A0A673WMV1_SALTR Loading...

Cytochrome c oxidase subunit 7C, mitochondrial

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

AlphaFold DB , UniProt , Accession A0A673WMV1, Species SALTR (Salmo trutta, Brown trout), Gene COX7C, Length 63 aa.

						>A0A673WMV1_SALTR|A0A673WMV1|COX7C
MLGQVVRRFTTSAVRSSHYGEGPGQNLPFSVDNKWRLLAMMVVFFGSGFAFPFIVVRHQLLKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68	Low	82.3	Confident	209 Å²	209	116.9 Å²	116.9	100%	1.03	59%	0.593	S	S	*	*				0	-47.7	0	-65.9	-59.3	177.2	0	0	112.9	G3 Q4 V5	M1-G3 PolarHBondContact O-N 3.12Å; M1-Q4 PolarHBondContact O-N 3.39Å; M1-V5 PolarHBondContact O-N 2.91Å
2	L	81.6	Confident	81.8	Confident	137 Å²	137	113.7 Å²	113.7	72%	0.717	59%	0.589	S	S	*	*	H	α-helix	trans	-60.3	-43	-175.9	-149.9	157.4	0	0	0	114.3	Q4 V5 V6	L2-Q4 VanDerWaalsContact C-N 3.33Å; L2-Q4 PolarHBondContact O-N 3.41Å; L2-V5 WeakPolarHBondContact O-CB 3.34Å; L2-V5 PolarHBondContact O-N 3.39Å; L2-V5 VanDerWaalsContact O-N 3.12Å; L2-V6 HydrophobicContact CD2-CG2 3.77Å; L2-V6 WeakPolarHBondContact O-CG2 3.49Å; L2-V6 PolarHBondContact O-N 3.16Å
3	G	83.4	Confident	81.6	Confident	54 Å²	54	109.6 Å²	109.6	56%	0.557	58%	0.582	S	S	*	*	H	α-helix	trans	-64	-31.9	177.5	0	0	0	0	0	114.6	M1 R7	M1-G3 PolarHBondContact O-N 3.12Å; G3-R7 VanDerWaalsContact O-CB 3.31Å; G3-R7 WeakPolarHBondContact O-CB 3.44Å; G3-R7 PolarHBondContact O-N 3.27Å
4	Q	81.8	Confident	81.5	Confident	105 Å²	105	108.9 Å²	108.9	49%	0.491	58%	0.584	S	S	.	*	H	α-helix	trans	-69.3	-37.6	173.5	-74.7	-74.6	-66.6	0	0	111.3	M1 L2 R8	M1-Q4 PolarHBondContact O-N 3.39Å; L2-Q4 VanDerWaalsContact C-N 3.33Å; L2-Q4 PolarHBondContact O-N 3.41Å; Q4-R8 WeakPolarHBondContact O-CB 3.33Å; Q4-R8 VanDerWaalsContact O-CG 3.23Å; Q4-R8 WeakPolarHBondContact O-CG 2.95Å; Q4-R8 PolarHBondContact O-N 3.14Å
5	V	85.6	Confident	81.3	Confident	68 Å²	68	114.4 Å²	114.4	41%	0.412	59%	0.593	S	S	.	*	H	α-helix	trans	-66.8	-47.8	176.5	173.6	0	0	0	0	110.6	M1 L2 R7 R8 F9	M1-V5 PolarHBondContact O-N 2.91Å; L2-V5 WeakPolarHBondContact O-CB 3.34Å; L2-V5 PolarHBondContact O-N 3.39Å; L2-V5 VanDerWaalsContact O-N 3.12Å; V5-R7 VanDerWaalsContact C-N 3.33Å; V5-R7 PolarHBondContact O-N 3.49Å; V5-R8 PolarHBondContact O-N 2.9Å; V5-R8 VanDerWaalsContact O-N 3.16Å; V5-F9 HydrophobicContact CG1-CD2 3.57Å; V5-F9 HydrophobicContact CG1-CE2 3.36Å; V5-F9 WeakPolarHBondContact O-CD2 3.27Å; V5-F9 PolarHBondContact O-N 3.34Å
6	V	87.5	Confident	80.8	Confident	75 Å²	75	110.6 Å²	110.6	46%	0.455	58%	0.58	S	S	.	*	H	α-helix	trans	-59.3	-43.6	175.2	172.4	0	0	0	0	111.3	L2 R8 F9 T10	L2-V6 HydrophobicContact CD2-CG2 3.77Å; L2-V6 WeakPolarHBondContact O-CG2 3.49Å; L2-V6 PolarHBondContact O-N 3.16Å; V6-R8 PolarHBondContact O-N 3.33Å; V6-F9 PolarHBondContact O-N 2.82Å; V6-T10 HydrophobicContact CG1-CG2 4.27Å; V6-T10 WeakPolarHBondContact O-CB 3.43Å; V6-T10 WeakPolarHBondContact O-CG2 3.47Å; V6-T10 PolarHBondContact O-N 3.3Å; V6-T10 PolarHBondContact O-OG1 3.13Å
7	R	84	Confident	80.5	Confident	169 Å²	169	109.5 Å²	109.5	64%	0.638	58%	0.583	S	S	*	*	H	α-helix	trans	-60.1	-45.1	175.4	-172.5	174.5	178.3	174.2	-0.9	111.6	G3 V5 T10 T11	G3-R7 VanDerWaalsContact O-CB 3.31Å; G3-R7 WeakPolarHBondContact O-CB 3.44Å; G3-R7 PolarHBondContact O-N 3.27Å; V5-R7 VanDerWaalsContact C-N 3.33Å; V5-R7 PolarHBondContact O-N 3.49Å; R7-T10 WeakPolarHBondContact CA-OG1 3.47Å; R7-T10 PolarHBondContact O-OG1 3.47Å; R7-T11 HydrophobicContact CG-CG2 4.46Å; R7-T11 WeakPolarHBondContact O-CB 3.32Å; R7-T11 VanDerWaalsContact O-CG2 3.27Å; R7-T11 WeakPolarHBondContact O-CG2 3.43Å; R7-T11 PolarHBondContact O-N 3.09Å; R7-T11 PolarHBondContact O-OG1 3.42Å
8	R	83.4	Confident	80.6	Confident	167 Å²	167	111.4 Å²	111.4	63%	0.63	59%	0.588	S	S	*	*	H	α-helix	trans	-62.5	-44.5	177.7	-72.8	170.3	-174	-169.1	1.4	112.2	Q4 V5 V6 T11 S12	Q4-R8 WeakPolarHBondContact O-CB 3.33Å; Q4-R8 VanDerWaalsContact O-CG 3.23Å; Q4-R8 WeakPolarHBondContact O-CG 2.95Å; Q4-R8 PolarHBondContact O-N 3.14Å; V5-R8 PolarHBondContact O-N 2.9Å; V5-R8 VanDerWaalsContact O-N 3.16Å; V6-R8 PolarHBondContact O-N 3.33Å; R8-T11 WeakPolarHBondContact CA-OG1 3.37Å; R8-T11 PolarHBondContact O-N 3.14Å; R8-T11 PolarHBondContact O-OG1 2.85Å; R8-S12 PolarHBondContact O-N 3.22Å; R8-S12 PolarHBondContact O-OG 3.32Å; R8-S12 VanDerWaalsContact O-OG 3.1Å
9	F	86	Confident	80.7	Confident	149 Å²	149	114.1 Å²	114.1	65%	0.654	59%	0.59	S	S	*	*	H	α-helix	trans	-64.4	-47.9	177.8	-81.6	-67.8	0	0	0	112.6	V5 V6 T11 S12 A13	V5-F9 HydrophobicContact CG1-CD2 3.57Å; V5-F9 HydrophobicContact CG1-CE2 3.36Å; V5-F9 WeakPolarHBondContact O-CD2 3.27Å; V5-F9 PolarHBondContact O-N 3.34Å; V6-F9 PolarHBondContact O-N 2.82Å; F9-T11 VanDerWaalsContact C-N 3.35Å; F9-T11 PolarHBondContact O-N 2.95Å; F9-S12 PolarHBondContact O-N 3.46Å; F9-A13 PolarHBondContact O-N 2.88Å
10	T	83.2	Confident	80.9	Confident	73 Å²	73	110.4 Å²	110.4	45%	0.448	58%	0.582	S	S	.	*	H	α-helix	trans	-61.8	-41.6	177.7	50	0	0	0	0	111.6	V6 R7 S12 A13 V14	V6-T10 HydrophobicContact CG1-CG2 4.27Å; V6-T10 WeakPolarHBondContact O-CB 3.43Å; V6-T10 WeakPolarHBondContact O-CG2 3.47Å; V6-T10 PolarHBondContact O-N 3.3Å; V6-T10 PolarHBondContact O-OG1 3.13Å; R7-T10 WeakPolarHBondContact CA-OG1 3.47Å; R7-T10 PolarHBondContact O-OG1 3.47Å; T10-S12 VanDerWaalsContact C-N 3.35Å; T10-S12 PolarHBondContact O-N 3.4Å; T10-A13 PolarHBondContact O-N 2.9Å; T10-V14 WeakPolarHBondContact O-CB 3.24Å; T10-V14 VanDerWaalsContact O-CG2 3.24Å; T10-V14 WeakPolarHBondContact O-CG2 3.14Å; T10-V14 PolarHBondContact O-N 3.13Å
11	T	80.9	Confident	81.1	Confident	80 Å²	80	111.8 Å²	111.8	49%	0.491	59%	0.585	S	S	.	*	H	α-helix	trans	-64.5	-37	175.5	51.8	0	0	0	0	113.1	R7 R8 F9 R15	R7-T11 HydrophobicContact CG-CG2 4.46Å; R7-T11 WeakPolarHBondContact O-CB 3.32Å; R7-T11 VanDerWaalsContact O-CG2 3.27Å; R7-T11 WeakPolarHBondContact O-CG2 3.43Å; R7-T11 PolarHBondContact O-N 3.09Å; R7-T11 PolarHBondContact O-OG1 3.42Å; R8-T11 WeakPolarHBondContact CA-OG1 3.37Å; R8-T11 PolarHBondContact O-N 3.14Å; R8-T11 PolarHBondContact O-OG1 2.85Å; F9-T11 VanDerWaalsContact C-N 3.35Å; F9-T11 PolarHBondContact O-N 2.95Å; T11-R15 WeakPolarHBondContact O-CB 3.44Å; T11-R15 PolarHBondContact O-N 3.47Å; T11-R15 VanDerWaalsContact O-N 3.08Å
12	S	76.8	Confident	82.1	Confident	78 Å²	78	103.8 Å²	103.8	55%	0.545	56%	0.557	S	S	.	*	H	α-helix	trans	-68.2	-42.7	176.5	-65.7	0	0	0	0	111.8	R8 F9 T10 R15 S16	R8-S12 PolarHBondContact O-N 3.22Å; R8-S12 PolarHBondContact O-OG 3.32Å; R8-S12 VanDerWaalsContact O-OG 3.1Å; F9-S12 PolarHBondContact O-N 3.46Å; T10-S12 VanDerWaalsContact C-N 3.35Å; T10-S12 PolarHBondContact O-N 3.4Å; S12-R15 PolarHBondContact O-N 2.99Å; S12-S16 PolarHBondContact O-N 3.21Å; S12-S16 VanDerWaalsContact O-N 3.08Å
13	A	79.2	Confident	82.7	Confident	61 Å²	61	103.8 Å²	103.8	50%	0.504	57%	0.565	S	S	.	*	H	α-helix	trans	-64.4	-42.9	177.5	0	0	0	0	0	112.1	F9 T10 R15 S16 S17	F9-A13 PolarHBondContact O-N 2.88Å; T10-A13 PolarHBondContact O-N 2.9Å; A13-R15 VanDerWaalsContact C-N 3.31Å; A13-R15 PolarHBondContact O-N 3.38Å; A13-S16 PolarHBondContact O-N 2.89Å; A13-S17 PolarHBondContact O-N 3.23Å; A13-S17 PolarHBondContact O-OG 3.43Å
14	V	80.1	Confident	83.2	Confident	100 Å²	100	102 Å²	102	61%	0.606	55%	0.546	S	S	*	.	H	α-helix	trans	-65.7	-33.8	176.8	171.2	0	0	0	0	111.9	T10 S17	T10-V14 WeakPolarHBondContact O-CB 3.24Å; T10-V14 VanDerWaalsContact O-CG2 3.24Å; T10-V14 WeakPolarHBondContact O-CG2 3.14Å; T10-V14 PolarHBondContact O-N 3.13Å; V14-S17 PolarHBondContact O-OG 3.49Å; V14-S17 VanDerWaalsContact O-OG 3.06Å
15	R	77.7	Confident	83.7	Confident	191 Å²	191	102.1 Å²	102.1	72%	0.721	55%	0.547	S	S	*	.	H	α-helix	trans	-70.2	-40.7	176.6	-178.1	177.3	174.6	168.1	-0.3	112.1	T11 S12 A13 Y19	T11-R15 WeakPolarHBondContact O-CB 3.44Å; T11-R15 PolarHBondContact O-N 3.47Å; T11-R15 VanDerWaalsContact O-N 3.08Å; S12-R15 PolarHBondContact O-N 2.99Å; A13-R15 VanDerWaalsContact C-N 3.31Å; A13-R15 PolarHBondContact O-N 3.38Å; R15-Y19 WeakPolarHBondContact O-CD2 3.32Å
16	S	74.5	Confident	84	Confident	54 Å²	54	105 Å²	105	38%	0.378	56%	0.56	S	S	.	*	H	α-helix	trans	-68.4	-40.7	178.6	135.4	0	0	0	0	111	S12 A13 H18 Y19 E21	S12-S16 PolarHBondContact O-N 3.21Å; S12-S16 VanDerWaalsContact O-N 3.08Å; A13-S16 PolarHBondContact O-N 2.89Å; S16-H18 PolarHBondContact O-N 3.41Å; S16-Y19 PolarHBondContact O-N 2.96Å; S16-Y19 VanDerWaalsContact O-O 3.13Å; S16-E21 WeakPolarHBondContact CB-OE1 3.39Å; S16-E21 PolarHBondContact OG-OE1 2.92Å
17	S	74.9	Confident	84.3	Confident	92 Å²	92	105 Å²	105	64%	0.643	56%	0.557	S	S	*	*	H	α-helix	trans	-66.5	-19.9	-179.9	66.9	0	0	0	0	115.2	A13 V14	A13-S17 PolarHBondContact O-N 3.23Å; A13-S17 PolarHBondContact O-OG 3.43Å; V14-S17 PolarHBondContact O-OG 3.49Å; V14-S17 VanDerWaalsContact O-OG 3.06Å
18	H	82.4	Confident	84.8	Confident	144 Å²	144	103.1 Å²	103.1	67%	0.667	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.8	-24.2	-179.4	-173.2	-80.6	0	0	0	113.2	S16	S16-H18 PolarHBondContact O-N 3.41Å
19	Y	83.1	Confident	85.4	Confident	161 Å²	161	98.6 Å²	98.6	63%	0.631	55%	0.552	S	S	*	*	S	Bend	trans	-105.4	137.7	179.1	-65.2	-79.8	0	0	0	109.4	R15 S16 E21	R15-Y19 WeakPolarHBondContact O-CD2 3.32Å; S16-Y19 PolarHBondContact O-N 2.96Å; S16-Y19 VanDerWaalsContact O-O 3.13Å; Y19-E21 PolarHBondContact O-N 3.34Å
20	G	84.2	Confident	85.9	Confident	41 Å²	41	93.3 Å²	93.3	42%	0.423	53%	0.533	S	S	.	.			trans	-59.6	126.2	174.5	0	0	0	0	0	109.9	Q25	G20-Q25 VanDerWaalsContact C-CB 3.41Å; G20-Q25 VanDerWaalsContact O-CB 3.28Å; G20-Q25 WeakPolarHBondContact O-CB 3.44Å
21	E	85.2	Confident	86.5	Confident	139 Å²	139	92.2 Å²	92.2	65%	0.65	53%	0.526	S	S	*	.			trans	-96.9	150.6	175.4	-62.5	-171.3	168.4	0	0	110.3	S16 Y19	S16-E21 WeakPolarHBondContact CB-OE1 3.39Å; S16-E21 PolarHBondContact OG-OE1 2.92Å; Y19-E21 PolarHBondContact O-N 3.34Å
22	G	88.8	Confident	87.3	Confident	42 Å²	42	94.5 Å²	94.5	43%	0.433	54%	0.535	S	S	.	.	S	Bend	trans	98.9	175.4	177.2	0	0	0	0	0	115.2	G24 Q25	G22-G24 PolarHBondContact O-N 2.91Å; G22-Q25 PolarHBondContact O-N 3.4Å
23	P	94.6	Very high	88.3	Confident	136 Å²	136	94.2 Å²	94.2	88%	0.883	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.3	131.1	-175.3	-25.4	35.2	0	0	0	112.6	Q25	P23-Q25 VanDerWaalsContact C-N 3.26Å; P23-Q25 PolarHBondContact O-N 3.43Å
24	G	93.6	Very high	89.2	Confident	16 Å²	16	98.7 Å²	98.7	17%	0.165	54%	0.536	C	S	.	.	T	Hydrogen-bonded Turn	trans	84.6	-15.4	177.6	0	0	0	0	0	115.4	G22	G22-G24 PolarHBondContact O-N 2.91Å
25	Q	92.7	Very high	90	Very high	108 Å²	108	102.5 Å²	102.5	51%	0.505	54%	0.539	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.5	-17.4	179.2	-63.8	-64.2	-22.5	0	0	113.4	G20 G22 P23 L27	G20-Q25 VanDerWaalsContact C-CB 3.41Å; G20-Q25 VanDerWaalsContact O-CB 3.28Å; G20-Q25 WeakPolarHBondContact O-CB 3.44Å; G22-Q25 PolarHBondContact O-N 3.4Å; P23-Q25 VanDerWaalsContact C-N 3.26Å; P23-Q25 PolarHBondContact O-N 3.43Å; Q25-L27 VanDerWaalsContact C-N 3.32Å
26	N	91.6	Very high	91	Very high	128 Å²	128	98.4 Å²	98.4	68%	0.684	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.8	13.3	177.6	67.4	-19.7	0	0	0	113.5
27	L	94.1	Very high	92.2	Very high	75 Å²	75	97.9 Å²	97.9	39%	0.393	52%	0.517	S	S	.	.	S	Bend	trans	-103	146.1	-178.9	-62.5	176.7	0	0	0	110.7	Q25 F29 V31	Q25-L27 VanDerWaalsContact C-N 3.32Å; L27-F29 HydrophobicContact CB-CE1 4.47Å; L27-F29 HydrophobicContact CB-CZ 4.47Å; L27-F29 HydrophobicContact CD1-CE2 4.05Å; L27-F29 HydrophobicContact CD1-CZ 4.07Å; L27-F29 PolarHBondContact O-N 3.44Å; L27-F29 VanDerWaalsContact O-N 3.11Å; L27-V31 HydrophobicContact CD1-CG1 3.78Å
28	P	94.3	Very high	93.3	Very high	130 Å²	130	98 Å²	98	84%	0.844	51%	0.51	S	S	*	.	S	Bend	trans	-76.8	10.4	177.1	32.5	-34.8	0	0	0	113.5
29	F	96	Very high	94.1	Very high	73 Å²	73	93.7 Å²	93.7	32%	0.32	50%	0.499	S	S	.	.	S	Bend	trans	-145	147.8	175.6	55.5	-91.3	0	0	0	108.9	L27 V31 L37 M40 M41	L27-F29 HydrophobicContact CB-CE1 4.47Å; L27-F29 HydrophobicContact CB-CZ 4.47Å; L27-F29 HydrophobicContact CD1-CE2 4.05Å; L27-F29 HydrophobicContact CD1-CZ 4.07Å; L27-F29 PolarHBondContact O-N 3.44Å; L27-F29 VanDerWaalsContact O-N 3.11Å; F29-V31 HydrophobicContact CD2-CG1 4.24Å; F29-V31 HydrophobicContact CE2-CG1 3.96Å; F29-L37 HydrophobicContact CD2-CD1 3.78Å; F29-L37 HydrophobicContact CE2-CD1 3.63Å; F29-M40 HydrophobicContact CB-SD 4.37Å; F29-M41 HydrophobicContact CD2-CE 4.42Å; F29-M41 HydrophobicContact CE2-CE 4.17Å; F29-M41 HydrophobicContact CZ-CE 4.25Å
30	S	95.4	Very high	94.8	Very high	37 Å²	37	90.1 Å²	90.1	26%	0.259	49%	0.49	S	S	.	.			trans	-82.5	138.8	-177.9	165.1	0	0	0	0	112.2	D32 R36	S30-D32 PolarHBondContact OG-N 3.47Å; S30-D32 PolarHBondContact OG-OD2 2.92Å; S30-R36 PolarHBondContact OG-NH2 3.27Å
31	V	97.1	Very high	95.5	Very high	50 Å²	50	90.8 Å²	90.8	30%	0.303	48%	0.482	S	S	.	.			trans	-104.4	4.1	177.2	-63.1	0	0	0	0	113.5	L27 F29 N33 L37	L27-V31 HydrophobicContact CD1-CG1 3.78Å; F29-V31 HydrophobicContact CD2-CG1 4.24Å; F29-V31 HydrophobicContact CE2-CG1 3.96Å; V31-N33 VanDerWaalsContact C-N 3.28Å; V31-N33 PolarHBondContact O-N 3.06Å; V31-L37 HydrophobicContact CB-CD2 4.21Å; V31-L37 HydrophobicContact CG1-CD1 4.13Å; V31-L37 HydrophobicContact CG1-CD2 4.01Å
32	D	96.6	Very high	96.1	Very high	128 Å²	128	88.6 Å²	88.6	68%	0.684	48%	0.478	S	S	*	.	S	Bend	trans	-63.1	-32.9	-172.2	-55.6	-40	0	0	0	113.2	S30	S30-D32 PolarHBondContact OG-N 3.47Å; S30-D32 PolarHBondContact OG-OD2 2.92Å
33	N	97.9	Very high	96.6	Very high	73 Å²	73	91.5 Å²	91.5	39%	0.39	49%	0.487	S	S	.	.			trans	-116.3	111.8	177.1	-176.9	-27.1	0	0	0	110.1	V31 W35 R36 L37	V31-N33 VanDerWaalsContact C-N 3.28Å; V31-N33 PolarHBondContact O-N 3.06Å; N33-W35 VanDerWaalsContact C-N 3.25Å; N33-W35 PolarHBondContact O-N 3.24Å; N33-W35 WeakPolarHBondContact OD1-CB 3.46Å; N33-W35 PolarHBondContact OD1-N 2.84Å; N33-R36 HydrophobicContact CB-CB 4.05Å; N33-R36 PolarHBondContact O-N 2.95Å; N33-R36 VanDerWaalsContact O-N 3.13Å; N33-R36 PolarHBondContact OD1-N 2.89Å; N33-L37 PolarHBondContact O-N 3.33Å
34	K	97.8	Very high	96.8	Very high	155 Å²	155	91.7 Å²	91.7	67%	0.674	47%	0.474	S	S	*	.	H	α-helix	trans	-56.1	-34	-179.8	67.8	-173.5	179.1	-169.7	0	114.3	L38	K34-L38 VanDerWaalsContact O-CB 3.32Å; K34-L38 WeakPolarHBondContact O-CB 3.18Å; K34-L38 PolarHBondContact O-N 3.44Å
35	W	98.6	Very high	97	Very high	179 Å²	179	97.2 Å²	97.2	68%	0.678	49%	0.494	S	S	*	.	H	α-helix	trans	-75.2	-38.5	179.3	-62.6	114.6	0	0	0	111.8	N33 L38 A39	N33-W35 VanDerWaalsContact C-N 3.25Å; N33-W35 PolarHBondContact O-N 3.24Å; N33-W35 WeakPolarHBondContact OD1-CB 3.46Å; N33-W35 PolarHBondContact OD1-N 2.84Å; W35-L38 HydrophobicContact CE3-CD2 4.04Å; W35-L38 HydrophobicContact CZ3-CD2 4.13Å; W35-L38 PolarHBondContact O-N 2.9Å; W35-A39 WeakPolarHBondContact O-CB 3.34Å; W35-A39 PolarHBondContact O-N 2.8Å
36	R	98.2	Very high	97.3	Very high	105 Å²	105	93.6 Å²	93.6	40%	0.396	49%	0.486	S	S	.	.	H	α-helix	trans	-64.9	-43.6	172.1	-173.9	178.4	67.6	-140.6	-3.7	110.7	S30 N33 A39 M40	S30-R36 PolarHBondContact OG-NH2 3.27Å; N33-R36 HydrophobicContact CB-CB 4.05Å; N33-R36 PolarHBondContact O-N 2.95Å; N33-R36 VanDerWaalsContact O-N 3.13Å; N33-R36 PolarHBondContact OD1-N 2.89Å; R36-A39 PolarHBondContact O-N 2.97Å; R36-M40 HydrophobicContact CG-CE 4.44Å; R36-M40 HydrophobicContact CG-SD 4.5Å; R36-M40 WeakPolarHBondContact O-CG 3.34Å; R36-M40 PolarHBondContact O-N 2.68Å
37	L	98.5	Very high	97.6	Very high	44 Å²	44	90.8 Å²	90.8	23%	0.23	48%	0.476	C	S	.	.	H	α-helix	trans	-59.8	-47.9	176.3	178.6	61.4	0	0	0	111	F29 V31 N33 A39 M40 M41	F29-L37 HydrophobicContact CD2-CD1 3.78Å; F29-L37 HydrophobicContact CE2-CD1 3.63Å; V31-L37 HydrophobicContact CB-CD2 4.21Å; V31-L37 HydrophobicContact CG1-CD1 4.13Å; V31-L37 HydrophobicContact CG1-CD2 4.01Å; N33-L37 PolarHBondContact O-N 3.33Å; L37-A39 PolarHBondContact O-N 3.44Å; L37-M40 PolarHBondContact O-N 3.22Å; L37-M41 HydrophobicContact CD1-CE 4.22Å; L37-M41 HydrophobicContact CD1-CG 4.17Å; L37-M41 HydrophobicContact CG-CG 4.44Å; L37-M41 VanDerWaalsContact O-CG 3.3Å; L37-M41 WeakPolarHBondContact O-CG 3.11Å; L37-M41 PolarHBondContact O-N 3.11Å
38	L	98.7	Very high	97.8	Very high	93 Å²	93	89.5 Å²	89.5	49%	0.487	48%	0.481	S	S	.	.	H	α-helix	trans	-56.1	-49.8	176.2	177.8	65.4	0	0	0	111.3	K34 W35 M40 M41 V42	K34-L38 VanDerWaalsContact O-CB 3.32Å; K34-L38 WeakPolarHBondContact O-CB 3.18Å; K34-L38 PolarHBondContact O-N 3.44Å; W35-L38 HydrophobicContact CE3-CD2 4.04Å; W35-L38 HydrophobicContact CZ3-CD2 4.13Å; W35-L38 PolarHBondContact O-N 2.9Å; L38-M40 VanDerWaalsContact C-N 3.34Å; L38-M40 PolarHBondContact O-N 2.66Å; L38-M41 PolarHBondContact O-N 3.5Å; L38-V42 HydrophobicContact CD1-CG2 4.18Å; L38-V42 HydrophobicContact CG-CG2 4.46Å; L38-V42 WeakPolarHBondContact O-CG2 3.31Å; L38-V42 PolarHBondContact O-N 2.85Å
39	A	98.6	Very high	98	Very high	55 Å²	55	90.4 Å²	90.4	46%	0.455	47%	0.472	S	S	.	.	H	α-helix	trans	-59.4	-44.5	178.6	0	0	0	0	0	111.8	W35 R36 L37 M41 V42 V43	W35-A39 WeakPolarHBondContact O-CB 3.34Å; W35-A39 PolarHBondContact O-N 2.8Å; R36-A39 PolarHBondContact O-N 2.97Å; L37-A39 PolarHBondContact O-N 3.44Å; A39-M41 PolarHBondContact O-N 3.25Å; A39-V42 PolarHBondContact O-N 2.88Å; A39-V43 WeakPolarHBondContact O-CG2 3.37Å; A39-V43 PolarHBondContact O-N 2.89Å
40	M	98.4	Very high	98.2	Very high	86 Å²	86	88.6 Å²	88.6	42%	0.424	47%	0.471	S	S	.	.	H	α-helix	trans	-61	-43.4	176.2	-77.6	-176.1	165.6	0	0	112.4	F29 R36 L37 L38 V43 F44	F29-M40 HydrophobicContact CB-SD 4.37Å; R36-M40 HydrophobicContact CG-CE 4.44Å; R36-M40 HydrophobicContact CG-SD 4.5Å; R36-M40 WeakPolarHBondContact O-CG 3.34Å; R36-M40 PolarHBondContact O-N 2.68Å; L37-M40 PolarHBondContact O-N 3.22Å; L38-M40 VanDerWaalsContact C-N 3.34Å; L38-M40 PolarHBondContact O-N 2.66Å; M40-V43 PolarHBondContact O-N 3.37Å; M40-F44 VanDerWaalsContact O-CB 3.29Å; M40-F44 WeakPolarHBondContact O-CB 3.32Å; M40-F44 PolarHBondContact O-N 3.3Å
41	M	98.6	Very high	98.3	Very high	55 Å²	55	93.5 Å²	93.5	27%	0.271	49%	0.488	S	S	.	.	H	α-helix	trans	-65.8	-44	178.3	-67.3	-60.3	97.8	0	0	111.8	F29 L37 L38 A39 V43 F44 F45	F29-M41 HydrophobicContact CD2-CE 4.42Å; F29-M41 HydrophobicContact CE2-CE 4.17Å; F29-M41 HydrophobicContact CZ-CE 4.25Å; L37-M41 HydrophobicContact CD1-CE 4.22Å; L37-M41 HydrophobicContact CD1-CG 4.17Å; L37-M41 HydrophobicContact CG-CG 4.44Å; L37-M41 VanDerWaalsContact O-CG 3.3Å; L37-M41 WeakPolarHBondContact O-CG 3.11Å; L37-M41 PolarHBondContact O-N 3.11Å; L38-M41 PolarHBondContact O-N 3.5Å; A39-M41 PolarHBondContact O-N 3.25Å; M41-V43 VanDerWaalsContact C-N 3.34Å; M41-V43 PolarHBondContact O-N 3.22Å; M41-F44 PolarHBondContact O-N 3.39Å; M41-F45 HydrophobicContact CB-CD2 4.28Å; M41-F45 HydrophobicContact CB-CE2 4.47Å; M41-F45 WeakPolarHBondContact O-CB 3.3Å; M41-F45 VanDerWaalsContact O-CD2 3.26Å; M41-F45 WeakPolarHBondContact O-CD2 3.47Å; M41-F45 PolarHBondContact O-N 3.34Å; M41-F45 HydrophobicContact SD-CD2 4.4Å; M41-F45 HydrophobicContact SD-CE2 3.73Å
42	V	98.7	Very high	98.4	Very high	93 Å²	93	94.5 Å²	94.5	56%	0.564	50%	0.495	S	S	*	.	H	α-helix	trans	-61.3	-43.6	176.9	170.4	0	0	0	0	110.8	L38 A39 G46	L38-V42 HydrophobicContact CD1-CG2 4.18Å; L38-V42 HydrophobicContact CG-CG2 4.46Å; L38-V42 WeakPolarHBondContact O-CG2 3.31Å; L38-V42 PolarHBondContact O-N 2.85Å; A39-V42 PolarHBondContact O-N 2.88Å; V42-G46 WeakPolarHBondContact O-CA 3.26Å; V42-G46 PolarHBondContact O-N 3.25Å
43	V	98.6	Very high	98.5	Very high	102 Å²	102	94.8 Å²	94.8	62%	0.618	49%	0.49	S	S	*	.	H	α-helix	trans	-65.8	-49.8	177.6	171.3	0	0	0	0	110.8	A39 M40 M41 S47	A39-V43 WeakPolarHBondContact O-CG2 3.37Å; A39-V43 PolarHBondContact O-N 2.89Å; M40-V43 PolarHBondContact O-N 3.37Å; M41-V43 VanDerWaalsContact C-N 3.34Å; M41-V43 PolarHBondContact O-N 3.22Å; V43-S47 WeakPolarHBondContact O-CB 3.44Å; V43-S47 PolarHBondContact O-N 3.18Å; V43-S47 PolarHBondContact O-OG 3.36Å
44	F	98.4	Very high	98.5	Very high	141 Å²	141	96.5 Å²	96.5	62%	0.618	50%	0.498	S	S	*	.	H	α-helix	trans	-61.6	-53.8	-176.4	179.7	-104.4	0	0	0	112.6	M40 M41 S47 G48	M40-F44 VanDerWaalsContact O-CB 3.29Å; M40-F44 WeakPolarHBondContact O-CB 3.32Å; M40-F44 PolarHBondContact O-N 3.3Å; M41-F44 PolarHBondContact O-N 3.39Å; F44-S47 PolarHBondContact O-OG 3.44Å; F44-S47 VanDerWaalsContact O-OG 3.06Å; F44-G48 PolarHBondContact O-N 3.08Å
45	F	98.7	Very high	98.5	Very high	131 Å²	131	91.7 Å²	91.7	58%	0.575	48%	0.482	S	S	*	.	H	α-helix	trans	-74.5	-40.4	179.8	-67.5	-64.8	0	0	0	111.9	M41 S47 G48 F49	M41-F45 HydrophobicContact CB-CD2 4.28Å; M41-F45 HydrophobicContact CB-CE2 4.47Å; M41-F45 WeakPolarHBondContact O-CB 3.3Å; M41-F45 VanDerWaalsContact O-CD2 3.26Å; M41-F45 WeakPolarHBondContact O-CD2 3.47Å; M41-F45 PolarHBondContact O-N 3.34Å; M41-F45 HydrophobicContact SD-CD2 4.4Å; M41-F45 HydrophobicContact SD-CE2 3.73Å; F45-S47 VanDerWaalsContact C-N 3.33Å; F45-S47 PolarHBondContact O-N 2.57Å; F45-G48 PolarHBondContact O-N 3.32Å; F45-F49 VanDerWaalsContact O-CB 3.31Å; F45-F49 WeakPolarHBondContact O-CB 3.23Å; F45-F49 PolarHBondContact O-N 3.06Å
46	G	98.7	Very high	98.5	Very high	32 Å²	32	87.3 Å²	87.3	33%	0.33	48%	0.475	S	S	.	.	H	α-helix	trans	-62.7	-38.7	179	0	0	0	0	0	112.3	V42 F49 A50	V42-G46 WeakPolarHBondContact O-CA 3.26Å; V42-G46 PolarHBondContact O-N 3.25Å; G46-F49 PolarHBondContact O-N 3.02Å; G46-A50 WeakPolarHBondContact O-CB 3.28Å; G46-A50 PolarHBondContact O-N 2.97Å
47	S	98.5	Very high	98.5	Very high	70 Å²	70	90.2 Å²	90.2	49%	0.49	49%	0.486	S	S	.	.	H	α-helix	trans	-66.4	-45.1	174.7	65	0	0	0	0	111.7	V43 F44 F45 F49 A50 F51	V43-S47 WeakPolarHBondContact O-CB 3.44Å; V43-S47 PolarHBondContact O-N 3.18Å; V43-S47 PolarHBondContact O-OG 3.36Å; F44-S47 PolarHBondContact O-OG 3.44Å; F44-S47 VanDerWaalsContact O-OG 3.06Å; F45-S47 VanDerWaalsContact C-N 3.33Å; F45-S47 PolarHBondContact O-N 2.57Å; S47-F49 VanDerWaalsContact C-N 3.32Å; S47-F49 PolarHBondContact O-N 3.08Å; S47-A50 PolarHBondContact O-N 3.38Å; S47-F51 VanDerWaalsContact O-CB 3.23Å; S47-F51 WeakPolarHBondContact O-CB 3.47Å; S47-F51 PolarHBondContact O-N 3.1Å
48	G	98.3	Very high	98.5	Very high	48 Å²	48	93.1 Å²	93.1	50%	0.495	50%	0.498	S	S	.	.	H	α-helix	trans	-62	-40.5	177.6	0	0	0	0	0	112.4	F44 F45 P52	F44-G48 PolarHBondContact O-N 3.08Å; F45-G48 PolarHBondContact O-N 3.32Å; G48-P52 VanDerWaalsContact O-CD 3.3Å; G48-P52 WeakPolarHBondContact O-CD 3.41Å
49	F	98.6	Very high	98.5	Very high	148 Å²	148	93.6 Å²	93.6	65%	0.649	50%	0.498	S	S	*	.	H	α-helix	trans	-71	-42.1	177.6	-179.6	-103.7	0	0	0	112.8	F45 G46 S47 P52 F53	F45-F49 VanDerWaalsContact O-CB 3.31Å; F45-F49 WeakPolarHBondContact O-CB 3.23Å; F45-F49 PolarHBondContact O-N 3.06Å; G46-F49 PolarHBondContact O-N 3.02Å; S47-F49 VanDerWaalsContact C-N 3.32Å; S47-F49 PolarHBondContact O-N 3.08Å; F49-P52 WeakPolarHBondContact O-CD 3.29Å; F49-F53 HydrophobicContact CD1-CE2 4.47Å; F49-F53 HydrophobicContact CE1-CE2 4.03Å; F49-F53 HydrophobicContact CE2-CE2 4.15Å; F49-F53 AromaticContact CZ-CE2 3.86Å; F49-F53 HydrophobicContact CZ-CE2 3.86Å; F49-F53 HydrophobicContact CZ-CZ 4.23Å; F49-F53 VanDerWaalsContact O-CD2 3.24Å; F49-F53 WeakPolarHBondContact O-CD2 3.24Å; F49-F53 WeakPolarHBondContact O-CE2 3.3Å
50	A	98.6	Very high	98.4	Very high	36 Å²	36	97.6 Å²	97.6	30%	0.298	51%	0.511	S	S	.	.	H	α-helix	trans	-74	-28.6	-178.4	0	0	0	0	0	113	G46 S47 F53 I54	G46-A50 WeakPolarHBondContact O-CB 3.28Å; G46-A50 PolarHBondContact O-N 2.97Å; S47-A50 PolarHBondContact O-N 3.38Å; A50-F53 PolarHBondContact O-N 3.45Å; A50-F53 VanDerWaalsContact O-N 3.14Å; A50-I54 HydrophobicContact CB-CD1 4.29Å; A50-I54 WeakPolarHBondContact O-CG1 3.39Å; A50-I54 PolarHBondContact O-N 2.96Å; A50-I54 VanDerWaalsContact O-N 3.09Å
51	F	98.6	Very high	98.4	Very high	140 Å²	140	98.8 Å²	98.8	61%	0.614	52%	0.518	S	S	*	.	H	α-helix	trans	-55.1	-48.5	-172	-177.8	-97.8	0	0	0	114.1	S47 F53 I54 V55	S47-F51 VanDerWaalsContact O-CB 3.23Å; S47-F51 WeakPolarHBondContact O-CB 3.47Å; S47-F51 PolarHBondContact O-N 3.1Å; F51-F53 VanDerWaalsContact C-N 3.32Å; F51-F53 PolarHBondContact O-N 3.22Å; F51-I54 PolarHBondContact O-N 2.95Å; F51-V55 HydrophobicContact CD1-CG2 4.12Å; F51-V55 HydrophobicContact CE1-CG2 3.74Å; F51-V55 HydrophobicContact CE2-CG2 4.16Å; F51-V55 HydrophobicContact CG-CG2 4.48Å; F51-V55 HydrophobicContact CZ-CG2 3.77Å; F51-V55 WeakPolarHBondContact O-CG2 3.43Å; F51-V55 PolarHBondContact O-N 3.46Å
52	P	98.6	Very high	98.2	Very high	71 Å²	71	101.3 Å²	101.3	46%	0.461	53%	0.528	S	S	.	.	H	α-helix	trans	-57.8	-40.9	177	-25.2	34.9	0	0	0	113.5	G48 F49 V55 V56	G48-P52 VanDerWaalsContact O-CD 3.3Å; G48-P52 WeakPolarHBondContact O-CD 3.41Å; F49-P52 WeakPolarHBondContact O-CD 3.29Å; P52-V55 PolarHBondContact O-N 3.37Å; P52-V56 WeakPolarHBondContact O-CG2 3.38Å; P52-V56 PolarHBondContact O-N 3.04Å
53	F	98.4	Very high	97	Very high	133 Å²	133	110 Å²	110	58%	0.583	56%	0.558	S	S	*	*	H	α-helix	trans	-66.5	-40	179.3	-62	-83.5	0	0	0	112.1	F49 A50 F51 V55 V56 R57	F49-F53 HydrophobicContact CD1-CE2 4.47Å; F49-F53 HydrophobicContact CE1-CE2 4.03Å; F49-F53 HydrophobicContact CE2-CE2 4.15Å; F49-F53 AromaticContact CZ-CE2 3.86Å; F49-F53 HydrophobicContact CZ-CE2 3.86Å; F49-F53 HydrophobicContact CZ-CZ 4.23Å; F49-F53 VanDerWaalsContact O-CD2 3.24Å; F49-F53 WeakPolarHBondContact O-CD2 3.24Å; F49-F53 WeakPolarHBondContact O-CE2 3.3Å; A50-F53 PolarHBondContact O-N 3.45Å; A50-F53 VanDerWaalsContact O-N 3.14Å; F51-F53 VanDerWaalsContact C-N 3.32Å; F51-F53 PolarHBondContact O-N 3.22Å; F53-V55 VanDerWaalsContact C-N 3.35Å; F53-V56 PolarHBondContact O-N 2.78Å; F53-R57 WeakPolarHBondContact O-CB 3.27Å; F53-R57 PolarHBondContact O-N 2.83Å
54	I	98.4	Very high	96.9	Very high	109 Å²	109	110.5 Å²	110.5	56%	0.559	56%	0.555	S	S	*	*	H	α-helix	trans	-64.1	-43.3	175.5	-65.2	169.9	0	0	0	110.1	A50 F51 R57 H58	A50-I54 HydrophobicContact CB-CD1 4.29Å; A50-I54 WeakPolarHBondContact O-CG1 3.39Å; A50-I54 PolarHBondContact O-N 2.96Å; A50-I54 VanDerWaalsContact O-N 3.09Å; F51-I54 PolarHBondContact O-N 2.95Å; I54-R57 PolarHBondContact O-N 2.91Å; I54-H58 VanDerWaalsContact O-CB 3.32Å; I54-H58 WeakPolarHBondContact O-CB 3.45Å; I54-H58 PolarHBondContact O-N 3.49Å
55	V	98.4	Very high	96.9	Very high	55 Å²	55	108.8 Å²	108.8	33%	0.333	55%	0.552	S	S	.	*	H	α-helix	trans	-62.8	-47.2	177.2	171.9	0	0	0	0	111	F51 P52 F53 R57 H58 Q59	F51-V55 HydrophobicContact CD1-CG2 4.12Å; F51-V55 HydrophobicContact CE1-CG2 3.74Å; F51-V55 HydrophobicContact CE2-CG2 4.16Å; F51-V55 HydrophobicContact CG-CG2 4.48Å; F51-V55 HydrophobicContact CZ-CG2 3.77Å; F51-V55 WeakPolarHBondContact O-CG2 3.43Å; F51-V55 PolarHBondContact O-N 3.46Å; P52-V55 PolarHBondContact O-N 3.37Å; F53-V55 VanDerWaalsContact C-N 3.35Å; V55-R57 PolarHBondContact O-N 3.47Å; V55-H58 WeakPolarHBondContact O-CB 3.45Å; V55-H58 PolarHBondContact O-N 2.94Å; V55-H58 VanDerWaalsContact O-N 3.16Å; V55-Q59 HydrophobicContact CG1-CG 4.47Å; V55-Q59 WeakPolarHBondContact O-CG 3.33Å; V55-Q59 PolarHBondContact O-N 2.98Å
56	V	98.6	Very high	96.8	Very high	86 Å²	86	107.6 Å²	107.6	52%	0.521	55%	0.55	S	S	.	*	H	α-helix	trans	-58.2	-49.8	176.3	169.2	0	0	0	0	110.4	P52 F53 H58 Q59 L60	P52-V56 WeakPolarHBondContact O-CG2 3.38Å; P52-V56 PolarHBondContact O-N 3.04Å; F53-V56 PolarHBondContact O-N 2.78Å; V56-H58 VanDerWaalsContact C-N 3.27Å; V56-H58 PolarHBondContact O-N 2.95Å; V56-Q59 PolarHBondContact O-N 2.92Å; V56-Q59 VanDerWaalsContact O-N 3.13Å; V56-L60 HydrophobicContact CG1-CD1 3.87Å; V56-L60 HydrophobicContact CG1-CG 4.27Å; V56-L60 WeakPolarHBondContact O-CG 3.5Å; V56-L60 PolarHBondContact O-N 3.4Å
57	R	98.1	Very high	96.6	Very high	167 Å²	167	112.1 Å²	112.1	63%	0.63	56%	0.563	S	S	*	*	H	α-helix	trans	-56.2	-44.1	175.7	-179	-176.7	179	-80.1	-2.1	111.4	F53 I54 V55 Q59 L60 L61	F53-R57 WeakPolarHBondContact O-CB 3.27Å; F53-R57 PolarHBondContact O-N 2.83Å; I54-R57 PolarHBondContact O-N 2.91Å; V55-R57 PolarHBondContact O-N 3.47Å; R57-Q59 PolarHBondContact O-N 2.93Å; R57-L60 PolarHBondContact O-N 3.29Å; R57-L61 HydrophobicContact CG-CD1 3.91Å; R57-L61 HydrophobicContact CG-CG 4.5Å; R57-L61 VanDerWaalsContact CZ-CD1 3.44Å; R57-L61 WeakPolarHBondContact O-CB 3.31Å; R57-L61 VanDerWaalsContact O-CG 3.27Å; R57-L61 WeakPolarHBondContact O-CG 3.45Å; R57-L61 PolarHBondContact O-N 3.12Å; R57-L61 VanDerWaalsContact O-N 3.12Å
58	H	98.1	Very high	96.5	Very high	104 Å²	104	114.7 Å²	114.7	48%	0.481	57%	0.568	S	S	.	*	H	α-helix	trans	-61.3	-43.2	178.2	174.5	69.7	0	0	0	111.7	I54 V55 V56 L61 K62	I54-H58 VanDerWaalsContact O-CB 3.32Å; I54-H58 WeakPolarHBondContact O-CB 3.45Å; I54-H58 PolarHBondContact O-N 3.49Å; V55-H58 WeakPolarHBondContact O-CB 3.45Å; V55-H58 PolarHBondContact O-N 2.94Å; V55-H58 VanDerWaalsContact O-N 3.16Å; V56-H58 VanDerWaalsContact C-N 3.27Å; V56-H58 PolarHBondContact O-N 2.95Å; H58-L61 PolarHBondContact O-N 3.43Å; H58-K62 VanDerWaalsContact CD2-CE 3.43Å; H58-K62 WeakPolarHBondContact CD2-CE 3.45Å; H58-K62 WeakPolarHBondContact NE2-CE 3.4Å; H58-K62 PolarHBondContact NE2-NZ 2.98Å; H58-K62 WeakPolarHBondContact O-CG 3.17Å; H58-K62 PolarHBondContact O-N 3.16Å
59	Q	98.3	Very high	96.4	Very high	104 Å²	104	119.1 Å²	119.1	49%	0.486	57%	0.573	S	S	.	*	H	α-helix	trans	-66	-42.8	176.9	-63.2	-65.1	-0.8	0	0	112.2	V55 V56 R57 L61 K62	V55-Q59 HydrophobicContact CG1-CG 4.47Å; V55-Q59 WeakPolarHBondContact O-CG 3.33Å; V55-Q59 PolarHBondContact O-N 2.98Å; V56-Q59 PolarHBondContact O-N 2.92Å; V56-Q59 VanDerWaalsContact O-N 3.13Å; R57-Q59 PolarHBondContact O-N 2.93Å; Q59-L61 PolarHBondContact O-N 3.35Å; Q59-K62 WeakPolarHBondContact O-CB 3.23Å; Q59-K62 PolarHBondContact O-N 3.26Å; Q59-K62 VanDerWaalsContact O-N 3.14Å
60	L	97.9	Very high	96.3	Very high	139 Å²	139	117.1 Å²	117.1	73%	0.728	57%	0.568	S	S	*	*	H	α-helix	trans	-63.5	-27	178.5	-68.5	174.5	0	0	0	113.3	V56 R57	V56-L60 HydrophobicContact CG1-CD1 3.87Å; V56-L60 HydrophobicContact CG1-CG 4.27Å; V56-L60 WeakPolarHBondContact O-CG 3.5Å; V56-L60 PolarHBondContact O-N 3.4Å; R57-L60 PolarHBondContact O-N 3.29Å
61	L	97.8	Very high	96.1	Very high	111 Å²	111	123.3 Å²	123.3	58%	0.581	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.8	-3.7	178.9	-67.3	175.3	0	0	0	113.5	R57 H58 Q59	R57-L61 HydrophobicContact CG-CD1 3.91Å; R57-L61 HydrophobicContact CG-CG 4.5Å; R57-L61 VanDerWaalsContact CZ-CD1 3.44Å; R57-L61 WeakPolarHBondContact O-CB 3.31Å; R57-L61 VanDerWaalsContact O-CG 3.27Å; R57-L61 WeakPolarHBondContact O-CG 3.45Å; R57-L61 PolarHBondContact O-N 3.12Å; R57-L61 VanDerWaalsContact O-N 3.12Å; H58-L61 PolarHBondContact O-N 3.43Å; Q59-L61 PolarHBondContact O-N 3.35Å
62	K	93.9	Very high	95.9	Very high	107 Å²	107	121.9 Å²	121.9	47%	0.465	59%	0.586	S	S	.	*			trans	-74.3	129.5	169.1	-69.7	176.1	-176	174.4	0	108.7	H58 Q59	H58-K62 VanDerWaalsContact CD2-CE 3.43Å; H58-K62 WeakPolarHBondContact CD2-CE 3.45Å; H58-K62 WeakPolarHBondContact NE2-CE 3.4Å; H58-K62 PolarHBondContact NE2-NZ 2.98Å; H58-K62 WeakPolarHBondContact O-CG 3.17Å; H58-K62 PolarHBondContact O-N 3.16Å; Q59-K62 WeakPolarHBondContact O-CB 3.23Å; Q59-K62 PolarHBondContact O-N 3.26Å; Q59-K62 VanDerWaalsContact O-N 3.14Å
63	K	74	Confident	95.6	Very high	277 Å²	277	126.5 Å²	126.5	100%	1.204	60%	0.598	S	S	*	*			trans	-90.8	0	165.2	-70	-170.9	178.6	-171.6	0	109.4

Retrieved 63 of 63 residues in 322.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).