A0A060W7G5_ONCMY Loading...

Cytochrome c oxidase subunit 7C, mitochondrial

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

AlphaFold DB (A0A673WMV1), UniProt , Accession A0A060W7G5, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110535720, Length 63 aa.

>A0A060W7G5_ONCMY|A0A060W7G5|LOC110535720
MLGQVVRRFTTSAVRSSHYGEGPGQNLPFSVDNKWRLLAMMVVFFGSGFAFPFIVVRHQLLKK
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M68Low82.3Confident209 Ų209116.9 Ų116.9100%1.0359%0.593SS**  0-47.70-65.9-59.3177.200112.9G3 Q4 V5M1-G3 PolarHBondContact O-N 3.12Å; M1-Q4 PolarHBondContact O-N 3.39Å; M1-V5 PolarHBondContact O-N 2.91Å
2L81.6Confident81.8Confident137 Ų137113.7 Ų113.772%0.71759%0.589SS**Hα-helixtrans-60.3-43-175.9-149.9157.4000114.3Q4 V5 V6L2-Q4 VanDerWaalsContact C-N 3.33Å; L2-Q4 PolarHBondContact O-N 3.41Å; L2-V5 WeakPolarHBondContact O-CB 3.34Å; L2-V5 PolarHBondContact O-N 3.39Å; L2-V5 VanDerWaalsContact O-N 3.12Å; L2-V6 HydrophobicContact CD2-CG2 3.77Å; L2-V6 WeakPolarHBondContact O-CG2 3.49Å; L2-V6 PolarHBondContact O-N 3.16Å
3G83.4Confident81.6Confident54 Ų54109.6 Ų109.656%0.55758%0.582SS**Hα-helixtrans-64-31.9177.500000114.6M1 R7M1-G3 PolarHBondContact O-N 3.12Å; G3-R7 VanDerWaalsContact O-CB 3.31Å; G3-R7 WeakPolarHBondContact O-CB 3.44Å; G3-R7 PolarHBondContact O-N 3.27Å
4Q81.8Confident81.5Confident105 Ų105108.9 Ų108.949%0.49158%0.584SS.*Hα-helixtrans-69.3-37.6173.5-74.7-74.6-66.600111.3M1 L2 R8M1-Q4 PolarHBondContact O-N 3.39Å; L2-Q4 VanDerWaalsContact C-N 3.33Å; L2-Q4 PolarHBondContact O-N 3.41Å; Q4-R8 WeakPolarHBondContact O-CB 3.33Å; Q4-R8 VanDerWaalsContact O-CG 3.23Å; Q4-R8 WeakPolarHBondContact O-CG 2.95Å; Q4-R8 PolarHBondContact O-N 3.14Å
5V85.6Confident81.3Confident68 Ų68114.4 Ų114.441%0.41259%0.593SS.*Hα-helixtrans-66.8-47.8176.5173.60000110.6M1 L2 R7 R8 F9M1-V5 PolarHBondContact O-N 2.91Å; L2-V5 WeakPolarHBondContact O-CB 3.34Å; L2-V5 PolarHBondContact O-N 3.39Å; L2-V5 VanDerWaalsContact O-N 3.12Å; V5-R7 VanDerWaalsContact C-N 3.33Å; V5-R7 PolarHBondContact O-N 3.49Å; V5-R8 PolarHBondContact O-N 2.9Å; V5-R8 VanDerWaalsContact O-N 3.16Å; V5-F9 HydrophobicContact CG1-CD2 3.57Å; V5-F9 HydrophobicContact CG1-CE2 3.36Å; V5-F9 WeakPolarHBondContact O-CD2 3.27Å; V5-F9 PolarHBondContact O-N 3.34Å
6V87.5Confident80.8Confident75 Ų75110.6 Ų110.646%0.45558%0.58SS.*Hα-helixtrans-59.3-43.6175.2172.40000111.3L2 R8 F9 T10L2-V6 HydrophobicContact CD2-CG2 3.77Å; L2-V6 WeakPolarHBondContact O-CG2 3.49Å; L2-V6 PolarHBondContact O-N 3.16Å; V6-R8 PolarHBondContact O-N 3.33Å; V6-F9 PolarHBondContact O-N 2.82Å; V6-T10 HydrophobicContact CG1-CG2 4.27Å; V6-T10 WeakPolarHBondContact O-CB 3.43Å; V6-T10 WeakPolarHBondContact O-CG2 3.47Å; V6-T10 PolarHBondContact O-N 3.3Å; V6-T10 PolarHBondContact O-OG1 3.13Å
7R84Confident80.5Confident169 Ų169109.5 Ų109.564%0.63858%0.583SS**Hα-helixtrans-60.1-45.1175.4-172.5174.5178.3174.2-0.9111.6G3 V5 T10 T11G3-R7 VanDerWaalsContact O-CB 3.31Å; G3-R7 WeakPolarHBondContact O-CB 3.44Å; G3-R7 PolarHBondContact O-N 3.27Å; V5-R7 VanDerWaalsContact C-N 3.33Å; V5-R7 PolarHBondContact O-N 3.49Å; R7-T10 WeakPolarHBondContact CA-OG1 3.47Å; R7-T10 PolarHBondContact O-OG1 3.47Å; R7-T11 HydrophobicContact CG-CG2 4.46Å; R7-T11 WeakPolarHBondContact O-CB 3.32Å; R7-T11 VanDerWaalsContact O-CG2 3.27Å; R7-T11 WeakPolarHBondContact O-CG2 3.43Å; R7-T11 PolarHBondContact O-N 3.09Å; R7-T11 PolarHBondContact O-OG1 3.42Å
8R83.4Confident80.6Confident167 Ų167111.4 Ų111.463%0.6359%0.588SS**Hα-helixtrans-62.5-44.5177.7-72.8170.3-174-169.11.4112.2Q4 V5 V6 T11 S12Q4-R8 WeakPolarHBondContact O-CB 3.33Å; Q4-R8 VanDerWaalsContact O-CG 3.23Å; Q4-R8 WeakPolarHBondContact O-CG 2.95Å; Q4-R8 PolarHBondContact O-N 3.14Å; V5-R8 PolarHBondContact O-N 2.9Å; V5-R8 VanDerWaalsContact O-N 3.16Å; V6-R8 PolarHBondContact O-N 3.33Å; R8-T11 WeakPolarHBondContact CA-OG1 3.37Å; R8-T11 PolarHBondContact O-N 3.14Å; R8-T11 PolarHBondContact O-OG1 2.85Å; R8-S12 PolarHBondContact O-N 3.22Å; R8-S12 PolarHBondContact O-OG 3.32Å; R8-S12 VanDerWaalsContact O-OG 3.1Å
9F86Confident80.7Confident149 Ų149114.1 Ų114.165%0.65459%0.59SS**Hα-helixtrans-64.4-47.9177.8-81.6-67.8000112.6V5 V6 T11 S12 A13V5-F9 HydrophobicContact CG1-CD2 3.57Å; V5-F9 HydrophobicContact CG1-CE2 3.36Å; V5-F9 WeakPolarHBondContact O-CD2 3.27Å; V5-F9 PolarHBondContact O-N 3.34Å; V6-F9 PolarHBondContact O-N 2.82Å; F9-T11 VanDerWaalsContact C-N 3.35Å; F9-T11 PolarHBondContact O-N 2.95Å; F9-S12 PolarHBondContact O-N 3.46Å; F9-A13 PolarHBondContact O-N 2.88Å
10T83.2Confident80.9Confident73 Ų73110.4 Ų110.445%0.44858%0.582SS.*Hα-helixtrans-61.8-41.6177.7500000111.6V6 R7 S12 A13 V14V6-T10 HydrophobicContact CG1-CG2 4.27Å; V6-T10 WeakPolarHBondContact O-CB 3.43Å; V6-T10 WeakPolarHBondContact O-CG2 3.47Å; V6-T10 PolarHBondContact O-N 3.3Å; V6-T10 PolarHBondContact O-OG1 3.13Å; R7-T10 WeakPolarHBondContact CA-OG1 3.47Å; R7-T10 PolarHBondContact O-OG1 3.47Å; T10-S12 VanDerWaalsContact C-N 3.35Å; T10-S12 PolarHBondContact O-N 3.4Å; T10-A13 PolarHBondContact O-N 2.9Å; T10-V14 WeakPolarHBondContact O-CB 3.24Å; T10-V14 VanDerWaalsContact O-CG2 3.24Å; T10-V14 WeakPolarHBondContact O-CG2 3.14Å; T10-V14 PolarHBondContact O-N 3.13Å
11T80.9Confident81.1Confident80 Ų80111.8 Ų111.849%0.49159%0.585SS.*Hα-helixtrans-64.5-37175.551.80000113.1R7 R8 F9 R15R7-T11 HydrophobicContact CG-CG2 4.46Å; R7-T11 WeakPolarHBondContact O-CB 3.32Å; R7-T11 VanDerWaalsContact O-CG2 3.27Å; R7-T11 WeakPolarHBondContact O-CG2 3.43Å; R7-T11 PolarHBondContact O-N 3.09Å; R7-T11 PolarHBondContact O-OG1 3.42Å; R8-T11 WeakPolarHBondContact CA-OG1 3.37Å; R8-T11 PolarHBondContact O-N 3.14Å; R8-T11 PolarHBondContact O-OG1 2.85Å; F9-T11 VanDerWaalsContact C-N 3.35Å; F9-T11 PolarHBondContact O-N 2.95Å; T11-R15 WeakPolarHBondContact O-CB 3.44Å; T11-R15 PolarHBondContact O-N 3.47Å; T11-R15 VanDerWaalsContact O-N 3.08Å
12S76.8Confident82.1Confident78 Ų78103.8 Ų103.855%0.54556%0.557SS.*Hα-helixtrans-68.2-42.7176.5-65.70000111.8R8 F9 T10 R15 S16R8-S12 PolarHBondContact O-N 3.22Å; R8-S12 PolarHBondContact O-OG 3.32Å; R8-S12 VanDerWaalsContact O-OG 3.1Å; F9-S12 PolarHBondContact O-N 3.46Å; T10-S12 VanDerWaalsContact C-N 3.35Å; T10-S12 PolarHBondContact O-N 3.4Å; S12-R15 PolarHBondContact O-N 2.99Å; S12-S16 PolarHBondContact O-N 3.21Å; S12-S16 VanDerWaalsContact O-N 3.08Å
13A79.2Confident82.7Confident61 Ų61103.8 Ų103.850%0.50457%0.565SS.*Hα-helixtrans-64.4-42.9177.500000112.1F9 T10 R15 S16 S17F9-A13 PolarHBondContact O-N 2.88Å; T10-A13 PolarHBondContact O-N 2.9Å; A13-R15 VanDerWaalsContact C-N 3.31Å; A13-R15 PolarHBondContact O-N 3.38Å; A13-S16 PolarHBondContact O-N 2.89Å; A13-S17 PolarHBondContact O-N 3.23Å; A13-S17 PolarHBondContact O-OG 3.43Å
14V80.1Confident83.2Confident100 Ų100102 Ų10261%0.60655%0.546SS*.Hα-helixtrans-65.7-33.8176.8171.20000111.9T10 S17T10-V14 WeakPolarHBondContact O-CB 3.24Å; T10-V14 VanDerWaalsContact O-CG2 3.24Å; T10-V14 WeakPolarHBondContact O-CG2 3.14Å; T10-V14 PolarHBondContact O-N 3.13Å; V14-S17 PolarHBondContact O-OG 3.49Å; V14-S17 VanDerWaalsContact O-OG 3.06Å
15R77.7Confident83.7Confident191 Ų191102.1 Ų102.172%0.72155%0.547SS*.Hα-helixtrans-70.2-40.7176.6-178.1177.3174.6168.1-0.3112.1T11 S12 A13 Y19T11-R15 WeakPolarHBondContact O-CB 3.44Å; T11-R15 PolarHBondContact O-N 3.47Å; T11-R15 VanDerWaalsContact O-N 3.08Å; S12-R15 PolarHBondContact O-N 2.99Å; A13-R15 VanDerWaalsContact C-N 3.31Å; A13-R15 PolarHBondContact O-N 3.38Å; R15-Y19 WeakPolarHBondContact O-CD2 3.32Å
16S74.5Confident84Confident54 Ų54105 Ų10538%0.37856%0.56SS.*Hα-helixtrans-68.4-40.7178.6135.40000111S12 A13 H18 Y19 E21S12-S16 PolarHBondContact O-N 3.21Å; S12-S16 VanDerWaalsContact O-N 3.08Å; A13-S16 PolarHBondContact O-N 2.89Å; S16-H18 PolarHBondContact O-N 3.41Å; S16-Y19 PolarHBondContact O-N 2.96Å; S16-Y19 VanDerWaalsContact O-O 3.13Å; S16-E21 WeakPolarHBondContact CB-OE1 3.39Å; S16-E21 PolarHBondContact OG-OE1 2.92Å
17S74.9Confident84.3Confident92 Ų92105 Ų10564%0.64356%0.557SS**Hα-helixtrans-66.5-19.9-179.966.90000115.2A13 V14A13-S17 PolarHBondContact O-N 3.23Å; A13-S17 PolarHBondContact O-OG 3.43Å; V14-S17 PolarHBondContact O-OG 3.49Å; V14-S17 VanDerWaalsContact O-OG 3.06Å
18H82.4Confident84.8Confident144 Ų144103.1 Ų103.167%0.66757%0.567SS**THydrogen-bonded Turntrans-77.8-24.2-179.4-173.2-80.6000113.2S16S16-H18 PolarHBondContact O-N 3.41Å
19Y83.1Confident85.4Confident161 Ų16198.6 Ų98.663%0.63155%0.552SS**SBendtrans-105.4137.7179.1-65.2-79.8000109.4R15 S16 E21R15-Y19 WeakPolarHBondContact O-CD2 3.32Å; S16-Y19 PolarHBondContact O-N 2.96Å; S16-Y19 VanDerWaalsContact O-O 3.13Å; Y19-E21 PolarHBondContact O-N 3.34Å
20G84.2Confident85.9Confident41 Ų4193.3 Ų93.342%0.42353%0.533SS..  trans-59.6126.2174.500000109.9Q25G20-Q25 VanDerWaalsContact C-CB 3.41Å; G20-Q25 VanDerWaalsContact O-CB 3.28Å; G20-Q25 WeakPolarHBondContact O-CB 3.44Å
21E85.2Confident86.5Confident139 Ų13992.2 Ų92.265%0.6553%0.526SS*.  trans-96.9150.6175.4-62.5-171.3168.400110.3S16 Y19S16-E21 WeakPolarHBondContact CB-OE1 3.39Å; S16-E21 PolarHBondContact OG-OE1 2.92Å; Y19-E21 PolarHBondContact O-N 3.34Å
22G88.8Confident87.3Confident42 Ų4294.5 Ų94.543%0.43354%0.535SS..SBendtrans98.9175.4177.200000115.2G24 Q25G22-G24 PolarHBondContact O-N 2.91Å; G22-Q25 PolarHBondContact O-N 3.4Å
23P94.6Very high88.3Confident136 Ų13694.2 Ų94.288%0.88353%0.528SS*.THydrogen-bonded Turntrans-57.3131.1-175.3-25.435.2000112.6Q25P23-Q25 VanDerWaalsContact C-N 3.26Å; P23-Q25 PolarHBondContact O-N 3.43Å
24G93.6Very high89.2Confident16 Ų1698.7 Ų98.717%0.16554%0.536CS..THydrogen-bonded Turntrans84.6-15.4177.600000115.4G22G22-G24 PolarHBondContact O-N 2.91Å
25Q92.7Very high90Very high108 Ų108102.5 Ų102.551%0.50554%0.539SS..THydrogen-bonded Turntrans-88.5-17.4179.2-63.8-64.2-22.500113.4G20 G22 P23 L27G20-Q25 VanDerWaalsContact C-CB 3.41Å; G20-Q25 VanDerWaalsContact O-CB 3.28Å; G20-Q25 WeakPolarHBondContact O-CB 3.44Å; G22-Q25 PolarHBondContact O-N 3.4Å; P23-Q25 VanDerWaalsContact C-N 3.26Å; P23-Q25 PolarHBondContact O-N 3.43Å; Q25-L27 VanDerWaalsContact C-N 3.32Å
26N91.6Very high91Very high128 Ų12898.4 Ų98.468%0.68452%0.524SS*.THydrogen-bonded Turntrans-92.813.3177.667.4-19.7000113.5
27L94.1Very high92.2Very high75 Ų7597.9 Ų97.939%0.39352%0.517SS..SBendtrans-103146.1-178.9-62.5176.7000110.7Q25 F29 V31Q25-L27 VanDerWaalsContact C-N 3.32Å; L27-F29 HydrophobicContact CB-CE1 4.47Å; L27-F29 HydrophobicContact CB-CZ 4.47Å; L27-F29 HydrophobicContact CD1-CE2 4.05Å; L27-F29 HydrophobicContact CD1-CZ 4.07Å; L27-F29 PolarHBondContact O-N 3.44Å; L27-F29 VanDerWaalsContact O-N 3.11Å; L27-V31 HydrophobicContact CD1-CG1 3.78Å
28P94.3Very high93.3Very high130 Ų13098 Ų9884%0.84451%0.51SS*.SBendtrans-76.810.4177.132.5-34.8000113.5
29F96Very high94.1Very high73 Ų7393.7 Ų93.732%0.3250%0.499SS..SBendtrans-145147.8175.655.5-91.3000108.9L27 V31 L37 M40 M41L27-F29 HydrophobicContact CB-CE1 4.47Å; L27-F29 HydrophobicContact CB-CZ 4.47Å; L27-F29 HydrophobicContact CD1-CE2 4.05Å; L27-F29 HydrophobicContact CD1-CZ 4.07Å; L27-F29 PolarHBondContact O-N 3.44Å; L27-F29 VanDerWaalsContact O-N 3.11Å; F29-V31 HydrophobicContact CD2-CG1 4.24Å; F29-V31 HydrophobicContact CE2-CG1 3.96Å; F29-L37 HydrophobicContact CD2-CD1 3.78Å; F29-L37 HydrophobicContact CE2-CD1 3.63Å; F29-M40 HydrophobicContact CB-SD 4.37Å; F29-M41 HydrophobicContact CD2-CE 4.42Å; F29-M41 HydrophobicContact CE2-CE 4.17Å; F29-M41 HydrophobicContact CZ-CE 4.25Å
30S95.4Very high94.8Very high37 Ų3790.1 Ų90.126%0.25949%0.49SS..  trans-82.5138.8-177.9165.10000112.2D32 R36S30-D32 PolarHBondContact OG-N 3.47Å; S30-D32 PolarHBondContact OG-OD2 2.92Å; S30-R36 PolarHBondContact OG-NH2 3.27Å
31V97.1Very high95.5Very high50 Ų5090.8 Ų90.830%0.30348%0.482SS..  trans-104.44.1177.2-63.10000113.5L27 F29 N33 L37L27-V31 HydrophobicContact CD1-CG1 3.78Å; F29-V31 HydrophobicContact CD2-CG1 4.24Å; F29-V31 HydrophobicContact CE2-CG1 3.96Å; V31-N33 VanDerWaalsContact C-N 3.28Å; V31-N33 PolarHBondContact O-N 3.06Å; V31-L37 HydrophobicContact CB-CD2 4.21Å; V31-L37 HydrophobicContact CG1-CD1 4.13Å; V31-L37 HydrophobicContact CG1-CD2 4.01Å
32D96.6Very high96.1Very high128 Ų12888.6 Ų88.668%0.68448%0.478SS*.SBendtrans-63.1-32.9-172.2-55.6-40000113.2S30S30-D32 PolarHBondContact OG-N 3.47Å; S30-D32 PolarHBondContact OG-OD2 2.92Å
33N97.9Very high96.6Very high73 Ų7391.5 Ų91.539%0.3949%0.487SS..  trans-116.3111.8177.1-176.9-27.1000110.1V31 W35 R36 L37V31-N33 VanDerWaalsContact C-N 3.28Å; V31-N33 PolarHBondContact O-N 3.06Å; N33-W35 VanDerWaalsContact C-N 3.25Å; N33-W35 PolarHBondContact O-N 3.24Å; N33-W35 WeakPolarHBondContact OD1-CB 3.46Å; N33-W35 PolarHBondContact OD1-N 2.84Å; N33-R36 HydrophobicContact CB-CB 4.05Å; N33-R36 PolarHBondContact O-N 2.95Å; N33-R36 VanDerWaalsContact O-N 3.13Å; N33-R36 PolarHBondContact OD1-N 2.89Å; N33-L37 PolarHBondContact O-N 3.33Å
34K97.8Very high96.8Very high155 Ų15591.7 Ų91.767%0.67447%0.474SS*.Hα-helixtrans-56.1-34-179.867.8-173.5179.1-169.70114.3L38K34-L38 VanDerWaalsContact O-CB 3.32Å; K34-L38 WeakPolarHBondContact O-CB 3.18Å; K34-L38 PolarHBondContact O-N 3.44Å
35W98.6Very high97Very high179 Ų17997.2 Ų97.268%0.67849%0.494SS*.Hα-helixtrans-75.2-38.5179.3-62.6114.6000111.8N33 L38 A39N33-W35 VanDerWaalsContact C-N 3.25Å; N33-W35 PolarHBondContact O-N 3.24Å; N33-W35 WeakPolarHBondContact OD1-CB 3.46Å; N33-W35 PolarHBondContact OD1-N 2.84Å; W35-L38 HydrophobicContact CE3-CD2 4.04Å; W35-L38 HydrophobicContact CZ3-CD2 4.13Å; W35-L38 PolarHBondContact O-N 2.9Å; W35-A39 WeakPolarHBondContact O-CB 3.34Å; W35-A39 PolarHBondContact O-N 2.8Å
36R98.2Very high97.3Very high105 Ų10593.6 Ų93.640%0.39649%0.486SS..Hα-helixtrans-64.9-43.6172.1-173.9178.467.6-140.6-3.7110.7S30 N33 A39 M40S30-R36 PolarHBondContact OG-NH2 3.27Å; N33-R36 HydrophobicContact CB-CB 4.05Å; N33-R36 PolarHBondContact O-N 2.95Å; N33-R36 VanDerWaalsContact O-N 3.13Å; N33-R36 PolarHBondContact OD1-N 2.89Å; R36-A39 PolarHBondContact O-N 2.97Å; R36-M40 HydrophobicContact CG-CE 4.44Å; R36-M40 HydrophobicContact CG-SD 4.5Å; R36-M40 WeakPolarHBondContact O-CG 3.34Å; R36-M40 PolarHBondContact O-N 2.68Å
37L98.5Very high97.6Very high44 Ų4490.8 Ų90.823%0.2348%0.476CS..Hα-helixtrans-59.8-47.9176.3178.661.4000111F29 V31 N33 A39 M40 M41F29-L37 HydrophobicContact CD2-CD1 3.78Å; F29-L37 HydrophobicContact CE2-CD1 3.63Å; V31-L37 HydrophobicContact CB-CD2 4.21Å; V31-L37 HydrophobicContact CG1-CD1 4.13Å; V31-L37 HydrophobicContact CG1-CD2 4.01Å; N33-L37 PolarHBondContact O-N 3.33Å; L37-A39 PolarHBondContact O-N 3.44Å; L37-M40 PolarHBondContact O-N 3.22Å; L37-M41 HydrophobicContact CD1-CE 4.22Å; L37-M41 HydrophobicContact CD1-CG 4.17Å; L37-M41 HydrophobicContact CG-CG 4.44Å; L37-M41 VanDerWaalsContact O-CG 3.3Å; L37-M41 WeakPolarHBondContact O-CG 3.11Å; L37-M41 PolarHBondContact O-N 3.11Å
38L98.7Very high97.8Very high93 Ų9389.5 Ų89.549%0.48748%0.481SS..Hα-helixtrans-56.1-49.8176.2177.865.4000111.3K34 W35 M40 M41 V42K34-L38 VanDerWaalsContact O-CB 3.32Å; K34-L38 WeakPolarHBondContact O-CB 3.18Å; K34-L38 PolarHBondContact O-N 3.44Å; W35-L38 HydrophobicContact CE3-CD2 4.04Å; W35-L38 HydrophobicContact CZ3-CD2 4.13Å; W35-L38 PolarHBondContact O-N 2.9Å; L38-M40 VanDerWaalsContact C-N 3.34Å; L38-M40 PolarHBondContact O-N 2.66Å; L38-M41 PolarHBondContact O-N 3.5Å; L38-V42 HydrophobicContact CD1-CG2 4.18Å; L38-V42 HydrophobicContact CG-CG2 4.46Å; L38-V42 WeakPolarHBondContact O-CG2 3.31Å; L38-V42 PolarHBondContact O-N 2.85Å
39A98.6Very high98Very high55 Ų5590.4 Ų90.446%0.45547%0.472SS..Hα-helixtrans-59.4-44.5178.600000111.8W35 R36 L37 M41 V42 V43W35-A39 WeakPolarHBondContact O-CB 3.34Å; W35-A39 PolarHBondContact O-N 2.8Å; R36-A39 PolarHBondContact O-N 2.97Å; L37-A39 PolarHBondContact O-N 3.44Å; A39-M41 PolarHBondContact O-N 3.25Å; A39-V42 PolarHBondContact O-N 2.88Å; A39-V43 WeakPolarHBondContact O-CG2 3.37Å; A39-V43 PolarHBondContact O-N 2.89Å
40M98.4Very high98.2Very high86 Ų8688.6 Ų88.642%0.42447%0.471SS..Hα-helixtrans-61-43.4176.2-77.6-176.1165.600112.4F29 R36 L37 L38 V43 F44F29-M40 HydrophobicContact CB-SD 4.37Å; R36-M40 HydrophobicContact CG-CE 4.44Å; R36-M40 HydrophobicContact CG-SD 4.5Å; R36-M40 WeakPolarHBondContact O-CG 3.34Å; R36-M40 PolarHBondContact O-N 2.68Å; L37-M40 PolarHBondContact O-N 3.22Å; L38-M40 VanDerWaalsContact C-N 3.34Å; L38-M40 PolarHBondContact O-N 2.66Å; M40-V43 PolarHBondContact O-N 3.37Å; M40-F44 VanDerWaalsContact O-CB 3.29Å; M40-F44 WeakPolarHBondContact O-CB 3.32Å; M40-F44 PolarHBondContact O-N 3.3Å
41M98.6Very high98.3Very high55 Ų5593.5 Ų93.527%0.27149%0.488SS..Hα-helixtrans-65.8-44178.3-67.3-60.397.800111.8F29 L37 L38 A39 V43 F44 F45F29-M41 HydrophobicContact CD2-CE 4.42Å; F29-M41 HydrophobicContact CE2-CE 4.17Å; F29-M41 HydrophobicContact CZ-CE 4.25Å; L37-M41 HydrophobicContact CD1-CE 4.22Å; L37-M41 HydrophobicContact CD1-CG 4.17Å; L37-M41 HydrophobicContact CG-CG 4.44Å; L37-M41 VanDerWaalsContact O-CG 3.3Å; L37-M41 WeakPolarHBondContact O-CG 3.11Å; L37-M41 PolarHBondContact O-N 3.11Å; L38-M41 PolarHBondContact O-N 3.5Å; A39-M41 PolarHBondContact O-N 3.25Å; M41-V43 VanDerWaalsContact C-N 3.34Å; M41-V43 PolarHBondContact O-N 3.22Å; M41-F44 PolarHBondContact O-N 3.39Å; M41-F45 HydrophobicContact CB-CD2 4.28Å; M41-F45 HydrophobicContact CB-CE2 4.47Å; M41-F45 WeakPolarHBondContact O-CB 3.3Å; M41-F45 VanDerWaalsContact O-CD2 3.26Å; M41-F45 WeakPolarHBondContact O-CD2 3.47Å; M41-F45 PolarHBondContact O-N 3.34Å; M41-F45 HydrophobicContact SD-CD2 4.4Å; M41-F45 HydrophobicContact SD-CE2 3.73Å
42V98.7Very high98.4Very high93 Ų9394.5 Ų94.556%0.56450%0.495SS*.Hα-helixtrans-61.3-43.6176.9170.40000110.8L38 A39 G46L38-V42 HydrophobicContact CD1-CG2 4.18Å; L38-V42 HydrophobicContact CG-CG2 4.46Å; L38-V42 WeakPolarHBondContact O-CG2 3.31Å; L38-V42 PolarHBondContact O-N 2.85Å; A39-V42 PolarHBondContact O-N 2.88Å; V42-G46 WeakPolarHBondContact O-CA 3.26Å; V42-G46 PolarHBondContact O-N 3.25Å
43V98.6Very high98.5Very high102 Ų10294.8 Ų94.862%0.61849%0.49SS*.Hα-helixtrans-65.8-49.8177.6171.30000110.8A39 M40 M41 S47A39-V43 WeakPolarHBondContact O-CG2 3.37Å; A39-V43 PolarHBondContact O-N 2.89Å; M40-V43 PolarHBondContact O-N 3.37Å; M41-V43 VanDerWaalsContact C-N 3.34Å; M41-V43 PolarHBondContact O-N 3.22Å; V43-S47 WeakPolarHBondContact O-CB 3.44Å; V43-S47 PolarHBondContact O-N 3.18Å; V43-S47 PolarHBondContact O-OG 3.36Å
44F98.4Very high98.5Very high141 Ų14196.5 Ų96.562%0.61850%0.498SS*.Hα-helixtrans-61.6-53.8-176.4179.7-104.4000112.6M40 M41 S47 G48M40-F44 VanDerWaalsContact O-CB 3.29Å; M40-F44 WeakPolarHBondContact O-CB 3.32Å; M40-F44 PolarHBondContact O-N 3.3Å; M41-F44 PolarHBondContact O-N 3.39Å; F44-S47 PolarHBondContact O-OG 3.44Å; F44-S47 VanDerWaalsContact O-OG 3.06Å; F44-G48 PolarHBondContact O-N 3.08Å
45F98.7Very high98.5Very high131 Ų13191.7 Ų91.758%0.57548%0.482SS*.Hα-helixtrans-74.5-40.4179.8-67.5-64.8000111.9M41 S47 G48 F49M41-F45 HydrophobicContact CB-CD2 4.28Å; M41-F45 HydrophobicContact CB-CE2 4.47Å; M41-F45 WeakPolarHBondContact O-CB 3.3Å; M41-F45 VanDerWaalsContact O-CD2 3.26Å; M41-F45 WeakPolarHBondContact O-CD2 3.47Å; M41-F45 PolarHBondContact O-N 3.34Å; M41-F45 HydrophobicContact SD-CD2 4.4Å; M41-F45 HydrophobicContact SD-CE2 3.73Å; F45-S47 VanDerWaalsContact C-N 3.33Å; F45-S47 PolarHBondContact O-N 2.57Å; F45-G48 PolarHBondContact O-N 3.32Å; F45-F49 VanDerWaalsContact O-CB 3.31Å; F45-F49 WeakPolarHBondContact O-CB 3.23Å; F45-F49 PolarHBondContact O-N 3.06Å
46G98.7Very high98.5Very high32 Ų3287.3 Ų87.333%0.3348%0.475SS..Hα-helixtrans-62.7-38.717900000112.3V42 F49 A50V42-G46 WeakPolarHBondContact O-CA 3.26Å; V42-G46 PolarHBondContact O-N 3.25Å; G46-F49 PolarHBondContact O-N 3.02Å; G46-A50 WeakPolarHBondContact O-CB 3.28Å; G46-A50 PolarHBondContact O-N 2.97Å
47S98.5Very high98.5Very high70 Ų7090.2 Ų90.249%0.4949%0.486SS..Hα-helixtrans-66.4-45.1174.7650000111.7V43 F44 F45 F49 A50 F51V43-S47 WeakPolarHBondContact O-CB 3.44Å; V43-S47 PolarHBondContact O-N 3.18Å; V43-S47 PolarHBondContact O-OG 3.36Å; F44-S47 PolarHBondContact O-OG 3.44Å; F44-S47 VanDerWaalsContact O-OG 3.06Å; F45-S47 VanDerWaalsContact C-N 3.33Å; F45-S47 PolarHBondContact O-N 2.57Å; S47-F49 VanDerWaalsContact C-N 3.32Å; S47-F49 PolarHBondContact O-N 3.08Å; S47-A50 PolarHBondContact O-N 3.38Å; S47-F51 VanDerWaalsContact O-CB 3.23Å; S47-F51 WeakPolarHBondContact O-CB 3.47Å; S47-F51 PolarHBondContact O-N 3.1Å
48G98.3Very high98.5Very high48 Ų4893.1 Ų93.150%0.49550%0.498SS..Hα-helixtrans-62-40.5177.600000112.4F44 F45 P52F44-G48 PolarHBondContact O-N 3.08Å; F45-G48 PolarHBondContact O-N 3.32Å; G48-P52 VanDerWaalsContact O-CD 3.3Å; G48-P52 WeakPolarHBondContact O-CD 3.41Å
49F98.6Very high98.5Very high148 Ų14893.6 Ų93.665%0.64950%0.498SS*.Hα-helixtrans-71-42.1177.6-179.6-103.7000112.8F45 G46 S47 P52 F53F45-F49 VanDerWaalsContact O-CB 3.31Å; F45-F49 WeakPolarHBondContact O-CB 3.23Å; F45-F49 PolarHBondContact O-N 3.06Å; G46-F49 PolarHBondContact O-N 3.02Å; S47-F49 VanDerWaalsContact C-N 3.32Å; S47-F49 PolarHBondContact O-N 3.08Å; F49-P52 WeakPolarHBondContact O-CD 3.29Å; F49-F53 HydrophobicContact CD1-CE2 4.47Å; F49-F53 HydrophobicContact CE1-CE2 4.03Å; F49-F53 HydrophobicContact CE2-CE2 4.15Å; F49-F53 AromaticContact CZ-CE2 3.86Å; F49-F53 HydrophobicContact CZ-CE2 3.86Å; F49-F53 HydrophobicContact CZ-CZ 4.23Å; F49-F53 VanDerWaalsContact O-CD2 3.24Å; F49-F53 WeakPolarHBondContact O-CD2 3.24Å; F49-F53 WeakPolarHBondContact O-CE2 3.3Å
50A98.6Very high98.4Very high36 Ų3697.6 Ų97.630%0.29851%0.511SS..Hα-helixtrans-74-28.6-178.400000113G46 S47 F53 I54G46-A50 WeakPolarHBondContact O-CB 3.28Å; G46-A50 PolarHBondContact O-N 2.97Å; S47-A50 PolarHBondContact O-N 3.38Å; A50-F53 PolarHBondContact O-N 3.45Å; A50-F53 VanDerWaalsContact O-N 3.14Å; A50-I54 HydrophobicContact CB-CD1 4.29Å; A50-I54 WeakPolarHBondContact O-CG1 3.39Å; A50-I54 PolarHBondContact O-N 2.96Å; A50-I54 VanDerWaalsContact O-N 3.09Å
51F98.6Very high98.4Very high140 Ų14098.8 Ų98.861%0.61452%0.518SS*.Hα-helixtrans-55.1-48.5-172-177.8-97.8000114.1S47 F53 I54 V55S47-F51 VanDerWaalsContact O-CB 3.23Å; S47-F51 WeakPolarHBondContact O-CB 3.47Å; S47-F51 PolarHBondContact O-N 3.1Å; F51-F53 VanDerWaalsContact C-N 3.32Å; F51-F53 PolarHBondContact O-N 3.22Å; F51-I54 PolarHBondContact O-N 2.95Å; F51-V55 HydrophobicContact CD1-CG2 4.12Å; F51-V55 HydrophobicContact CE1-CG2 3.74Å; F51-V55 HydrophobicContact CE2-CG2 4.16Å; F51-V55 HydrophobicContact CG-CG2 4.48Å; F51-V55 HydrophobicContact CZ-CG2 3.77Å; F51-V55 WeakPolarHBondContact O-CG2 3.43Å; F51-V55 PolarHBondContact O-N 3.46Å
52P98.6Very high98.2Very high71 Ų71101.3 Ų101.346%0.46153%0.528SS..Hα-helixtrans-57.8-40.9177-25.234.9000113.5G48 F49 V55 V56G48-P52 VanDerWaalsContact O-CD 3.3Å; G48-P52 WeakPolarHBondContact O-CD 3.41Å; F49-P52 WeakPolarHBondContact O-CD 3.29Å; P52-V55 PolarHBondContact O-N 3.37Å; P52-V56 WeakPolarHBondContact O-CG2 3.38Å; P52-V56 PolarHBondContact O-N 3.04Å
53F98.4Very high97Very high133 Ų133110 Ų11058%0.58356%0.558SS**Hα-helixtrans-66.5-40179.3-62-83.5000112.1F49 A50 F51 V55 V56 R57F49-F53 HydrophobicContact CD1-CE2 4.47Å; F49-F53 HydrophobicContact CE1-CE2 4.03Å; F49-F53 HydrophobicContact CE2-CE2 4.15Å; F49-F53 AromaticContact CZ-CE2 3.86Å; F49-F53 HydrophobicContact CZ-CE2 3.86Å; F49-F53 HydrophobicContact CZ-CZ 4.23Å; F49-F53 VanDerWaalsContact O-CD2 3.24Å; F49-F53 WeakPolarHBondContact O-CD2 3.24Å; F49-F53 WeakPolarHBondContact O-CE2 3.3Å; A50-F53 PolarHBondContact O-N 3.45Å; A50-F53 VanDerWaalsContact O-N 3.14Å; F51-F53 VanDerWaalsContact C-N 3.32Å; F51-F53 PolarHBondContact O-N 3.22Å; F53-V55 VanDerWaalsContact C-N 3.35Å; F53-V56 PolarHBondContact O-N 2.78Å; F53-R57 WeakPolarHBondContact O-CB 3.27Å; F53-R57 PolarHBondContact O-N 2.83Å
54I98.4Very high96.9Very high109 Ų109110.5 Ų110.556%0.55956%0.555SS**Hα-helixtrans-64.1-43.3175.5-65.2169.9000110.1A50 F51 R57 H58A50-I54 HydrophobicContact CB-CD1 4.29Å; A50-I54 WeakPolarHBondContact O-CG1 3.39Å; A50-I54 PolarHBondContact O-N 2.96Å; A50-I54 VanDerWaalsContact O-N 3.09Å; F51-I54 PolarHBondContact O-N 2.95Å; I54-R57 PolarHBondContact O-N 2.91Å; I54-H58 VanDerWaalsContact O-CB 3.32Å; I54-H58 WeakPolarHBondContact O-CB 3.45Å; I54-H58 PolarHBondContact O-N 3.49Å
55V98.4Very high96.9Very high55 Ų55108.8 Ų108.833%0.33355%0.552SS.*Hα-helixtrans-62.8-47.2177.2171.90000111F51 P52 F53 R57 H58 Q59F51-V55 HydrophobicContact CD1-CG2 4.12Å; F51-V55 HydrophobicContact CE1-CG2 3.74Å; F51-V55 HydrophobicContact CE2-CG2 4.16Å; F51-V55 HydrophobicContact CG-CG2 4.48Å; F51-V55 HydrophobicContact CZ-CG2 3.77Å; F51-V55 WeakPolarHBondContact O-CG2 3.43Å; F51-V55 PolarHBondContact O-N 3.46Å; P52-V55 PolarHBondContact O-N 3.37Å; F53-V55 VanDerWaalsContact C-N 3.35Å; V55-R57 PolarHBondContact O-N 3.47Å; V55-H58 WeakPolarHBondContact O-CB 3.45Å; V55-H58 PolarHBondContact O-N 2.94Å; V55-H58 VanDerWaalsContact O-N 3.16Å; V55-Q59 HydrophobicContact CG1-CG 4.47Å; V55-Q59 WeakPolarHBondContact O-CG 3.33Å; V55-Q59 PolarHBondContact O-N 2.98Å
56V98.6Very high96.8Very high86 Ų86107.6 Ų107.652%0.52155%0.55SS.*Hα-helixtrans-58.2-49.8176.3169.20000110.4P52 F53 H58 Q59 L60P52-V56 WeakPolarHBondContact O-CG2 3.38Å; P52-V56 PolarHBondContact O-N 3.04Å; F53-V56 PolarHBondContact O-N 2.78Å; V56-H58 VanDerWaalsContact C-N 3.27Å; V56-H58 PolarHBondContact O-N 2.95Å; V56-Q59 PolarHBondContact O-N 2.92Å; V56-Q59 VanDerWaalsContact O-N 3.13Å; V56-L60 HydrophobicContact CG1-CD1 3.87Å; V56-L60 HydrophobicContact CG1-CG 4.27Å; V56-L60 WeakPolarHBondContact O-CG 3.5Å; V56-L60 PolarHBondContact O-N 3.4Å
57R98.1Very high96.6Very high167 Ų167112.1 Ų112.163%0.6356%0.563SS**Hα-helixtrans-56.2-44.1175.7-179-176.7179-80.1-2.1111.4F53 I54 V55 Q59 L60 L61F53-R57 WeakPolarHBondContact O-CB 3.27Å; F53-R57 PolarHBondContact O-N 2.83Å; I54-R57 PolarHBondContact O-N 2.91Å; V55-R57 PolarHBondContact O-N 3.47Å; R57-Q59 PolarHBondContact O-N 2.93Å; R57-L60 PolarHBondContact O-N 3.29Å; R57-L61 HydrophobicContact CG-CD1 3.91Å; R57-L61 HydrophobicContact CG-CG 4.5Å; R57-L61 VanDerWaalsContact CZ-CD1 3.44Å; R57-L61 WeakPolarHBondContact O-CB 3.31Å; R57-L61 VanDerWaalsContact O-CG 3.27Å; R57-L61 WeakPolarHBondContact O-CG 3.45Å; R57-L61 PolarHBondContact O-N 3.12Å; R57-L61 VanDerWaalsContact O-N 3.12Å
58H98.1Very high96.5Very high104 Ų104114.7 Ų114.748%0.48157%0.568SS.*Hα-helixtrans-61.3-43.2178.2174.569.7000111.7I54 V55 V56 L61 K62I54-H58 VanDerWaalsContact O-CB 3.32Å; I54-H58 WeakPolarHBondContact O-CB 3.45Å; I54-H58 PolarHBondContact O-N 3.49Å; V55-H58 WeakPolarHBondContact O-CB 3.45Å; V55-H58 PolarHBondContact O-N 2.94Å; V55-H58 VanDerWaalsContact O-N 3.16Å; V56-H58 VanDerWaalsContact C-N 3.27Å; V56-H58 PolarHBondContact O-N 2.95Å; H58-L61 PolarHBondContact O-N 3.43Å; H58-K62 VanDerWaalsContact CD2-CE 3.43Å; H58-K62 WeakPolarHBondContact CD2-CE 3.45Å; H58-K62 WeakPolarHBondContact NE2-CE 3.4Å; H58-K62 PolarHBondContact NE2-NZ 2.98Å; H58-K62 WeakPolarHBondContact O-CG 3.17Å; H58-K62 PolarHBondContact O-N 3.16Å
59Q98.3Very high96.4Very high104 Ų104119.1 Ų119.149%0.48657%0.573SS.*Hα-helixtrans-66-42.8176.9-63.2-65.1-0.800112.2V55 V56 R57 L61 K62V55-Q59 HydrophobicContact CG1-CG 4.47Å; V55-Q59 WeakPolarHBondContact O-CG 3.33Å; V55-Q59 PolarHBondContact O-N 2.98Å; V56-Q59 PolarHBondContact O-N 2.92Å; V56-Q59 VanDerWaalsContact O-N 3.13Å; R57-Q59 PolarHBondContact O-N 2.93Å; Q59-L61 PolarHBondContact O-N 3.35Å; Q59-K62 WeakPolarHBondContact O-CB 3.23Å; Q59-K62 PolarHBondContact O-N 3.26Å; Q59-K62 VanDerWaalsContact O-N 3.14Å
60L97.9Very high96.3Very high139 Ų139117.1 Ų117.173%0.72857%0.568SS**Hα-helixtrans-63.5-27178.5-68.5174.5000113.3V56 R57V56-L60 HydrophobicContact CG1-CD1 3.87Å; V56-L60 HydrophobicContact CG1-CG 4.27Å; V56-L60 WeakPolarHBondContact O-CG 3.5Å; V56-L60 PolarHBondContact O-N 3.4Å; R57-L60 PolarHBondContact O-N 3.29Å
61L97.8Very high96.1Very high111 Ų111123.3 Ų123.358%0.58159%0.588SS**THydrogen-bonded Turntrans-89.8-3.7178.9-67.3175.3000113.5R57 H58 Q59R57-L61 HydrophobicContact CG-CD1 3.91Å; R57-L61 HydrophobicContact CG-CG 4.5Å; R57-L61 VanDerWaalsContact CZ-CD1 3.44Å; R57-L61 WeakPolarHBondContact O-CB 3.31Å; R57-L61 VanDerWaalsContact O-CG 3.27Å; R57-L61 WeakPolarHBondContact O-CG 3.45Å; R57-L61 PolarHBondContact O-N 3.12Å; R57-L61 VanDerWaalsContact O-N 3.12Å; H58-L61 PolarHBondContact O-N 3.43Å; Q59-L61 PolarHBondContact O-N 3.35Å
62K93.9Very high95.9Very high107 Ų107121.9 Ų121.947%0.46559%0.586SS.*  trans-74.3129.5169.1-69.7176.1-176174.40108.7H58 Q59H58-K62 VanDerWaalsContact CD2-CE 3.43Å; H58-K62 WeakPolarHBondContact CD2-CE 3.45Å; H58-K62 WeakPolarHBondContact NE2-CE 3.4Å; H58-K62 PolarHBondContact NE2-NZ 2.98Å; H58-K62 WeakPolarHBondContact O-CG 3.17Å; H58-K62 PolarHBondContact O-N 3.16Å; Q59-K62 WeakPolarHBondContact O-CB 3.23Å; Q59-K62 PolarHBondContact O-N 3.26Å; Q59-K62 VanDerWaalsContact O-N 3.14Å
63K74Confident95.6Very high277 Ų277126.5 Ų126.5100%1.20460%0.598SS**  trans-90.80165.2-70-170.9178.6-171.60109.4

Retrieved 63 of 63 residues in 61.3 ms (Link to these results)