A0A060W959_ONCMY Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB , UniProt , Accession A0A060W959, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110509971, Length 75 aa.

						>A0A060W959_ONCMY|A0A060W959|LOC110509971
MKGDTPVNSTMSVGQARKLVEQLKIEASFCRIKVSKAAADLMAYCDAHAIEDPLITPVPTSENPFREKKFFCALL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.3	Very low	55.3	Low	249 Å²	249	139.8 Å²	139.8	100%	1.227	80%	0.802	S	S	*	*				0	96.2	0	-70.5	161.3	135.5	0	0	107.6
2	K	40.9	Very low	58	Low	199 Å²	199	134 Å²	134	87%	0.865	78%	0.776	S	S	*	*			trans	-85.9	118.4	174	-94.9	175.7	172.8	177.4	0	106.6	D4	K2-D4 PolarHBondContact O-N 2.72Å
3	G	43.7	Very low	60.4	Low	73 Å²	73	131.4 Å²	131.4	75%	0.753	76%	0.763	S	S	*	*			trans	-76.1	112.8	170.9	0	0	0	0	0	108.5	T5	G3-T5 PolarHBondContact O-N 3.39Å
4	D	48.6	Very low	62.6	Low	154 Å²	154	124.8 Å²	124.8	82%	0.824	74%	0.737	S	S	*	*			trans	-71.6	105.3	171.5	-66.7	-49.1	0	0	0	108.8	K2	K2-D4 PolarHBondContact O-N 2.72Å
5	T	61.9	Low	64.6	Low	118 Å²	118	123.9 Å²	123.9	72%	0.724	72%	0.723	S	S	*	*			trans	-75.3	128.5	163.6	-42.3	0	0	0	0	107.5	G3 V7	G3-T5 PolarHBondContact O-N 3.39Å; T5-V7 PolarHBondContact O-N 3.41Å
6	P	50.3	Low	66.4	Low	121 Å²	121	118.4 Å²	118.4	79%	0.786	70%	0.696	S	S	*	*			trans	-69.2	99.6	173.8	28.1	-30.3	0	0	0	108	N8	P6-N8 PolarHBondContact O-N 3.23Å; P6-N8 VanDerWaalsContact O-N 3.1Å
7	V	57.6	Low	68.1	Low	122 Å²	122	121.4 Å²	121.4	74%	0.739	69%	0.692	S	S	*	*			trans	-70	103.9	169.1	174	0	0	0	0	106.3	T5 S9	T5-V7 PolarHBondContact O-N 3.41Å; V7-S9 PolarHBondContact O-N 2.98Å; V7-S9 VanDerWaalsContact O-N 3.11Å
8	N	57.5	Low	69.6	Low	158 Å²	158	123.7 Å²	123.7	85%	0.845	69%	0.693	S	S	*	*			trans	-62.5	115	175.2	-149.6	-3	0	0	0	108.3	P6	P6-N8 PolarHBondContact O-N 3.23Å; P6-N8 VanDerWaalsContact O-N 3.1Å
9	S	68.2	Low	71	Confident	95 Å²	95	121.6 Å²	121.6	66%	0.664	68%	0.68	S	S	*	*	S	Bend	trans	-70.6	142.9	-166.8	-66.2	0	0	0	0	112.8	V7	V7-S9 PolarHBondContact O-N 2.98Å; V7-S9 VanDerWaalsContact O-N 3.11Å
10	T	67.6	Low	72.3	Confident	137 Å²	137	119.1 Å²	119.1	84%	0.84	67%	0.667	S	S	*	*			trans	75	65.5	173.4	73.3	0	0	0	0	117.3	S12	T10-S12 PolarHBondContact O-N 3.34Å
11	M	70.1	Confident	73.5	Confident	112 Å²	112	118.2 Å²	118.2	55%	0.552	66%	0.658	S	S	*	*			trans	-74.2	119.9	155.8	-143	155.1	72.6	0	0	108.4	Q15 A16 L19	M11-Q15 HydrophobicContact CG-CB 3.84Å; M11-A16 HydrophobicContact CE-CB 4.15Å; M11-L19 HydrophobicContact CE-CD2 3.65Å
12	S	87.1	Confident	76.1	Confident	70 Å²	70	110.6 Å²	110.6	49%	0.49	62%	0.62	S	S	.	*			trans	-55.9	145.1	176.7	166.9	0	0	0	0	109.9	T10 G14 Q15 A16	T10-S12 PolarHBondContact O-N 3.34Å; S12-G14 PolarHBondContact O-N 3.26Å; S12-G14 PolarHBondContact OG-N 3.49Å; S12-Q15 WeakPolarHBondContact O-CA 3.32Å; S12-Q15 WeakPolarHBondContact O-CB 3.49Å; S12-Q15 PolarHBondContact O-N 3.06Å; S12-A16 PolarHBondContact O-N 3.21Å
13	V	89.1	Confident	78.8	Confident	100 Å²	100	105.5 Å²	105.5	61%	0.606	60%	0.601	S	S	*	*	H	α-helix	trans	-51.4	-34.8	174.8	176.9	0	0	0	0	111	R17	V13-R17 VanDerWaalsContact O-CG 3.29Å; V13-R17 WeakPolarHBondContact O-CG 3.34Å; V13-R17 PolarHBondContact O-N 3.46Å
14	G	90.9	Very high	81.4	Confident	39 Å²	39	107.6 Å²	107.6	40%	0.402	59%	0.589	S	S	.	*	H	α-helix	trans	-66.5	-38.4	174.9	0	0	0	0	0	113.8	S12 K18	S12-G14 PolarHBondContact O-N 3.26Å; S12-G14 PolarHBondContact OG-N 3.49Å; G14-K18 WeakPolarHBondContact O-CG 3.44Å; G14-K18 PolarHBondContact O-N 3.36Å
15	Q	92.7	Very high	83.7	Confident	112 Å²	112	104.6 Å²	104.6	52%	0.523	57%	0.572	S	S	.	*	H	α-helix	trans	-71.4	-41.4	175.7	-67.9	171	-59.4	0	0	111.4	M11 S12 R17 K18 L19	M11-Q15 HydrophobicContact CG-CB 3.84Å; S12-Q15 WeakPolarHBondContact O-CA 3.32Å; S12-Q15 WeakPolarHBondContact O-CB 3.49Å; S12-Q15 PolarHBondContact O-N 3.06Å; Q15-R17 VanDerWaalsContact C-N 3.33Å; Q15-R17 PolarHBondContact O-N 2.85Å; Q15-K18 PolarHBondContact O-N 3.41Å; Q15-L19 PolarHBondContact O-N 3.35Å
16	A	93.6	Very high	85.3	Confident	35 Å²	35	103.4 Å²	103.4	29%	0.289	56%	0.559	S	S	.	*	H	α-helix	trans	-60.3	-42.1	176	0	0	0	0	0	112	M11 S12 L19 V20	M11-A16 HydrophobicContact CE-CB 4.15Å; S12-A16 PolarHBondContact O-N 3.21Å; A16-L19 PolarHBondContact O-N 3.42Å; A16-V20 WeakPolarHBondContact O-CG2 3.46Å; A16-V20 PolarHBondContact O-N 2.99Å
17	R	95.1	Very high	87.5	Confident	170 Å²	170	100.8 Å²	100.8	64%	0.642	55%	0.548	S	S	*	.	H	α-helix	trans	-61.6	-46.6	174.8	-73.8	175.6	-171.2	-81.8	0.3	112.1	V13 Q15 L19 V20 E21	V13-R17 VanDerWaalsContact O-CG 3.29Å; V13-R17 WeakPolarHBondContact O-CG 3.34Å; V13-R17 PolarHBondContact O-N 3.46Å; Q15-R17 VanDerWaalsContact C-N 3.33Å; Q15-R17 PolarHBondContact O-N 2.85Å; R17-L19 VanDerWaalsContact C-N 3.3Å; R17-L19 PolarHBondContact O-N 3.47Å; R17-V20 PolarHBondContact O-N 3.34Å; R17-E21 WeakPolarHBondContact O-CG 3.22Å; R17-E21 PolarHBondContact O-N 3.48Å
18	K	95.7	Very high	89.3	Confident	163 Å²	163	99.1 Å²	99.1	71%	0.709	54%	0.541	S	S	*	.	H	α-helix	trans	-58.2	-43	176.6	-73.7	-179.2	179.1	-174.2	0	112	G14 Q15 E21 Q22	G14-K18 WeakPolarHBondContact O-CG 3.44Å; G14-K18 PolarHBondContact O-N 3.36Å; Q15-K18 PolarHBondContact O-N 3.41Å; K18-E21 PolarHBondContact O-N 3.38Å; K18-Q22 PolarHBondContact O-N 3Å
19	L	96	Very high	91.2	Very high	84 Å²	84	98 Å²	98	44%	0.44	53%	0.529	S	S	.	.	H	α-helix	trans	-63.4	-42.9	176.9	-178.5	63.4	0	0	0	111.8	M11 Q15 A16 R17 E21 Q22 L23	M11-L19 HydrophobicContact CE-CD2 3.65Å; Q15-L19 PolarHBondContact O-N 3.35Å; A16-L19 PolarHBondContact O-N 3.42Å; R17-L19 VanDerWaalsContact C-N 3.3Å; R17-L19 PolarHBondContact O-N 3.47Å; L19-E21 VanDerWaalsContact C-N 3.35Å; L19-E21 PolarHBondContact O-N 2.98Å; L19-Q22 PolarHBondContact O-N 3.38Å; L19-L23 HydrophobicContact CD1-CD1 4.45Å; L19-L23 HydrophobicContact CD1-CG 4.38Å; L19-L23 HydrophobicContact CG-CD1 4.1Å; L19-L23 HydrophobicContact CG-CG 4.45Å; L19-L23 VanDerWaalsContact O-CG 3.32Å; L19-L23 WeakPolarHBondContact O-CG 3.36Å; L19-L23 PolarHBondContact O-N 3.2Å
20	V	96.4	Very high	92.5	Very high	71 Å²	71	99.7 Å²	99.7	43%	0.43	54%	0.54	S	S	.	.	H	α-helix	trans	-62.2	-42.8	177.3	168.3	0	0	0	0	111.3	A16 R17 Q22 L23 K24	A16-V20 WeakPolarHBondContact O-CG2 3.46Å; A16-V20 PolarHBondContact O-N 2.99Å; R17-V20 PolarHBondContact O-N 3.34Å; V20-Q22 VanDerWaalsContact C-N 3.34Å; V20-Q22 PolarHBondContact O-N 2.91Å; V20-L23 PolarHBondContact O-N 2.98Å; V20-K24 HydrophobicContact CG1-CD 4.39Å; V20-K24 WeakPolarHBondContact O-CG 3.35Å; V20-K24 PolarHBondContact O-N 3.39Å
21	E	97.3	Very high	93.9	Very high	100 Å²	100	102.4 Å²	102.4	47%	0.467	53%	0.534	S	S	.	.	H	α-helix	trans	-63.4	-40.3	176.3	-64.4	-47.6	126.6	0	0	112	R17 K18 L19 K24 I25	R17-E21 WeakPolarHBondContact O-CG 3.22Å; R17-E21 PolarHBondContact O-N 3.48Å; K18-E21 PolarHBondContact O-N 3.38Å; L19-E21 VanDerWaalsContact C-N 3.35Å; L19-E21 PolarHBondContact O-N 2.98Å; E21-K24 PolarHBondContact O-N 3.43Å; E21-K24 IonicContact OE1-NZ 2.72Å; E21-K24 PolarHBondContact OE1-NZ 3.34Å; E21-K24 IonicContact OE2-NZ 3.5Å; E21-I25 WeakPolarHBondContact O-CG1 3.37Å; E21-I25 PolarHBondContact O-N 3.35Å
22	Q	97.5	Very high	95.2	Very high	90 Å²	90	102.1 Å²	102.1	42%	0.421	53%	0.534	S	S	.	.	H	α-helix	trans	-61.2	-47.2	173.9	-178.7	60	27.8	0	0	112	K18 L19 V20 K24 I25 E26	K18-Q22 PolarHBondContact O-N 3Å; L19-Q22 PolarHBondContact O-N 3.38Å; V20-Q22 VanDerWaalsContact C-N 3.34Å; V20-Q22 PolarHBondContact O-N 2.91Å; Q22-K24 VanDerWaalsContact C-N 3.29Å; Q22-K24 PolarHBondContact O-N 3.04Å; Q22-I25 WeakPolarHBondContact O-CB 3.29Å; Q22-I25 PolarHBondContact O-N 3.49Å; Q22-I25 VanDerWaalsContact O-N 3.12Å; Q22-E26 WeakPolarHBondContact CG-OE1 3.45Å; Q22-E26 PolarHBondContact NE2-OE1 2.9Å; Q22-E26 PolarHBondContact O-N 2.66Å
23	L	97.3	Very high	95.7	Very high	91 Å²	91	106.6 Å²	106.6	48%	0.476	55%	0.545	S	S	.	.	H	α-helix	trans	-63.5	-34.4	180	-71.8	172.8	0	0	0	112.4	L19 V20 I25 E26 A27	L19-L23 HydrophobicContact CD1-CD1 4.45Å; L19-L23 HydrophobicContact CD1-CG 4.38Å; L19-L23 HydrophobicContact CG-CD1 4.1Å; L19-L23 HydrophobicContact CG-CG 4.45Å; L19-L23 VanDerWaalsContact O-CG 3.32Å; L19-L23 WeakPolarHBondContact O-CG 3.36Å; L19-L23 PolarHBondContact O-N 3.2Å; V20-L23 PolarHBondContact O-N 2.98Å; L23-I25 VanDerWaalsContact C-N 3.33Å; L23-E26 PolarHBondContact O-N 3.07Å; L23-A27 VanDerWaalsContact O-CB 3.22Å; L23-A27 WeakPolarHBondContact O-CB 3.39Å; L23-A27 PolarHBondContact O-N 3.1Å
24	K	97.8	Very high	96.1	Very high	117 Å²	117	107.7 Å²	107.7	51%	0.509	55%	0.551	S	S	.	*	H	α-helix	trans	-61.9	-42.5	173.7	-74.8	170.7	-178.5	171.7	0	111.6	V20 E21 Q22 A27 S28	V20-K24 HydrophobicContact CG1-CD 4.39Å; V20-K24 WeakPolarHBondContact O-CG 3.35Å; V20-K24 PolarHBondContact O-N 3.39Å; E21-K24 PolarHBondContact O-N 3.43Å; E21-K24 IonicContact OE1-NZ 2.72Å; E21-K24 PolarHBondContact OE1-NZ 3.34Å; E21-K24 IonicContact OE2-NZ 3.5Å; Q22-K24 VanDerWaalsContact C-N 3.29Å; Q22-K24 PolarHBondContact O-N 3.04Å; K24-A27 PolarHBondContact O-N 3.11Å; K24-S28 PolarHBondContact O-N 2.92Å; K24-S28 VanDerWaalsContact O-N 3.14Å
25	I	97.1	Very high	96.5	Very high	91 Å²	91	110 Å²	110	47%	0.467	56%	0.561	S	S	.	*	H	α-helix	trans	-63.3	-49.7	176.8	-63.6	165	0	0	0	109.5	E21 Q22 L23 A27 S28 F29	E21-I25 WeakPolarHBondContact O-CG1 3.37Å; E21-I25 PolarHBondContact O-N 3.35Å; Q22-I25 WeakPolarHBondContact O-CB 3.29Å; Q22-I25 PolarHBondContact O-N 3.49Å; Q22-I25 VanDerWaalsContact O-N 3.12Å; L23-I25 VanDerWaalsContact C-N 3.33Å; I25-A27 VanDerWaalsContact C-N 3.31Å; I25-A27 PolarHBondContact O-N 3.33Å; I25-S28 PolarHBondContact O-N 3.1Å; I25-S28 PolarHBondContact O-OG 3.17Å; I25-F29 HydrophobicContact CG2-CE2 4.17Å; I25-F29 WeakPolarHBondContact O-CD2 3.43Å
26	E	96.3	Very high	96.7	Very high	93 Å²	93	109.7 Å²	109.7	44%	0.435	56%	0.558	S	S	.	*	H	α-helix	trans	-62.4	-35.9	179.4	-71.4	176.6	-162.5	0	0	113.2	Q22 L23 S28 F29	Q22-E26 WeakPolarHBondContact CG-OE1 3.45Å; Q22-E26 PolarHBondContact NE2-OE1 2.9Å; Q22-E26 PolarHBondContact O-N 2.66Å; L23-E26 PolarHBondContact O-N 3.07Å; E26-S28 VanDerWaalsContact C-N 3.28Å; E26-S28 PolarHBondContact O-N 3.14Å; E26-F29 PolarHBondContact O-N 3.26Å
27	A	96.8	Very high	97	Very high	67 Å²	67	109.6 Å²	109.6	55%	0.554	56%	0.557	S	S	*	*	H	α-helix	trans	-67.3	-30.8	175.5	0	0	0	0	0	112.4	L23 K24 I25 F29	L23-A27 VanDerWaalsContact O-CB 3.22Å; L23-A27 WeakPolarHBondContact O-CB 3.39Å; L23-A27 PolarHBondContact O-N 3.1Å; K24-A27 PolarHBondContact O-N 3.11Å; I25-A27 VanDerWaalsContact C-N 3.31Å; I25-A27 PolarHBondContact O-N 3.33Å; A27-F29 VanDerWaalsContact C-N 3.26Å; A27-F29 PolarHBondContact O-N 3.49Å
28	S	96.3	Very high	97.1	Very high	87 Å²	87	104.1 Å²	104.1	61%	0.608	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76	-8	-179.7	75.6	0	0	0	0	114.4	K24 I25 E26 C30	K24-S28 PolarHBondContact O-N 2.92Å; K24-S28 VanDerWaalsContact O-N 3.14Å; I25-S28 PolarHBondContact O-N 3.1Å; I25-S28 PolarHBondContact O-OG 3.17Å; E26-S28 VanDerWaalsContact C-N 3.28Å; E26-S28 PolarHBondContact O-N 3.14Å; S28-C30 PolarHBondContact O-N 2.89Å
29	F	95.4	Very high	97.3	Very high	135 Å²	135	98.7 Å²	98.7	59%	0.592	53%	0.534	S	S	*	.	S	Bend	trans	-67.6	125.7	177	-87.2	-90.6	0	0	0	112.2	I25 E26 A27 R31	I25-F29 HydrophobicContact CG2-CE2 4.17Å; I25-F29 WeakPolarHBondContact O-CD2 3.43Å; E26-F29 PolarHBondContact O-N 3.26Å; A27-F29 VanDerWaalsContact C-N 3.26Å; A27-F29 PolarHBondContact O-N 3.49Å; F29-R31 PolarHBondContact O-N 3.35Å
30	C	96.1	Very high	97.4	Very high	130 Å²	130	98.4 Å²	98.4	88%	0.878	53%	0.533	S	S	*	.			trans	-67.9	112.7	170.1	-67.6	0	0	0	0	110	S28	S28-C30 PolarHBondContact O-N 2.89Å
31	R	96.5	Very high	97.4	Very high	194 Å²	194	100.8 Å²	100.8	73%	0.732	54%	0.543	S	S	*	.	P	Polyproline II helix	trans	-86.4	148.4	174.5	-63	178.5	-174.6	75.5	3.1	110.4	F29	F29-R31 PolarHBondContact O-N 3.35Å
32	I	97.6	Very high	97.5	Very high	106 Å²	106	101.9 Å²	101.9	54%	0.544	55%	0.549	S	S	.	.	P	Polyproline II helix	trans	-94.3	160.4	168	62	172.1	0	0	0	110.4	V34 A37	I32-V34 PolarHBondContact O-N 3.38Å; I32-A37 HydrophobicContact CD1-CB 3.76Å; I32-A37 HydrophobicContact CG1-CB 4.27Å
33	K	98.3	Very high	97.5	Very high	164 Å²	164	100.4 Å²	100.4	71%	0.713	55%	0.552	S	S	*	*	P	Polyproline II helix	trans	-62.9	137.1	173.5	-68.8	-177.3	179.8	176.9	0	109.8	S35 K36 A37	K33-S35 PolarHBondContact O-N 3.27Å; K33-K36 HydrophobicContact CB-CB 4.37Å; K33-K36 WeakPolarHBondContact O-CB 3.32Å; K33-K36 PolarHBondContact O-N 3.49Å; K33-A37 PolarHBondContact O-N 2.98Å
34	V	98.3	Very high	97.5	Very high	123 Å²	123	103.1 Å²	103.1	75%	0.745	56%	0.557	S	S	*	*	H	α-helix	trans	-56.4	-39.8	176.5	175.5	0	0	0	0	111.3	I32 K36 A37 A38	I32-V34 PolarHBondContact O-N 3.38Å; V34-K36 VanDerWaalsContact C-N 3.28Å; V34-K36 PolarHBondContact O-N 3.12Å; V34-A37 PolarHBondContact O-N 2.91Å; V34-A38 WeakPolarHBondContact O-CB 3.43Å; V34-A38 PolarHBondContact O-N 3.12Å
35	S	98.2	Very high	97.5	Very high	87 Å²	87	101.3 Å²	101.3	61%	0.608	56%	0.558	S	S	*	*	H	α-helix	trans	-61	-35.7	176.6	61.2	0	0	0	0	113.1	K33 A39	K33-S35 PolarHBondContact O-N 3.27Å; S35-A39 WeakPolarHBondContact O-CB 3.44Å; S35-A39 PolarHBondContact O-N 2.98Å; S35-A39 VanDerWaalsContact O-N 3.1Å
36	K	98.2	Very high	97.4	Very high	106 Å²	106	102.1 Å²	102.1	46%	0.461	56%	0.564	S	S	.	*	H	α-helix	trans	-70.3	-48.4	175.4	175.7	169.6	170.2	43.1	0	110.7	K33 V34 A38 A39 D40	K33-K36 HydrophobicContact CB-CB 4.37Å; K33-K36 WeakPolarHBondContact O-CB 3.32Å; K33-K36 PolarHBondContact O-N 3.49Å; V34-K36 VanDerWaalsContact C-N 3.28Å; V34-K36 PolarHBondContact O-N 3.12Å; K36-A38 VanDerWaalsContact C-N 3.27Å; K36-A38 PolarHBondContact O-N 3.27Å; K36-A39 PolarHBondContact O-N 3.26Å; K36-A39 VanDerWaalsContact O-N 3.17Å; K36-D40 WeakPolarHBondContact CG-OD2 3.45Å; K36-D40 IonicContact NZ-OD1 3.12Å; K36-D40 PolarHBondContact NZ-OD1 3.27Å; K36-D40 VanDerWaalsContact NZ-OD1 3.12Å; K36-D40 IonicContact NZ-OD2 2.86Å; K36-D40 PolarHBondContact NZ-OD2 2.86Å; K36-D40 VanDerWaalsContact O-CG 3.22Å; K36-D40 PolarHBondContact O-N 3.05Å
37	A	98.4	Very high	97.4	Very high	33 Å²	33	100.9 Å²	100.9	27%	0.273	57%	0.569	S	S	.	*	H	α-helix	trans	-57.1	-43.1	177.6	0	0	0	0	0	111.7	I32 K33 V34 D40 L41	I32-A37 HydrophobicContact CD1-CB 3.76Å; I32-A37 HydrophobicContact CG1-CB 4.27Å; K33-A37 PolarHBondContact O-N 2.98Å; V34-A37 PolarHBondContact O-N 2.91Å; A37-D40 PolarHBondContact O-N 2.86Å; A37-L41 VanDerWaalsContact O-CG 3.32Å; A37-L41 WeakPolarHBondContact O-CG 3.45Å; A37-L41 PolarHBondContact O-N 2.8Å
38	A	98.4	Very high	97.4	Very high	54 Å²	54	101.2 Å²	101.2	45%	0.446	56%	0.559	S	S	.	*	H	α-helix	trans	-63.7	-42.2	177	0	0	0	0	0	112.5	V34 K36 L41 M42	V34-A38 WeakPolarHBondContact O-CB 3.43Å; V34-A38 PolarHBondContact O-N 3.12Å; K36-A38 VanDerWaalsContact C-N 3.27Å; K36-A38 PolarHBondContact O-N 3.27Å; A38-L41 PolarHBondContact O-N 3.03Å; A38-M42 WeakPolarHBondContact O-CB 3.48Å; A38-M42 PolarHBondContact O-N 3.47Å
39	A	98.4	Very high	97.3	Very high	50 Å²	50	98.6 Å²	98.6	41%	0.413	54%	0.542	S	S	.	.	H	α-helix	trans	-64.3	-42.4	176	0	0	0	0	0	112	S35 K36 L41 M42 A43	S35-A39 WeakPolarHBondContact O-CB 3.44Å; S35-A39 PolarHBondContact O-N 2.98Å; S35-A39 VanDerWaalsContact O-N 3.1Å; K36-A39 PolarHBondContact O-N 3.26Å; K36-A39 VanDerWaalsContact O-N 3.17Å; A39-L41 VanDerWaalsContact C-N 3.34Å; A39-L41 PolarHBondContact O-N 3.23Å; A39-M42 PolarHBondContact O-N 2.91Å; A39-A43 WeakPolarHBondContact O-CB 3.44Å; A39-A43 PolarHBondContact O-N 2.84Å
40	D	98.1	Very high	97.1	Very high	78 Å²	78	98.7 Å²	98.7	42%	0.417	55%	0.548	S	S	.	.	H	α-helix	trans	-64.1	-39.7	178.3	-64.2	-19.1	0	0	0	110.6	K36 A37 Y44	K36-D40 WeakPolarHBondContact CG-OD2 3.45Å; K36-D40 IonicContact NZ-OD1 3.12Å; K36-D40 PolarHBondContact NZ-OD1 3.27Å; K36-D40 VanDerWaalsContact NZ-OD1 3.12Å; K36-D40 IonicContact NZ-OD2 2.86Å; K36-D40 PolarHBondContact NZ-OD2 2.86Å; K36-D40 VanDerWaalsContact O-CG 3.22Å; K36-D40 PolarHBondContact O-N 3.05Å; A37-D40 PolarHBondContact O-N 2.86Å; D40-Y44 PolarHBondContact O-N 3.11Å; D40-Y44 VanDerWaalsContact O-N 3.11Å
41	L	98.3	Very high	96.9	Very high	121 Å²	121	99.4 Å²	99.4	63%	0.634	54%	0.538	S	S	*	.	H	α-helix	trans	-64.7	-45.5	173.9	-72.5	173.3	0	0	0	112.4	A37 A38 A39 Y44 C45	A37-L41 VanDerWaalsContact O-CG 3.32Å; A37-L41 WeakPolarHBondContact O-CG 3.45Å; A37-L41 PolarHBondContact O-N 2.8Å; A38-L41 PolarHBondContact O-N 3.03Å; A39-L41 VanDerWaalsContact C-N 3.34Å; A39-L41 PolarHBondContact O-N 3.23Å; L41-Y44 PolarHBondContact O-N 3.2Å; L41-C45 PolarHBondContact O-N 3.33Å; L41-C45 PolarHBondContact O-SG 2.95Å
42	M	97.7	Very high	96.9	Very high	122 Å²	122	93.1 Å²	93.1	60%	0.601	52%	0.519	S	S	*	.	H	α-helix	trans	-62.8	-45.2	179.3	-169.9	168.5	73.8	0	0	111.1	A38 A39 Y44 C45 D46	A38-M42 WeakPolarHBondContact O-CB 3.48Å; A38-M42 PolarHBondContact O-N 3.47Å; A39-M42 PolarHBondContact O-N 2.91Å; M42-Y44 VanDerWaalsContact C-N 3.28Å; M42-Y44 PolarHBondContact O-N 3.01Å; M42-C45 PolarHBondContact O-N 3.25Å; M42-D46 WeakPolarHBondContact O-CB 3.46Å; M42-D46 VanDerWaalsContact O-CG 3.25Å; M42-D46 PolarHBondContact O-N 3.41Å
43	A	98.1	Very high	96.6	Very high	59 Å²	59	91.8 Å²	91.8	49%	0.488	52%	0.517	S	S	.	.	H	α-helix	trans	-59.5	-38.6	176.2	0	0	0	0	0	112.4	A39 A47	A39-A43 WeakPolarHBondContact O-CB 3.44Å; A39-A43 PolarHBondContact O-N 2.84Å; A43-A47 VanDerWaalsContact O-CB 3.31Å; A43-A47 WeakPolarHBondContact O-CB 3.31Å; A43-A47 PolarHBondContact O-N 3.07Å; A43-A47 VanDerWaalsContact O-N 3.07Å
44	Y	98.1	Very high	96.3	Very high	149 Å²	149	91.5 Å²	91.5	58%	0.584	52%	0.523	S	S	*	.	H	α-helix	trans	-65.2	-47.3	175.6	-179	-96	0	0	0	111.9	D40 L41 M42 A47 H48	D40-Y44 PolarHBondContact O-N 3.11Å; D40-Y44 VanDerWaalsContact O-N 3.11Å; L41-Y44 PolarHBondContact O-N 3.2Å; M42-Y44 VanDerWaalsContact C-N 3.28Å; M42-Y44 PolarHBondContact O-N 3.01Å; Y44-A47 PolarHBondContact O-N 2.85Å; Y44-H48 AromaticContact CD2-CE1 3.6Å; Y44-H48 AromaticContact CD2-ND1 3.73Å; Y44-H48 AromaticContact CE2-CE1 3.32Å; Y44-H48 WeakPolarHBondContact CE2-CE1 3.3Å; Y44-H48 AromaticContact CE2-ND1 3.6Å; Y44-H48 AromaticContact CE2-NE2 3.96Å; Y44-H48 AromaticContact CZ-CE1 3.96Å; Y44-H48 AromaticContact CZ-ND1 3.89Å; Y44-H48 PolarHBondContact O-N 3.43Å; Y44-H48 PolarHBondContact O-ND1 2.79Å
45	C	97.3	Very high	96.1	Very high	78 Å²	78	91.1 Å²	91.1	53%	0.527	52%	0.516	S	S	.	.	H	α-helix	trans	-59.7	-48.5	176.5	-72.3	0	0	0	0	111.6	L41 M42 A47 H48 A49	L41-C45 PolarHBondContact O-N 3.33Å; L41-C45 PolarHBondContact O-SG 2.95Å; M42-C45 PolarHBondContact O-N 3.25Å; C45-A47 VanDerWaalsContact C-N 3.3Å; C45-A47 PolarHBondContact O-N 2.84Å; C45-H48 PolarHBondContact O-N 3.19Å; C45-A49 VanDerWaalsContact O-CB 3.3Å; C45-A49 WeakPolarHBondContact O-CB 3.32Å; C45-A49 PolarHBondContact O-N 3.37Å
46	D	95.6	Very high	95.8	Very high	109 Å²	109	89.7 Å²	89.7	58%	0.583	50%	0.503	S	S	*	.	H	α-helix	trans	-61.9	-39.1	-178.8	-67.9	-20.2	0	0	0	111.9	M42 H48	M42-D46 WeakPolarHBondContact O-CB 3.46Å; M42-D46 VanDerWaalsContact O-CG 3.25Å; M42-D46 PolarHBondContact O-N 3.41Å; D46-H48 VanDerWaalsContact C-N 3.31Å; D46-H48 PolarHBondContact O-N 3.27Å
47	A	96.6	Very high	95.3	Very high	67 Å²	67	90 Å²	90	55%	0.554	52%	0.516	S	S	*	.	H	α-helix	trans	-66.4	-30.9	178.7	0	0	0	0	0	113.3	A43 Y44 C45	A43-A47 VanDerWaalsContact O-CB 3.31Å; A43-A47 WeakPolarHBondContact O-CB 3.31Å; A43-A47 PolarHBondContact O-N 3.07Å; A43-A47 VanDerWaalsContact O-N 3.07Å; Y44-A47 PolarHBondContact O-N 2.85Å; C45-A47 VanDerWaalsContact C-N 3.3Å; C45-A47 PolarHBondContact O-N 2.84Å
48	H	96.3	Very high	94.9	Very high	74 Å²	74	91.2 Å²	91.2	34%	0.343	52%	0.52	S	S	.	.	H	α-helix	trans	-110.1	-2.8	-174.4	-59.4	83.5	0	0	0	113.8	Y44 C45 D46 I50 E51 D52	Y44-H48 AromaticContact CD2-CE1 3.6Å; Y44-H48 AromaticContact CD2-ND1 3.73Å; Y44-H48 AromaticContact CE2-CE1 3.32Å; Y44-H48 WeakPolarHBondContact CE2-CE1 3.3Å; Y44-H48 AromaticContact CE2-ND1 3.6Å; Y44-H48 AromaticContact CE2-NE2 3.96Å; Y44-H48 AromaticContact CZ-CE1 3.96Å; Y44-H48 AromaticContact CZ-ND1 3.89Å; Y44-H48 PolarHBondContact O-N 3.43Å; Y44-H48 PolarHBondContact O-ND1 2.79Å; C45-H48 PolarHBondContact O-N 3.19Å; D46-H48 VanDerWaalsContact C-N 3.31Å; D46-H48 PolarHBondContact O-N 3.27Å; H48-I50 PolarHBondContact O-N 3.02Å; H48-E51 IonicContact CD2-OE2 3.85Å; H48-E51 PolarHBondContact O-N 3.43Å; H48-D52 PolarHBondContact O-N 3.18Å
49	A	93.9	Very high	94.5	Very high	31 Å²	31	92 Å²	92	26%	0.256	52%	0.52	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60	-30.5	-177.4	0	0	0	0	0	113.4	C45 E51 I55 T56	C45-A49 VanDerWaalsContact O-CB 3.3Å; C45-A49 WeakPolarHBondContact O-CB 3.32Å; C45-A49 PolarHBondContact O-N 3.37Å; A49-E51 VanDerWaalsContact C-N 3.33Å; A49-I55 HydrophobicContact CB-CG2 4.47Å; A49-T56 PolarHBondContact O-OG1 3.24Å
50	I	91.4	Very high	93.8	Very high	137 Å²	137	93.7 Å²	93.7	70%	0.703	53%	0.526	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.1	-29.9	178.5	-59.2	174.2	0	0	0	111.2	H48	H48-I50 PolarHBondContact O-N 3.02Å
51	E	92.6	Very high	93.3	Very high	145 Å²	145	94.4 Å²	94.4	68%	0.678	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.9	-16.3	-178.2	-61.1	-178.4	178.5	0	0	112.6	H48 A49 P53	H48-E51 IonicContact CD2-OE2 3.85Å; H48-E51 PolarHBondContact O-N 3.43Å; A49-E51 VanDerWaalsContact C-N 3.33Å; E51-P53 WeakPolarHBondContact O-CD 3.48Å
52	D	95.1	Very high	92.8	Very high	63 Å²	63	95 Å²	95	34%	0.337	54%	0.536	S	S	.	.			trans	-80.2	109.5	176.9	-172.4	-27.9	0	0	0	110.6	H48 L54 I55 T56	H48-D52 PolarHBondContact O-N 3.18Å; D52-L54 PolarHBondContact O-N 3.15Å; D52-L54 VanDerWaalsContact O-N 3.13Å; D52-L54 WeakPolarHBondContact OD1-CA 3.48Å; D52-L54 VanDerWaalsContact OD1-CB 3.29Å; D52-L54 WeakPolarHBondContact OD1-CB 3.49Å; D52-L54 PolarHBondContact OD1-N 3.44Å; D52-I55 HydrophobicContact CB-CB 4.1Å; D52-I55 HydrophobicContact CB-CG1 4.01Å; D52-I55 PolarHBondContact O-N 3.22Å; D52-I55 VanDerWaalsContact O-N 3.15Å; D52-I55 PolarHBondContact OD1-N 2.84Å; D52-I55 WeakPolarHBondContact OD2-CG1 3.29Å; D52-T56 PolarHBondContact O-N 3.13Å
53	P	92.5	Very high	92.4	Very high	77 Å²	77	92 Å²	92	50%	0.5	52%	0.523	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.8	-14.9	-177.6	-21	36.3	0	0	0	114.2	E51 T56 V58	E51-P53 WeakPolarHBondContact O-CD 3.48Å; P53-T56 CarbonylContact C-O 3.52Å; P53-T56 WeakPolarHBondContact CA-O 3.38Å; P53-V58 HydrophobicContact CB-CG1 3.89Å; P53-V58 HydrophobicContact CB-CG2 4.32Å; P53-V58 HydrophobicContact CG-CG1 4.35Å
54	L	92	Very high	92	Very high	158 Å²	158	94.9 Å²	94.9	83%	0.827	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.6	-27	178.4	-57.2	179.6	0	0	0	112	D52	D52-L54 PolarHBondContact O-N 3.15Å; D52-L54 VanDerWaalsContact O-N 3.13Å; D52-L54 WeakPolarHBondContact OD1-CA 3.48Å; D52-L54 VanDerWaalsContact OD1-CB 3.29Å; D52-L54 WeakPolarHBondContact OD1-CB 3.49Å; D52-L54 PolarHBondContact OD1-N 3.44Å
55	I	93.1	Very high	91.5	Very high	116 Å²	116	96.9 Å²	96.9	60%	0.595	55%	0.549	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.7	-46.2	175.7	-57.6	-61.7	0	0	0	110.3	A49 D52 P57	A49-I55 HydrophobicContact CB-CG2 4.47Å; D52-I55 HydrophobicContact CB-CB 4.1Å; D52-I55 HydrophobicContact CB-CG1 4.01Å; D52-I55 PolarHBondContact O-N 3.22Å; D52-I55 VanDerWaalsContact O-N 3.15Å; D52-I55 PolarHBondContact OD1-N 2.84Å; D52-I55 WeakPolarHBondContact OD2-CG1 3.29Å; I55-P57 WeakPolarHBondContact O-CD 3.17Å
56	T	91.4	Very high	91	Very high	57 Å²	57	98.6 Å²	98.6	35%	0.35	54%	0.544	S	S	.	.	T	Hydrogen-bonded Turn	trans	-108.6	102.6	176.2	-56.7	0	0	0	0	108.9	A49 D52 P53 V58	A49-T56 PolarHBondContact O-OG1 3.24Å; D52-T56 PolarHBondContact O-N 3.13Å; P53-T56 CarbonylContact C-O 3.52Å; P53-T56 WeakPolarHBondContact CA-O 3.38Å; T56-V58 PolarHBondContact O-N 2.86Å
57	P	88.4	Confident	90.3	Very high	113 Å²	113	101.5 Å²	101.5	73%	0.734	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.2	125.7	-175.7	-23.9	33.8	0	0	0	111.9	I55	I55-P57 WeakPolarHBondContact O-CD 3.17Å
58	V	89.9	Confident	89.3	Confident	58 Å²	58	106.8 Å²	106.8	35%	0.352	57%	0.565	S	S	.	*	P	Polyproline II helix	trans	-78.7	153.7	174.1	-64.2	0	0	0	0	111.3	P53 T56 E62 N63	P53-V58 HydrophobicContact CB-CG1 3.89Å; P53-V58 HydrophobicContact CB-CG2 4.32Å; P53-V58 HydrophobicContact CG-CG1 4.35Å; T56-V58 PolarHBondContact O-N 2.86Å; V58-E62 HydrophobicContact CB-CB 4.42Å; V58-N63 HydrophobicContact CG2-CB 4.22Å
59	P	89.9	Confident	88	Confident	70 Å²	70	110.5 Å²	110.5	46%	0.455	58%	0.58	S	S	.	*	P	Polyproline II helix	trans	-54	147.6	172.8	-24.3	33.9	0	0	0	111.6	S61 E62 N63	P59-S61 PolarHBondContact O-N 3.09Å; P59-S61 VanDerWaalsContact O-N 3.09Å; P59-E62 PolarHBondContact O-N 2.96Å; P59-N63 PolarHBondContact O-N 3.2Å
60	T	84.8	Confident	86.7	Confident	86 Å²	86	117.9 Å²	117.9	53%	0.528	61%	0.606	S	S	.	*	T	Hydrogen-bonded Turn	trans	-57.9	-34.2	-176.1	-34	0	0	0	0	112.1	E62 N63 R66	T60-E62 VanDerWaalsContact C-N 3.27Å; T60-E62 PolarHBondContact O-N 2.87Å; T60-N63 PolarHBondContact O-N 3.26Å; T60-R66 HydrophobicContact CG2-CB 3.98Å; T60-R66 VanDerWaalsContact CG2-CD 3.46Å; T60-R66 HydrophobicContact CG2-CG 3.45Å; T60-R66 VanDerWaalsContact CG2-CG 3.45Å; T60-R66 WeakPolarHBondContact O-CB 3.15Å; T60-R66 WeakPolarHBondContact O-CD 3.26Å
61	S	86.4	Confident	84.9	Confident	93 Å²	93	120.5 Å²	120.5	65%	0.65	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.8	-30.6	177.3	47	0	0	0	0	114.3	P59	P59-S61 PolarHBondContact O-N 3.09Å; P59-S61 VanDerWaalsContact O-N 3.09Å
62	E	87.3	Confident	83	Confident	132 Å²	132	118.5 Å²	118.5	62%	0.617	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.5	-21.3	179.5	-66.8	176.3	-160.6	0	0	111.7	V58 P59 T60 P64	V58-E62 HydrophobicContact CB-CB 4.42Å; P59-E62 PolarHBondContact O-N 2.96Å; T60-E62 VanDerWaalsContact C-N 3.27Å; T60-E62 PolarHBondContact O-N 2.87Å; E62-P64 WeakPolarHBondContact O-CD 3.21Å
63	N	90.6	Very high	81.4	Confident	60 Å²	60	119.4 Å²	119.4	32%	0.321	63%	0.63	S	S	.	*			trans	-69.2	112.8	176.3	-175.3	-8.5	0	0	0	111.2	V58 P59 T60 F65 R66	V58-N63 HydrophobicContact CG2-CB 4.22Å; P59-N63 PolarHBondContact O-N 3.2Å; T60-N63 PolarHBondContact O-N 3.26Å; N63-F65 PolarHBondContact O-N 3.06Å; N63-F65 VanDerWaalsContact O-N 3.16Å; N63-F65 WeakPolarHBondContact OD1-CA 3.39Å; N63-F65 WeakPolarHBondContact OD1-CB 3.47Å; N63-F65 PolarHBondContact OD1-N 3.36Å; N63-R66 VanDerWaalsContact O-CB 3.26Å; N63-R66 WeakPolarHBondContact O-CB 3.4Å; N63-R66 PolarHBondContact O-N 3.16Å
64	P	89	Confident	79.8	Confident	120 Å²	120	123.6 Å²	123.6	78%	0.779	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.5	-21.3	179	-19.8	34.2	0	0	0	113.4	E62 R66	E62-P64 WeakPolarHBondContact O-CD 3.21Å; P64-R66 VanDerWaalsContact C-N 3.32Å
65	F	88.6	Confident	77.8	Confident	190 Å²	190	127.3 Å²	127.3	83%	0.833	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.7	10.4	178	-57	-79	0	0	0	113.1	N63	N63-F65 PolarHBondContact O-N 3.06Å; N63-F65 VanDerWaalsContact O-N 3.16Å; N63-F65 WeakPolarHBondContact OD1-CA 3.39Å; N63-F65 WeakPolarHBondContact OD1-CB 3.47Å; N63-F65 PolarHBondContact OD1-N 3.36Å
66	R	85	Confident	77.1	Confident	114 Å²	114	127.9 Å²	127.9	43%	0.43	67%	0.67	S	S	.	*			trans	-61.3	140.3	173.8	175.8	-176.1	-170.8	-153.3	9.9	111.3	T60 N63 P64 K68	T60-R66 HydrophobicContact CG2-CB 3.98Å; T60-R66 VanDerWaalsContact CG2-CD 3.46Å; T60-R66 HydrophobicContact CG2-CG 3.45Å; T60-R66 VanDerWaalsContact CG2-CG 3.45Å; T60-R66 WeakPolarHBondContact O-CB 3.15Å; T60-R66 WeakPolarHBondContact O-CD 3.26Å; N63-R66 VanDerWaalsContact O-CB 3.26Å; N63-R66 WeakPolarHBondContact O-CB 3.4Å; N63-R66 PolarHBondContact O-N 3.16Å; P64-R66 VanDerWaalsContact C-N 3.32Å; R66-K68 PolarHBondContact O-N 3.06Å
67	E	81.7	Confident	76.3	Confident	170 Å²	170	131.6 Å²	131.6	79%	0.794	69%	0.687	S	S	*	*			trans	-57.5	122.8	167.6	-65.7	-176.7	-179.3	0	0	111.6	K69	E67-K69 PolarHBondContact O-N 3.25Å
68	K	76.8	Confident	75.6	Confident	179 Å²	179	132.6 Å²	132.6	78%	0.778	69%	0.685	S	S	*	*			trans	-65.4	111.1	171.2	-69.4	-179.7	-177.8	176.2	0	108	R66 F70	R66-K68 PolarHBondContact O-N 3.06Å; K68-F70 PolarHBondContact O-N 3.16Å
69	K	68.7	Low	74.8	Confident	151 Å²	151	137 Å²	137	66%	0.657	70%	0.704	S	S	*	*			trans	-64.1	100.3	166.5	-69.7	-167.3	176.7	-171.9	0	107.5	E67 F71	E67-K69 PolarHBondContact O-N 3.25Å; K69-F71 PolarHBondContact O-N 2.91Å; K69-F71 VanDerWaalsContact O-N 3.16Å
70	F	65.1	Low	73.8	Confident	186 Å²	186	141.2 Å²	141.2	82%	0.816	72%	0.72	S	S	*	*			trans	-65.5	111.4	163.9	-70.6	-81.7	0	0	0	106.7	K68 C72	K68-F70 PolarHBondContact O-N 3.16Å; F70-C72 PolarHBondContact O-N 2.93Å
71	F	54.5	Low	73.1	Confident	192 Å²	192	144.9 Å²	144.9	84%	0.842	73%	0.733	S	S	*	*			trans	-70.2	90.9	166.5	-63.9	-83	0	0	0	106.9	K69 A73	K69-F71 PolarHBondContact O-N 2.91Å; K69-F71 VanDerWaalsContact O-N 3.16Å; F71-A73 VanDerWaalsContact C-N 3.31Å; F71-A73 PolarHBondContact O-N 3.39Å; F71-A73 VanDerWaalsContact O-N 3.07Å
72	C	53	Low	72.2	Confident	104 Å²	104	148.6 Å²	148.6	70%	0.703	74%	0.739	S	S	*	*			trans	-71.4	95.6	162.3	-171.9	0	0	0	0	106.6	F70 L74	F70-C72 PolarHBondContact O-N 2.93Å; C72-L74 PolarHBondContact O-N 3.07Å
73	A	61.4	Low	71	Confident	81 Å²	81	149.8 Å²	149.8	67%	0.669	75%	0.748	S	S	*	*			trans	-76.1	106.2	157.2	0	0	0	0	0	106.3	F71 L75	F71-A73 VanDerWaalsContact C-N 3.31Å; F71-A73 PolarHBondContact O-N 3.39Å; F71-A73 VanDerWaalsContact O-N 3.07Å; A73-L75 PolarHBondContact O-N 3.14Å; A73-L75 VanDerWaalsContact O-N 3.14Å
74	L	58	Low	69.4	Low	166 Å²	166	157.3 Å²	157.3	87%	0.869	78%	0.783	S	S	*	*			trans	-69.6	101.7	159.8	-69.4	170.4	0	0	0	106	C72	C72-L74 PolarHBondContact O-N 3.07Å
75	L	50.8	Low	67.6	Low	235 Å²	235	160.7 Å²	160.7	100%	1.23	78%	0.784	S	S	*	*			trans	-83.5	0	164.4	-90.9	156.6	0	0	0	109.2	A73	A73-L75 PolarHBondContact O-N 3.14Å; A73-L75 VanDerWaalsContact O-N 3.14Å

Retrieved 75 of 75 residues in 439.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).