.2	86%	0.857	80%	0.798	S	S	*	*	P	Polyproline II helix	trans	-79	130.4	-167.5	32.5	-33.3	0	0	0	113.2
154	M	38	Very low	39.3	Very low	174 Å²	174	138.6 Å²	138.6	86%	0.857	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-100.1	142.7	165.9	-71.3	-125.3	-70.6	0	0	110.6	A156	M154-A156 PolarHBondContact O-N 3.43Å
155	P	44.1	Very low	38.7	Very low	126 Å²	126	143.7 Å²	143.7	82%	0.818	80%	0.803	S	S	*	*	P	Polyproline II helix	trans	-76.6	123.7	-168.6	30.9	-32.3	0	0	0	110.7
156	A	38.8	Very low	38.1	Very low	93 Å²	93	149.3 Å²	149.3	77%	0.769	81%	0.813	S	S	*	*	P	Polyproline II helix	trans	-77.9	143.2	172.8	0	0	0	0	0	110.8	M154	M154-A156 PolarHBondContact O-N 3.43Å
157	P	32.8	Very low	37.7	Very low	123 Å²	123	152.7 Å²	152.7	80%	0.799	83%	0.829	S	S	*	*	P	Polyproline II helix	trans	-73.1	145.3	-171.5	0.2	15	0	0	0	112.1	Y159	P157-Y159 PolarHBondContact O-N 3.32Å
158	S	43.9	Very low	37.6	Very low	119 Å²	119	151.3 Å²	151.3	83%	0.832	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-51.9	116	167.9	48	0	0	0	0	112.3
159	Y	31.1	Very low	37.8	Very low	231 Å²	231	154.1 Å²	154.1	91%	0.906	83%	0.831	S	S	*	*			trans	-130.1	123	151.6	-148.3	-94.4	0	0	0	108.9	P157	P157-Y159 PolarHBondContact O-N 3.32Å
160	G	35.7	Very low	37.6	Very low	79 Å²	79	153.1 Å²	153.1	81%	0.814	83%	0.833	S	S	*	*			trans	-65.1	147.4	-161.4	0	0	0	0	0	115
161	G	32	Very low	37.6	Very low	73 Å²	73	152 Å²	152	75%	0.753	84%	0.835	S	S	*	*			trans	-168.7	66.7	172.1	0	0	0	0	0	107.6	Y163	G161-Y163 PolarHBondContact O-N 2.98Å; G161-Y163 VanDerWaalsContact O-N 3.12Å
162	D	36.9	Very low	37.5	Very low	133 Å²	133	154 Å²	154	71%	0.711	84%	0.838	S	S	*	*			trans	-56.5	104.2	178.1	-136.6	-31.1	0	0	0	110.7
163	Y	40.3	Very low	37.6	Very low	232 Å²	232	158.6 Å²	158.6	91%	0.91	85%	0.847	S	S	*	*			trans	-141.6	63.4	147.5	-69.5	-70.7	0	0	0	108.2	G161	G161-Y163 PolarHBondContact O-N 2.98Å; G161-Y163 VanDerWaalsContact O-N 3.12Å
164	R	34.5	Very low	36.9	Very low	209 Å²	209	160.5 Å²	160.5	79%	0.789	85%	0.847	S	S	*	*			trans	-54.4	147.7	154.7	-146.4	-177.7	-178	165.8	0.5	108.4
165	Q	34.9	Very low	36.8	Very low	164 Å²	164	159.5 Å²	159.5	77%	0.766	85%	0.846	S	S	*	*			trans	112	90.1	138.3	-148.9	174.4	-12.3	0	0	117.2
166	Y	33.9	Very low	36.2	Very low	221 Å²	221	162.3 Å²	162.3	87%	0.867	85%	0.848	S	S	*	*			trans	35	112.7	131.2	-68.3	-86.1	0	0	0	119.4
167	Q	39.7	Very low	36	Very low	270 Å²	270	168.5 Å²	168.5	100%	1.262	86%	0.855	S	S	*	*				-161.7	0	114.3	-114.8	173.7	-4	0	0	111.2

Retrieved 167 of 167 residues in 454 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).