A0A060WEX8_ONCMY Loading...

Cytochrome c oxidase assembly factor 3

Core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for efficient translation of MT-CO1 and mitochondrial respiratory chain complex IV assembly. Required for assembly of cytochrome c oxidase (complex IV).

AlphaFold DB , UniProt , Accession A0A060WEX8, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 100 aa.

						>A0A060WEX8_ONCMY|A0A060WEX8
MADQKPTVDPEVPFAKRIDPNKEDLTRDEFYFIRQVELAQWKKKSQQLRGRNIATGLAIGAIVMGIYGYTFYSVKQEKIMDELDEEAKVARMGGAKTGAN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.3	Very low	50.7	Low	245 Å²	245	147.4 Å²	147.4	100%	1.207	80%	0.802	S	S	*	*				0	110.7	0	-75.9	128.2	166.3	0	0	107.1
2	A	49.8	Very low	51.4	Low	78 Å²	78	141.5 Å²	141.5	65%	0.645	77%	0.774	S	S	*	*			trans	-80.2	171.7	173.2	0	0	0	0	0	110
3	D	46.9	Very low	52.1	Low	153 Å²	153	138.8 Å²	138.8	82%	0.818	77%	0.767	S	S	*	*			trans	83.3	127.9	159.7	-44.3	-45.9	0	0	0	115.3
4	Q	48.8	Very low	52.5	Low	177 Å²	177	141.1 Å²	141.1	83%	0.827	77%	0.766	S	S	*	*			cis	-160.4	119.3	16.2	-157.1	162.3	16.3	0	0	107.4
5	K	50.1	Low	53.2	Low	193 Å²	193	137.7 Å²	137.7	84%	0.839	77%	0.765	S	S	*	*			trans	-71.9	133.7	164.4	-99.4	177.9	177.7	173.5	0	106.9	T7	K5-T7 PolarHBondContact O-N 3.14Å
6	P	50.3	Low	54	Low	115 Å²	115	137.6 Å²	137.6	75%	0.747	75%	0.754	S	S	*	*			trans	-60.9	115.9	176.6	25.1	-30.7	0	0	0	107.9	V8	P6-V8 PolarHBondContact O-N 3.01Å
7	T	48.5	Very low	54.3	Low	121 Å²	121	143.9 Å²	143.9	74%	0.742	76%	0.764	S	S	*	*			trans	-65.3	101.2	170.3	43.3	0	0	0	0	106.8	K5 D9	K5-T7 PolarHBondContact O-N 3.14Å; T7-D9 PolarHBondContact O-N 2.73Å
8	V	55	Low	54.8	Low	120 Å²	120	139.8 Å²	139.8	73%	0.727	74%	0.742	S	S	*	*			trans	-73.6	104.7	168.5	179.8	0	0	0	0	105.5	P6 P10	P6-V8 PolarHBondContact O-N 3.01Å; V8-P10 WeakPolarHBondContact O-CD 3.46Å
9	D	56.7	Low	55.2	Low	115 Å²	115	135.7 Å²	135.7	62%	0.615	72%	0.72	S	S	*	*			trans	-53.3	122.1	173	-65.4	-47.3	0	0	0	109	T7 E11	T7-D9 PolarHBondContact O-N 2.73Å; D9-E11 PolarHBondContact O-N 3.03Å; D9-E11 VanDerWaalsContact O-N 3.14Å
10	P	55.3	Low	55.6	Low	126 Å²	126	132.8 Å²	132.8	82%	0.818	71%	0.709	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.6	2.8	-172.8	28.1	-33	0	0	0	114	V8	V8-P10 WeakPolarHBondContact O-CD 3.46Å
11	E	51	Low	56	Low	178 Å²	178	133.7 Å²	133.7	83%	0.832	71%	0.714	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.6	4.4	-169.2	-68.2	-165.1	159.5	0	0	115.7	D9 P13	D9-E11 PolarHBondContact O-N 3.03Å; D9-E11 VanDerWaalsContact O-N 3.14Å; E11-P13 WeakPolarHBondContact O-CD 3.3Å
12	V	58.7	Low	56.7	Low	77 Å²	77	129.9 Å²	129.9	47%	0.467	69%	0.691	S	S	.	*			trans	-95.9	104.3	169.3	-127.1	0	0	0	0	108.3	F14	V12-F14 HydrophobicContact CB-CD2 3.67Å; V12-F14 HydrophobicContact CB-CE1 4.25Å; V12-F14 HydrophobicContact CB-CE2 3.31Å; V12-F14 HydrophobicContact CB-CG 4.29Å; V12-F14 HydrophobicContact CB-CZ 3.62Å; V12-F14 HydrophobicContact CG1-CE1 4.16Å; V12-F14 HydrophobicContact CG1-CE2 4.07Å; V12-F14 HydrophobicContact CG1-CZ 3.83Å; V12-F14 HydrophobicContact CG2-CD2 4.11Å; V12-F14 HydrophobicContact CG2-CE2 3.33Å; V12-F14 HydrophobicContact CG2-CZ 3.72Å; V12-F14 VanDerWaalsContact O-CD2 3.3Å; V12-F14 WeakPolarHBondContact O-CD2 3.11Å; V12-F14 PolarHBondContact O-N 2.75Å
13	P	61	Low	57.4	Low	106 Å²	106	129.6 Å²	129.6	69%	0.688	68%	0.676	S	S	*	*			trans	-70.8	79.5	175.8	28.8	-33.9	0	0	0	109	E11 A15	E11-P13 WeakPolarHBondContact O-CD 3.3Å; P13-A15 PolarHBondContact O-N 3.2Å
14	F	57.9	Low	58.2	Low	171 Å²	171	130.6 Å²	130.6	75%	0.75	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.2	-0.2	-171.3	-84.3	-66.7	0	0	0	115.3	V12	V12-F14 HydrophobicContact CB-CD2 3.67Å; V12-F14 HydrophobicContact CB-CE1 4.25Å; V12-F14 HydrophobicContact CB-CE2 3.31Å; V12-F14 HydrophobicContact CB-CG 4.29Å; V12-F14 HydrophobicContact CB-CZ 3.62Å; V12-F14 HydrophobicContact CG1-CE1 4.16Å; V12-F14 HydrophobicContact CG1-CE2 4.07Å; V12-F14 HydrophobicContact CG1-CZ 3.83Å; V12-F14 HydrophobicContact CG2-CD2 4.11Å; V12-F14 HydrophobicContact CG2-CE2 3.33Å; V12-F14 HydrophobicContact CG2-CZ 3.72Å; V12-F14 VanDerWaalsContact O-CD2 3.3Å; V12-F14 WeakPolarHBondContact O-CD2 3.11Å; V12-F14 PolarHBondContact O-N 2.75Å
15	A	62.8	Low	59	Low	91 Å²	91	124 Å²	124	75%	0.752	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-163.5	68.1	170.2	0	0	0	0	0	111.5	P13 R17	P13-A15 PolarHBondContact O-N 3.2Å; A15-R17 PolarHBondContact O-N 3.35Å
16	K	65.1	Low	60.3	Low	136 Å²	136	118.9 Å²	118.9	59%	0.591	64%	0.637	S	S	*	*			trans	-68.9	121.9	160	-160.6	179.5	-175.9	-152	0	107.1	I18 E23	K16-I18 VanDerWaalsContact C-N 3.32Å; K16-I18 PolarHBondContact O-N 3Å; K16-E23 WeakPolarHBondContact CE-OE1 3.5Å; K16-E23 IonicContact NZ-OE1 2.73Å; K16-E23 PolarHBondContact NZ-OE1 2.92Å
17	R	60.5	Low	61.6	Low	244 Å²	244	122.5 Å²	122.5	92%	0.921	64%	0.635	S	S	*	*			trans	-67.8	95.9	170	-82.1	-174.9	174.8	-132.2	2.2	107.4	A15 D19	A15-R17 PolarHBondContact O-N 3.35Å; R17-D19 PolarHBondContact O-N 3.49Å
18	I	63.1	Low	63	Low	71 Å²	71	122.9 Å²	122.9	36%	0.364	63%	0.633	S	S	.	*			trans	-69.6	126.1	176.2	-61.7	175.9	0	0	0	107.8	K16 P20 L25 I33	K16-I18 VanDerWaalsContact C-N 3.32Å; K16-I18 PolarHBondContact O-N 3Å; I18-P20 WeakPolarHBondContact O-CD 3.35Å; I18-L25 HydrophobicContact CG2-CD1 3.71Å; I18-L25 HydrophobicContact CG2-CD2 4.08Å; I18-L25 HydrophobicContact CG2-CG 4.18Å; I18-I33 HydrophobicContact CD1-CD1 4.38Å
19	D	61.3	Low	64.2	Low	62 Å²	62	121.5 Å²	121.5	33%	0.332	62%	0.619	S	S	.	*			trans	-98.9	99.8	173.3	-162.2	-15.9	0	0	0	107.2	R17 N21 K22 E23	R17-D19 PolarHBondContact O-N 3.49Å; D19-N21 PolarHBondContact O-N 2.75Å; D19-K22 HydrophobicContact CB-CB 4.27Å; D19-K22 HydrophobicContact CB-CD 4.31Å; D19-K22 HydrophobicContact CB-CG 4.4Å; D19-K22 PolarHBondContact O-N 2.93Å; D19-K22 VanDerWaalsContact OD2-CD 3.28Å; D19-K22 WeakPolarHBondContact OD2-CD 3.21Å; D19-K22 WeakPolarHBondContact OD2-CE 3.28Å; D19-K22 IonicContact OD2-NZ 2.75Å; D19-K22 PolarHBondContact OD2-NZ 2.65Å; D19-E23 PolarHBondContact O-N 2.86Å
20	P	63.1	Low	65.4	Low	77 Å²	77	121.4 Å²	121.4	50%	0.5	61%	0.613	S	S	.	*	T	Hydrogen-bonded Turn	trans	-64.8	-7.8	-167.1	23.4	-32.9	0	0	0	114.5	I18	I18-P20 WeakPolarHBondContact O-CD 3.35Å
21	N	64.9	Low	66.7	Low	152 Å²	152	121 Å²	121	81%	0.813	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.8	-5	175.8	-61.6	-56.6	0	0	0	113.7	D19	D19-N21 PolarHBondContact O-N 2.75Å
22	K	60.9	Low	68.4	Low	165 Å²	165	119.3 Å²	119.3	72%	0.717	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-123.7	-18.1	-172.7	-61.8	-176.1	-173.7	146.9	0	114.3	D19	D19-K22 HydrophobicContact CB-CB 4.27Å; D19-K22 HydrophobicContact CB-CD 4.31Å; D19-K22 HydrophobicContact CB-CG 4.4Å; D19-K22 PolarHBondContact O-N 2.93Å; D19-K22 VanDerWaalsContact OD2-CD 3.28Å; D19-K22 WeakPolarHBondContact OD2-CD 3.21Å; D19-K22 WeakPolarHBondContact OD2-CE 3.28Å; D19-K22 IonicContact OD2-NZ 2.75Å; D19-K22 PolarHBondContact OD2-NZ 2.65Å
23	E	63.2	Low	69.7	Low	72 Å²	72	118 Å²	118	34%	0.336	58%	0.576	S	S	.	*	S	Bend	trans	-109.7	139.7	178.6	-63.4	-172.6	153.5	0	0	110	K16 D19 L25	K16-E23 WeakPolarHBondContact CE-OE1 3.5Å; K16-E23 IonicContact NZ-OE1 2.73Å; K16-E23 PolarHBondContact NZ-OE1 2.92Å; D19-E23 PolarHBondContact O-N 2.86Å; E23-L25 VanDerWaalsContact C-N 3.33Å; E23-L25 HydrophobicContact CB-CD1 4.11Å; E23-L25 WeakPolarHBondContact O-CD1 3.24Å; E23-L25 PolarHBondContact O-N 2.93Å
24	D	63.1	Low	70.8	Confident	174 Å²	174	120 Å²	120	93%	0.93	57%	0.57	S	S	*	*			trans	-74	87.3	171.3	-107.7	-22.1	0	0	0	108.3
25	L	67.6	Low	72.2	Confident	39 Å²	39	118.5 Å²	118.5	20%	0.204	57%	0.565	C	S	.	*			trans	-72	136.3	176	-83	87.4	0	0	0	110.7	I18 E23 E29 I33	I18-L25 HydrophobicContact CG2-CD1 3.71Å; I18-L25 HydrophobicContact CG2-CD2 4.08Å; I18-L25 HydrophobicContact CG2-CG 4.18Å; E23-L25 VanDerWaalsContact C-N 3.33Å; E23-L25 HydrophobicContact CB-CD1 4.11Å; E23-L25 WeakPolarHBondContact O-CD1 3.24Å; E23-L25 PolarHBondContact O-N 2.93Å; L25-E29 HydrophobicContact CD2-CB 4.12Å; L25-I33 HydrophobicContact CD2-CD1 3.29Å
26	T	77.3	Confident	73.4	Confident	85 Å²	85	116.8 Å²	116.8	52%	0.521	55%	0.545	S	S	.	.			trans	-66	150.4	166.7	49.4	0	0	0	0	110.6	D28 E29 F30	T26-D28 PolarHBondContact O-N 2.94Å; T26-D28 VanDerWaalsContact O-N 3.13Å; T26-E29 PolarHBondContact N-OE2 3.13Å; T26-E29 WeakPolarHBondContact O-CB 3.3Å; T26-E29 PolarHBondContact O-N 3.47Å; T26-E29 VanDerWaalsContact OG1-CG 3.24Å; T26-E29 WeakPolarHBondContact OG1-CG 3.45Å; T26-E29 PolarHBondContact OG1-OE2 3.3Å; T26-F30 PolarHBondContact O-N 3.05Å; T26-F30 VanDerWaalsContact O-N 3.13Å
27	R	76.3	Confident	74.5	Confident	190 Å²	190	116 Å²	116	72%	0.717	54%	0.544	S	S	*	.	H	α-helix	trans	-55.3	-36	-174.8	-164.4	175.9	-176.1	-176.5	-0	112.3	F30 Y31	R27-F30 PolarHBondContact O-N 2.95Å; R27-Y31 HydrophobicContact CG-CD2 4.16Å; R27-Y31 HydrophobicContact CG-CE2 3.86Å; R27-Y31 WeakPolarHBondContact O-CD2 3.34Å; R27-Y31 PolarHBondContact O-N 3.33Å; R27-Y31 VanDerWaalsContact O-N 3.14Å
28	D	79.4	Confident	75.8	Confident	129 Å²	129	109.2 Å²	109.2	69%	0.69	53%	0.525	S	S	*	.	H	α-helix	trans	-71.4	-37.9	179.7	-64.1	-18.5	0	0	0	112.3	T26 F30 Y31 F32	T26-D28 PolarHBondContact O-N 2.94Å; T26-D28 VanDerWaalsContact O-N 3.13Å; D28-F30 VanDerWaalsContact C-N 3.32Å; D28-F30 PolarHBondContact O-N 3.31Å; D28-Y31 PolarHBondContact O-N 3.5Å; D28-F32 PolarHBondContact O-N 2.92Å
29	E	78.6	Confident	77	Confident	92 Å²	92	108.8 Å²	108.8	43%	0.43	53%	0.532	S	S	.	.	H	α-helix	trans	-63	-40.5	173.7	-67.8	170.1	136.8	0	0	111.1	L25 T26 F32 I33	L25-E29 HydrophobicContact CD2-CB 4.12Å; T26-E29 PolarHBondContact N-OE2 3.13Å; T26-E29 WeakPolarHBondContact O-CB 3.3Å; T26-E29 PolarHBondContact O-N 3.47Å; T26-E29 VanDerWaalsContact OG1-CG 3.24Å; T26-E29 WeakPolarHBondContact OG1-CG 3.45Å; T26-E29 PolarHBondContact OG1-OE2 3.3Å; E29-F32 PolarHBondContact O-N 3.45Å; E29-I33 VanDerWaalsContact O-CG1 3.3Å; E29-I33 WeakPolarHBondContact O-CG1 3.41Å; E29-I33 PolarHBondContact O-N 2.89Å
30	F	82	Confident	78.3	Confident	113 Å²	113	111.9 Å²	111.9	50%	0.496	54%	0.544	S	S	.	.	H	α-helix	trans	-62.8	-44.1	175.5	-170.8	-90.6	0	0	0	112.3	T26 R27 D28 F32 I33 R34	T26-F30 PolarHBondContact O-N 3.05Å; T26-F30 VanDerWaalsContact O-N 3.13Å; R27-F30 PolarHBondContact O-N 2.95Å; D28-F30 VanDerWaalsContact C-N 3.32Å; D28-F30 PolarHBondContact O-N 3.31Å; F30-F32 VanDerWaalsContact C-N 3.33Å; F30-F32 PolarHBondContact O-N 3.13Å; F30-I33 PolarHBondContact O-N 2.87Å; F30-R34 WeakPolarHBondContact O-CB 3.35Å; F30-R34 PolarHBondContact O-N 3.26Å
31	Y	83.9	Confident	79.5	Confident	118 Å²	118	117 Å²	117	46%	0.463	55%	0.554	S	S	.	*	H	α-helix	trans	-62.6	-40.4	175.5	-85.2	-71.4	0	0	0	111.9	R27 D28 Q35	R27-Y31 HydrophobicContact CG-CD2 4.16Å; R27-Y31 HydrophobicContact CG-CE2 3.86Å; R27-Y31 WeakPolarHBondContact O-CD2 3.34Å; R27-Y31 PolarHBondContact O-N 3.33Å; R27-Y31 VanDerWaalsContact O-N 3.14Å; D28-Y31 PolarHBondContact O-N 3.5Å; Y31-Q35 WeakPolarHBondContact O-CG 3.13Å; Y31-Q35 PolarHBondContact O-N 3.47Å; Y31-Q35 VanDerWaalsContact O-N 3.08Å
32	F	86.4	Confident	80.6	Confident	142 Å²	142	116.1 Å²	116.1	62%	0.623	54%	0.543	S	S	*	.	H	α-helix	trans	-64.7	-49.3	177.6	-178.9	-101.1	0	0	0	111.9	D28 E29 F30 R34 Q35 V36	D28-F32 PolarHBondContact O-N 2.92Å; E29-F32 PolarHBondContact O-N 3.45Å; F30-F32 VanDerWaalsContact C-N 3.33Å; F30-F32 PolarHBondContact O-N 3.13Å; F32-R34 VanDerWaalsContact C-N 3.3Å; F32-R34 PolarHBondContact O-N 3.14Å; F32-Q35 PolarHBondContact O-N 3.19Å; F32-Q35 VanDerWaalsContact O-N 3.14Å; F32-V36 HydrophobicContact CD1-CG2 4.23Å; F32-V36 HydrophobicContact CE1-CG2 3.82Å; F32-V36 HydrophobicContact CE2-CG2 4.16Å; F32-V36 HydrophobicContact CZ-CG2 3.78Å; F32-V36 WeakPolarHBondContact O-CG2 3.43Å; F32-V36 PolarHBondContact O-N 3.37Å
33	I	85.4	Confident	81.9	Confident	49 Å²	49	115.4 Å²	115.4	25%	0.251	54%	0.54	S	S	.	.	H	α-helix	trans	-57.2	-46	177.8	-70.5	167.2	0	0	0	110.5	I18 L25 E29 F30 Q35 V36 E37	I18-I33 HydrophobicContact CD1-CD1 4.38Å; L25-I33 HydrophobicContact CD2-CD1 3.29Å; E29-I33 VanDerWaalsContact O-CG1 3.3Å; E29-I33 WeakPolarHBondContact O-CG1 3.41Å; E29-I33 PolarHBondContact O-N 2.89Å; F30-I33 PolarHBondContact O-N 2.87Å; I33-Q35 VanDerWaalsContact C-N 3.32Å; I33-Q35 PolarHBondContact O-N 2.98Å; I33-V36 PolarHBondContact O-N 3.14Å; I33-E37 HydrophobicContact CG2-CG 4.47Å; I33-E37 PolarHBondContact O-N 3.03Å
34	R	84.9	Confident	83	Confident	148 Å²	148	118.7 Å²	118.7	56%	0.558	55%	0.553	S	S	*	*	H	α-helix	trans	-60.9	-40.1	178.7	-170.6	175.9	-176.3	-179.3	2.3	112.5	F30 F32 L38	F30-R34 WeakPolarHBondContact O-CB 3.35Å; F30-R34 PolarHBondContact O-N 3.26Å; F32-R34 VanDerWaalsContact C-N 3.3Å; F32-R34 PolarHBondContact O-N 3.14Å; R34-L38 HydrophobicContact CG-CD1 4.47Å; R34-L38 VanDerWaalsContact O-CG 3.29Å; R34-L38 WeakPolarHBondContact O-CG 3.44Å; R34-L38 PolarHBondContact O-N 2.9Å; R34-L38 VanDerWaalsContact O-N 3.13Å
35	Q	86.9	Confident	84.2	Confident	139 Å²	139	112.1 Å²	112.1	65%	0.65	52%	0.52	S	S	*	.	H	α-helix	trans	-66.6	-42	176.3	-76.4	-164	65.2	0	0	112.1	Y31 F32 I33 L38 A39	Y31-Q35 WeakPolarHBondContact O-CG 3.13Å; Y31-Q35 PolarHBondContact O-N 3.47Å; Y31-Q35 VanDerWaalsContact O-N 3.08Å; F32-Q35 PolarHBondContact O-N 3.19Å; F32-Q35 VanDerWaalsContact O-N 3.14Å; I33-Q35 VanDerWaalsContact C-N 3.32Å; I33-Q35 PolarHBondContact O-N 2.98Å; Q35-L38 PolarHBondContact O-N 3.4Å; Q35-A39 WeakPolarHBondContact O-CB 3.39Å; Q35-A39 PolarHBondContact O-N 3.38Å
36	V	88.1	Confident	85.1	Confident	55 Å²	55	116 Å²	116	33%	0.333	54%	0.538	S	S	.	.	H	α-helix	trans	-64.8	-43.5	178.2	174.5	0	0	0	0	111	F32 I33 L38 A39 Q40	F32-V36 HydrophobicContact CD1-CG2 4.23Å; F32-V36 HydrophobicContact CE1-CG2 3.82Å; F32-V36 HydrophobicContact CE2-CG2 4.16Å; F32-V36 HydrophobicContact CZ-CG2 3.78Å; F32-V36 WeakPolarHBondContact O-CG2 3.43Å; F32-V36 PolarHBondContact O-N 3.37Å; I33-V36 PolarHBondContact O-N 3.14Å; V36-L38 PolarHBondContact O-N 3.08Å; V36-A39 PolarHBondContact O-N 3.35Å; V36-Q40 HydrophobicContact CG1-CG 4.34Å; V36-Q40 WeakPolarHBondContact O-CB 3.35Å; V36-Q40 WeakPolarHBondContact O-CG 3.45Å; V36-Q40 PolarHBondContact O-N 3.48Å
37	E	87.4	Confident	85.6	Confident	121 Å²	121	117.7 Å²	117.7	57%	0.565	54%	0.539	S	S	*	.	H	α-helix	trans	-59.7	-45.4	175.8	-79.2	-171.6	160.2	0	0	112.1	I33 A39 Q40 W41	I33-E37 HydrophobicContact CG2-CG 4.47Å; I33-E37 PolarHBondContact O-N 3.03Å; E37-A39 VanDerWaalsContact C-N 3.34Å; E37-A39 PolarHBondContact O-N 3.45Å; E37-Q40 PolarHBondContact O-N 3.45Å; E37-W41 VanDerWaalsContact O-CB 3.28Å; E37-W41 WeakPolarHBondContact O-CB 3.29Å; E37-W41 PolarHBondContact O-N 3.33Å
38	L	88.9	Confident	86.2	Confident	101 Å²	101	112.6 Å²	112.6	53%	0.529	53%	0.526	S	S	.	.	H	α-helix	trans	-62.4	-42	177.2	-73.2	172.3	0	0	0	111.7	R34 Q35 V36 W41 K42	R34-L38 HydrophobicContact CG-CD1 4.47Å; R34-L38 VanDerWaalsContact O-CG 3.29Å; R34-L38 WeakPolarHBondContact O-CG 3.44Å; R34-L38 PolarHBondContact O-N 2.9Å; R34-L38 VanDerWaalsContact O-N 3.13Å; Q35-L38 PolarHBondContact O-N 3.4Å; V36-L38 PolarHBondContact O-N 3.08Å; L38-W41 PolarHBondContact O-N 2.96Å; L38-K42 VanDerWaalsContact O-CB 3.32Å; L38-K42 WeakPolarHBondContact O-CB 3.37Å; L38-K42 PolarHBondContact O-N 3.46Å
39	A	87.7	Confident	86.8	Confident	62 Å²	62	114.5 Å²	114.5	51%	0.512	52%	0.524	S	S	.	.	H	α-helix	trans	-64.6	-43.9	177	0	0	0	0	0	111.7	Q35 V36 E37 K42 K43	Q35-A39 WeakPolarHBondContact O-CB 3.39Å; Q35-A39 PolarHBondContact O-N 3.38Å; V36-A39 PolarHBondContact O-N 3.35Å; E37-A39 VanDerWaalsContact C-N 3.34Å; E37-A39 PolarHBondContact O-N 3.45Å; A39-K42 PolarHBondContact O-N 2.99Å; A39-K43 WeakPolarHBondContact O-CB 3.23Å; A39-K43 PolarHBondContact O-N 2.91Å
40	Q	88.2	Confident	87.5	Confident	127 Å²	127	112.1 Å²	112.1	59%	0.593	52%	0.524	S	S	*	.	H	α-helix	trans	-63.9	-43.4	175.9	-75.3	-176.1	-33.6	0	0	111.8	V36 E37 K43 K44	V36-Q40 HydrophobicContact CG1-CG 4.34Å; V36-Q40 WeakPolarHBondContact O-CB 3.35Å; V36-Q40 WeakPolarHBondContact O-CG 3.45Å; V36-Q40 PolarHBondContact O-N 3.48Å; E37-Q40 PolarHBondContact O-N 3.45Å; Q40-K43 PolarHBondContact O-N 2.81Å; Q40-K44 WeakPolarHBondContact O-CB 3.3Å; Q40-K44 PolarHBondContact O-N 3.4Å
41	W	87.7	Confident	88	Confident	185 Å²	185	114.4 Å²	114.4	70%	0.701	53%	0.529	S	S	*	.	H	α-helix	trans	-63.1	-44.9	177.7	-175.6	68.3	0	0	0	111.5	E37 L38 K43 K44 S45	E37-W41 VanDerWaalsContact O-CB 3.28Å; E37-W41 WeakPolarHBondContact O-CB 3.29Å; E37-W41 PolarHBondContact O-N 3.33Å; L38-W41 PolarHBondContact O-N 2.96Å; W41-K43 PolarHBondContact O-N 3.13Å; W41-K44 PolarHBondContact O-N 2.96Å; W41-S45 VanDerWaalsContact O-CB 3.23Å; W41-S45 WeakPolarHBondContact O-CB 3.32Å; W41-S45 PolarHBondContact O-N 3.39Å
42	K	88.5	Confident	88.6	Confident	132 Å²	132	114.2 Å²	114.2	57%	0.574	54%	0.536	S	S	*	.	H	α-helix	trans	-60.6	-46.7	175.9	-171.2	176.5	-178.4	-178.6	0	111.5	L38 A39 S45 Q46	L38-K42 VanDerWaalsContact O-CB 3.32Å; L38-K42 WeakPolarHBondContact O-CB 3.37Å; L38-K42 PolarHBondContact O-N 3.46Å; A39-K42 PolarHBondContact O-N 2.99Å; K42-S45 PolarHBondContact O-N 3.36Å; K42-Q46 WeakPolarHBondContact O-CB 3.32Å; K42-Q46 WeakPolarHBondContact O-CG 3.28Å; K42-Q46 PolarHBondContact O-N 3.48Å
43	K	87.9	Confident	89.1	Confident	151 Å²	151	112.8 Å²	112.8	66%	0.657	53%	0.533	S	S	*	.	H	α-helix	trans	-60.5	-48.2	177.6	-174.8	178.8	-179.2	-179.6	0	111.7	A39 Q40 W41 S45 Q46 Q47	A39-K43 WeakPolarHBondContact O-CB 3.23Å; A39-K43 PolarHBondContact O-N 2.91Å; Q40-K43 PolarHBondContact O-N 2.81Å; W41-K43 PolarHBondContact O-N 3.13Å; K43-S45 PolarHBondContact O-N 3.07Å; K43-Q46 PolarHBondContact O-N 3.34Å; K43-Q47 WeakPolarHBondContact O-CB 3.31Å; K43-Q47 PolarHBondContact O-N 3.49Å
44	K	87.3	Confident	89.6	Confident	141 Å²	141	113.1 Å²	113.1	61%	0.613	54%	0.544	S	S	*	.	H	α-helix	trans	-63.8	-42.3	179.4	-170.6	175.5	-179	179.9	0	111.6	Q40 W41 Q47 L48	Q40-K44 WeakPolarHBondContact O-CB 3.3Å; Q40-K44 PolarHBondContact O-N 3.4Å; W41-K44 PolarHBondContact O-N 2.96Å; K44-Q47 PolarHBondContact O-N 3.38Å; K44-L48 HydrophobicContact CG-CD1 4.25Å; K44-L48 VanDerWaalsContact O-CG 3.31Å; K44-L48 WeakPolarHBondContact O-CG 3.49Å; K44-L48 PolarHBondContact O-N 2.99Å
45	S	88.1	Confident	90.2	Very high	35 Å²	35	109.9 Å²	109.9	25%	0.245	54%	0.54	C	S	.	.	H	α-helix	trans	-62.4	-45.8	177.3	-175.7	0	0	0	0	112	W41 K42 K43 Q47 L48 R49	W41-S45 VanDerWaalsContact O-CB 3.23Å; W41-S45 WeakPolarHBondContact O-CB 3.32Å; W41-S45 PolarHBondContact O-N 3.39Å; K42-S45 PolarHBondContact O-N 3.36Å; K43-S45 PolarHBondContact O-N 3.07Å; S45-Q47 PolarHBondContact O-N 3Å; S45-L48 PolarHBondContact O-N 2.94Å; S45-R49 WeakPolarHBondContact O-CG 3.44Å; S45-R49 PolarHBondContact O-N 2.87Å
46	Q	86.5	Confident	90.8	Very high	122 Å²	122	105.2 Å²	105.2	57%	0.57	53%	0.53	S	S	*	.	H	α-helix	trans	-62.7	-42.1	176.1	-75.1	-178.1	-23.3	0	0	112.3	K42 K43 L48 R49 G50	K42-Q46 WeakPolarHBondContact O-CB 3.32Å; K42-Q46 WeakPolarHBondContact O-CG 3.28Å; K42-Q46 PolarHBondContact O-N 3.48Å; K43-Q46 PolarHBondContact O-N 3.34Å; Q46-L48 PolarHBondContact O-N 3.41Å; Q46-R49 PolarHBondContact O-N 3.5Å; Q46-G50 PolarHBondContact O-N 2.99Å
47	Q	88.3	Confident	91.3	Very high	119 Å²	119	108.4 Å²	108.4	56%	0.556	55%	0.545	S	S	*	.	H	α-helix	trans	-63.2	-42.6	178.2	-168.8	179.5	8.8	0	0	112	K43 K44 S45 G50 R51	K43-Q47 WeakPolarHBondContact O-CB 3.31Å; K43-Q47 PolarHBondContact O-N 3.49Å; K44-Q47 PolarHBondContact O-N 3.38Å; S45-Q47 PolarHBondContact O-N 3Å; Q47-G50 PolarHBondContact O-N 3.48Å; Q47-R51 VanDerWaalsContact O-CG 3.3Å; Q47-R51 WeakPolarHBondContact O-CG 3.42Å; Q47-R51 PolarHBondContact O-N 3.37Å
48	L	89.1	Confident	91.8	Very high	83 Å²	83	105.2 Å²	105.2	44%	0.435	54%	0.539	S	S	.	.	H	α-helix	trans	-64.9	-42.5	176.4	-70.7	169.9	0	0	0	111.7	K44 S45 Q46 R51 N52	K44-L48 HydrophobicContact CG-CD1 4.25Å; K44-L48 VanDerWaalsContact O-CG 3.31Å; K44-L48 WeakPolarHBondContact O-CG 3.49Å; K44-L48 PolarHBondContact O-N 2.99Å; S45-L48 PolarHBondContact O-N 2.94Å; Q46-L48 PolarHBondContact O-N 3.41Å; L48-R51 PolarHBondContact O-N 2.96Å; L48-N52 WeakPolarHBondContact O-CB 3.49Å; L48-N52 PolarHBondContact O-N 3.5Å; L48-N52 PolarHBondContact O-OD1 3.4Å
49	R	90.1	Very high	92.2	Very high	170 Å²	170	105.1 Å²	105.1	64%	0.642	54%	0.538	S	S	*	.	H	α-helix	trans	-61	-46.4	175.9	-73.1	176.2	-177.2	-162.1	-0.8	111.9	S45 Q46 R51 N52 I53	S45-R49 WeakPolarHBondContact O-CG 3.44Å; S45-R49 PolarHBondContact O-N 2.87Å; Q46-R49 PolarHBondContact O-N 3.5Å; R49-R51 PolarHBondContact O-N 2.97Å; R49-N52 PolarHBondContact O-N 3.2Å; R49-I53 VanDerWaalsContact O-CG1 3.32Å; R49-I53 WeakPolarHBondContact O-CG1 3.38Å; R49-I53 PolarHBondContact O-N 2.92Å
50	G	93.5	Very high	92.7	Very high	42 Å²	42	103.6 Å²	103.6	43%	0.433	53%	0.528	S	S	.	.	H	α-helix	trans	-60.6	-43.9	178.1	0	0	0	0	0	112.4	Q46 Q47 I53 A54	Q46-G50 PolarHBondContact O-N 2.99Å; Q47-G50 PolarHBondContact O-N 3.48Å; G50-I53 PolarHBondContact O-N 2.96Å; G50-A54 WeakPolarHBondContact O-CB 3.42Å; G50-A54 PolarHBondContact O-N 2.9Å
51	R	93.7	Very high	93.2	Very high	161 Å²	161	100.2 Å²	100.2	61%	0.608	52%	0.522	S	S	*	.	H	α-helix	trans	-62.1	-43.6	175.7	-71.4	173.4	69.2	171.7	2.6	111.9	Q47 L48 R49 I53 A54 T55	Q47-R51 VanDerWaalsContact O-CG 3.3Å; Q47-R51 WeakPolarHBondContact O-CG 3.42Å; Q47-R51 PolarHBondContact O-N 3.37Å; L48-R51 PolarHBondContact O-N 2.96Å; R49-R51 PolarHBondContact O-N 2.97Å; R51-I53 PolarHBondContact O-N 3.3Å; R51-A54 PolarHBondContact O-N 3.48Å; R51-T55 WeakPolarHBondContact O-CB 3.32Å; R51-T55 PolarHBondContact O-N 2.94Å; R51-T55 PolarHBondContact O-OG1 2.98Å
52	N	95.4	Very high	93.7	Very high	114 Å²	114	96.5 Å²	96.5	61%	0.61	52%	0.515	S	S	*	.	H	α-helix	trans	-65.7	-39.7	179.6	-69.4	-3.8	0	0	0	112.1	L48 R49 G56	L48-N52 WeakPolarHBondContact O-CB 3.49Å; L48-N52 PolarHBondContact O-N 3.5Å; L48-N52 PolarHBondContact O-OD1 3.4Å; R49-N52 PolarHBondContact O-N 3.2Å; N52-G56 PolarHBondContact O-N 3.27Å
53	I	96.7	Very high	94.1	Very high	111 Å²	111	93.4 Å²	93.4	57%	0.569	51%	0.507	S	S	*	.	H	α-helix	trans	-63.3	-48.4	174.6	-67.9	166.2	0	0	0	110.1	R49 G50 R51 T55 G56 L57	R49-I53 VanDerWaalsContact O-CG1 3.32Å; R49-I53 WeakPolarHBondContact O-CG1 3.38Å; R49-I53 PolarHBondContact O-N 2.92Å; G50-I53 PolarHBondContact O-N 2.96Å; R51-I53 PolarHBondContact O-N 3.3Å; I53-T55 VanDerWaalsContact C-N 3.34Å; I53-T55 PolarHBondContact O-N 3.34Å; I53-G56 PolarHBondContact O-N 3.46Å; I53-L57 HydrophobicContact CG2-CD1 4.01Å; I53-L57 HydrophobicContact CG2-CG 4.36Å; I53-L57 WeakPolarHBondContact O-CG 3.31Å; I53-L57 PolarHBondContact O-N 3.26Å
54	A	97.8	Very high	94.6	Very high	57 Å²	57	92.8 Å²	92.8	47%	0.471	51%	0.507	S	S	.	.	H	α-helix	trans	-59.4	-44.8	179.1	0	0	0	0	0	111.9	G50 R51 L57 A58	G50-A54 WeakPolarHBondContact O-CB 3.42Å; G50-A54 PolarHBondContact O-N 2.9Å; R51-A54 PolarHBondContact O-N 3.48Å; A54-L57 PolarHBondContact O-N 3.42Å; A54-A58 WeakPolarHBondContact O-CB 3.34Å; A54-A58 PolarHBondContact O-N 3.39Å
55	T	97.3	Very high	95	Very high	79 Å²	79	88 Å²	88	49%	0.485	50%	0.499	S	S	.	.	H	α-helix	trans	-62.2	-44.4	175.6	-57.3	0	0	0	0	111.5	R51 I53 L57 A58 I59	R51-T55 WeakPolarHBondContact O-CB 3.32Å; R51-T55 PolarHBondContact O-N 2.94Å; R51-T55 PolarHBondContact O-OG1 2.98Å; I53-T55 VanDerWaalsContact C-N 3.34Å; I53-T55 PolarHBondContact O-N 3.34Å; T55-L57 PolarHBondContact O-N 3.49Å; T55-A58 PolarHBondContact O-N 2.95Å; T55-I59 HydrophobicContact CG2-CD1 3.91Å; T55-I59 WeakPolarHBondContact O-CG1 3.47Å; T55-I59 PolarHBondContact O-N 3.4Å
56	G	97.9	Very high	95.4	Very high	42 Å²	42	91.2 Å²	91.2	43%	0.433	51%	0.512	S	S	.	.	H	α-helix	trans	-61.3	-43	177.4	0	0	0	0	0	112.8	N52 I53 I59 G60	N52-G56 PolarHBondContact O-N 3.27Å; I53-G56 PolarHBondContact O-N 3.46Å; G56-I59 PolarHBondContact O-N 3.35Å; G56-G60 PolarHBondContact O-N 2.92Å
57	L	98.4	Very high	95.8	Very high	122 Å²	122	92.4 Å²	92.4	64%	0.639	51%	0.512	S	S	*	.	H	α-helix	trans	-64.4	-41.8	175.5	-71.2	175.9	0	0	0	112	I53 A54 T55 G60 A61	I53-L57 HydrophobicContact CG2-CD1 4.01Å; I53-L57 HydrophobicContact CG2-CG 4.36Å; I53-L57 WeakPolarHBondContact O-CG 3.31Å; I53-L57 PolarHBondContact O-N 3.26Å; A54-L57 PolarHBondContact O-N 3.42Å; T55-L57 PolarHBondContact O-N 3.49Å; L57-G60 PolarHBondContact O-N 3.47Å; L57-A61 WeakPolarHBondContact O-CB 3.32Å; L57-A61 PolarHBondContact O-N 3.04Å
58	A	98.3	Very high	96.1	Very high	53 Å²	53	88.6 Å²	88.6	44%	0.438	51%	0.505	S	S	.	.	H	α-helix	trans	-62.1	-47.2	177.4	0	0	0	0	0	111.5	A54 T55 G60 A61 I62	A54-A58 WeakPolarHBondContact O-CB 3.34Å; A54-A58 PolarHBondContact O-N 3.39Å; T55-A58 PolarHBondContact O-N 2.95Å; A58-G60 PolarHBondContact O-N 3.35Å; A58-A61 PolarHBondContact O-N 3.49Å; A58-I62 VanDerWaalsContact O-CG1 3.31Å; A58-I62 WeakPolarHBondContact O-CG1 3.38Å; A58-I62 PolarHBondContact O-N 2.89Å
59	I	98.3	Very high	96.2	Very high	100 Å²	100	92.1 Å²	92.1	51%	0.513	51%	0.514	S	S	.	.	H	α-helix	trans	-60.8	-46.9	176.1	-66.2	168.3	0	0	0	110.2	T55 G56 A61 I62 V63	T55-I59 HydrophobicContact CG2-CD1 3.91Å; T55-I59 WeakPolarHBondContact O-CG1 3.47Å; T55-I59 PolarHBondContact O-N 3.4Å; G56-I59 PolarHBondContact O-N 3.35Å; I59-A61 VanDerWaalsContact C-N 3.35Å; I59-A61 PolarHBondContact O-N 2.86Å; I59-I62 PolarHBondContact O-N 3.04Å; I59-V63 HydrophobicContact CG2-CG2 4.48Å; I59-V63 WeakPolarHBondContact O-CG2 3.2Å; I59-V63 PolarHBondContact O-N 3.33Å
60	G	98	Very high	96.1	Very high	29 Å²	29	87.4 Å²	87.4	30%	0.299	50%	0.504	S	S	.	.	H	α-helix	trans	-59.5	-42.7	178.3	0	0	0	0	0	113	G56 L57 A58 V63 M64	G56-G60 PolarHBondContact O-N 2.92Å; L57-G60 PolarHBondContact O-N 3.47Å; A58-G60 PolarHBondContact O-N 3.35Å; G60-V63 PolarHBondContact O-N 3.49Å; G60-M64 WeakPolarHBondContact O-CB 3.43Å; G60-M64 WeakPolarHBondContact O-CG 3.38Å; G60-M64 PolarHBondContact O-N 2.92Å
61	A	98.3	Very high	95.5	Very high	57 Å²	57	92.4 Å²	92.4	47%	0.471	51%	0.514	S	S	.	.	H	α-helix	trans	-64.1	-41	177.2	0	0	0	0	0	112.3	L57 A58 I59 M64 G65	L57-A61 WeakPolarHBondContact O-CB 3.32Å; L57-A61 PolarHBondContact O-N 3.04Å; A58-A61 PolarHBondContact O-N 3.49Å; I59-A61 VanDerWaalsContact C-N 3.35Å; I59-A61 PolarHBondContact O-N 2.86Å; A61-M64 PolarHBondContact O-N 2.98Å; A61-G65 PolarHBondContact O-N 2.94Å
62	I	98.3	Very high	94.9	Very high	107 Å²	107	91.5 Å²	91.5	55%	0.549	51%	0.511	S	S	.	.	H	α-helix	trans	-62.2	-48.6	176	-69.4	165.5	0	0	0	110.4	A58 I59 M64 G65 I66	A58-I62 VanDerWaalsContact O-CG1 3.31Å; A58-I62 WeakPolarHBondContact O-CG1 3.38Å; A58-I62 PolarHBondContact O-N 2.89Å; I59-I62 PolarHBondContact O-N 3.04Å; I62-M64 PolarHBondContact O-N 3.3Å; I62-G65 PolarHBondContact O-N 2.86Å; I62-G65 VanDerWaalsContact O-N 3.15Å; I62-I66 HydrophobicContact CG2-CD1 3.97Å; I62-I66 WeakPolarHBondContact O-CG1 3.45Å; I62-I66 PolarHBondContact O-N 3.36Å
63	V	97.9	Very high	94	Very high	67 Å²	67	87.7 Å²	87.7	41%	0.406	49%	0.494	S	S	.	.	H	α-helix	trans	-60.5	-48.3	179.3	173.4	0	0	0	0	110.6	I59 G60 G65 I66 Y67	I59-V63 HydrophobicContact CG2-CG2 4.48Å; I59-V63 WeakPolarHBondContact O-CG2 3.2Å; I59-V63 PolarHBondContact O-N 3.33Å; G60-V63 PolarHBondContact O-N 3.49Å; V63-G65 VanDerWaalsContact C-N 3.27Å; V63-G65 PolarHBondContact O-N 3.15Å; V63-I66 PolarHBondContact O-N 3.49Å; V63-Y67 HydrophobicContact CG1-CD2 3.73Å; V63-Y67 HydrophobicContact CG1-CE2 3.83Å; V63-Y67 WeakPolarHBondContact O-CD2 3.33Å; V63-Y67 PolarHBondContact O-N 3.42Å
64	M	97.6	Very high	92.7	Very high	137 Å²	137	86.4 Å²	86.4	68%	0.675	49%	0.491	S	S	*	.	H	α-helix	trans	-60	-37.7	175.4	-75.6	-170.4	-71.1	0	0	112.3	G60 A61 I62 G68	G60-M64 WeakPolarHBondContact O-CB 3.43Å; G60-M64 WeakPolarHBondContact O-CG 3.38Å; G60-M64 PolarHBondContact O-N 2.92Å; A61-M64 PolarHBondContact O-N 2.98Å; I62-M64 PolarHBondContact O-N 3.3Å; M64-G68 WeakPolarHBondContact O-CA 3.49Å; M64-G68 PolarHBondContact O-N 2.96Å
65	G	96.6	Very high	91.1	Very high	42 Å²	42	90.3 Å²	90.3	43%	0.433	50%	0.497	S	S	.	.	H	α-helix	trans	-63.7	-46.2	176.5	0	0	0	0	0	112.7	A61 I62 V63 Y69	A61-G65 PolarHBondContact O-N 2.94Å; I62-G65 PolarHBondContact O-N 2.86Å; I62-G65 VanDerWaalsContact O-N 3.15Å; V63-G65 VanDerWaalsContact C-N 3.27Å; V63-G65 PolarHBondContact O-N 3.15Å; G65-Y69 WeakPolarHBondContact O-CB 3.47Å; G65-Y69 PolarHBondContact O-N 2.85Å
66	I	96.1	Very high	89.2	Confident	102 Å²	102	91.3 Å²	91.3	52%	0.523	50%	0.497	S	S	.	.	H	α-helix	trans	-62.6	-53.4	178.1	-65.7	167.2	0	0	0	110.1	I62 V63 G68 Y69 T70	I62-I66 HydrophobicContact CG2-CD1 3.97Å; I62-I66 WeakPolarHBondContact O-CG1 3.45Å; I62-I66 PolarHBondContact O-N 3.36Å; V63-I66 PolarHBondContact O-N 3.49Å; I66-G68 PolarHBondContact O-N 3.49Å; I66-Y69 PolarHBondContact O-N 2.92Å; I66-T70 PolarHBondContact O-N 3.01Å; I66-T70 PolarHBondContact O-OG1 3.39Å
67	Y	93.6	Very high	87.4	Confident	146 Å²	146	96 Å²	96	57%	0.573	51%	0.507	S	S	*	.	H	α-helix	trans	-64	-43.8	-179.7	-81	-74.8	0	0	0	111.9	V63 Y69 T70 F71	V63-Y67 HydrophobicContact CG1-CD2 3.73Å; V63-Y67 HydrophobicContact CG1-CE2 3.83Å; V63-Y67 WeakPolarHBondContact O-CD2 3.33Å; V63-Y67 PolarHBondContact O-N 3.42Å; Y67-Y69 VanDerWaalsContact C-N 3.32Å; Y67-Y69 PolarHBondContact O-N 3.43Å; Y67-T70 PolarHBondContact O-N 3.45Å; Y67-F71 WeakPolarHBondContact O-CD2 3.41Å; Y67-F71 PolarHBondContact O-N 3.42Å
68	G	94.4	Very high	85.7	Confident	39 Å²	39	96.6 Å²	96.6	40%	0.402	50%	0.504	S	S	.	.	H	α-helix	trans	-59.6	-42.3	177.1	0	0	0	0	0	112.2	M64 I66 F71 Y72	M64-G68 WeakPolarHBondContact O-CA 3.49Å; M64-G68 PolarHBondContact O-N 2.96Å; I66-G68 PolarHBondContact O-N 3.49Å; G68-F71 PolarHBondContact O-N 3.45Å; G68-Y72 WeakPolarHBondContact O-CB 3.39Å; G68-Y72 PolarHBondContact O-N 3.31Å
69	Y	92.2	Very high	83.9	Confident	158 Å²	158	98.5 Å²	98.5	62%	0.62	51%	0.506	S	S	*	.	H	α-helix	trans	-64.5	-45.7	174.4	-178.8	-102.5	0	0	0	111.7	G65 I66 Y67 F71 Y72 S73	G65-Y69 WeakPolarHBondContact O-CB 3.47Å; G65-Y69 PolarHBondContact O-N 2.85Å; I66-Y69 PolarHBondContact O-N 2.92Å; Y67-Y69 VanDerWaalsContact C-N 3.32Å; Y67-Y69 PolarHBondContact O-N 3.43Å; Y69-F71 VanDerWaalsContact C-N 3.34Å; Y69-F71 PolarHBondContact O-N 2.78Å; Y69-Y72 CarbonylContact O-C 3.58Å; Y69-Y72 PolarHBondContact O-N 3.04Å; Y69-Y72 VanDerWaalsContact O-N 3.12Å; Y69-S73 WeakPolarHBondContact O-CB 3.43Å; Y69-S73 PolarHBondContact O-N 2.96Å; Y69-S73 PolarHBondContact O-OG 3.49Å
70	T	87.3	Confident	82.4	Confident	70 Å²	70	98.8 Å²	98.8	43%	0.429	51%	0.507	S	S	.	.	H	α-helix	trans	-58.5	-44.6	175.8	-57.2	0	0	0	0	111.8	I66 Y67 Y72 S73 V74	I66-T70 PolarHBondContact O-N 3.01Å; I66-T70 PolarHBondContact O-OG1 3.39Å; Y67-T70 PolarHBondContact O-N 3.45Å; T70-Y72 VanDerWaalsContact C-N 3.32Å; T70-Y72 PolarHBondContact O-N 3.23Å; T70-S73 WeakPolarHBondContact CA-OG 3.44Å; T70-S73 PolarHBondContact O-N 2.79Å; T70-S73 PolarHBondContact O-OG 3Å; T70-V74 WeakPolarHBondContact O-CB 3.22Å; T70-V74 VanDerWaalsContact O-CG2 3.22Å; T70-V74 WeakPolarHBondContact O-CG2 3.5Å; T70-V74 PolarHBondContact O-N 3.12Å
71	F	80.9	Confident	81	Confident	148 Å²	148	102.7 Å²	102.7	65%	0.649	52%	0.521	S	S	*	.	H	α-helix	trans	-63.8	-38.2	175.7	-78.3	-65.4	0	0	0	112.4	Y67 G68 Y69 K75	Y67-F71 WeakPolarHBondContact O-CD2 3.41Å; Y67-F71 PolarHBondContact O-N 3.42Å; G68-F71 PolarHBondContact O-N 3.45Å; Y69-F71 VanDerWaalsContact C-N 3.34Å; Y69-F71 PolarHBondContact O-N 2.78Å; F71-K75 PolarHBondContact O-N 3.28Å
72	Y	81.4	Confident	79.6	Confident	141 Å²	141	104.9 Å²	104.9	55%	0.553	52%	0.521	S	S	*	.	H	α-helix	trans	-70.1	-40.2	177.3	178	-108.6	0	0	0	112.5	G68 Y69 T70 K75 Q76	G68-Y72 WeakPolarHBondContact O-CB 3.39Å; G68-Y72 PolarHBondContact O-N 3.31Å; Y69-Y72 CarbonylContact O-C 3.58Å; Y69-Y72 PolarHBondContact O-N 3.04Å; Y69-Y72 VanDerWaalsContact O-N 3.12Å; T70-Y72 VanDerWaalsContact C-N 3.32Å; T70-Y72 PolarHBondContact O-N 3.23Å; Y72-K75 WeakPolarHBondContact O-CB 3.04Å; Y72-K75 PolarHBondContact O-N 2.87Å; Y72-Q76 PolarHBondContact O-N 3.43Å
73	S	77.5	Confident	78.3	Confident	35 Å²	35	104.1 Å²	104.1	25%	0.245	52%	0.518	C	S	.	.	H	α-helix	trans	-67.3	-40.6	178.2	66.4	0	0	0	0	111.6	Y69 T70 K75 Q76 E77	Y69-S73 WeakPolarHBondContact O-CB 3.43Å; Y69-S73 PolarHBondContact O-N 2.96Å; Y69-S73 PolarHBondContact O-OG 3.49Å; T70-S73 WeakPolarHBondContact CA-OG 3.44Å; T70-S73 PolarHBondContact O-N 2.79Å; T70-S73 PolarHBondContact O-OG 3Å; S73-K75 PolarHBondContact O-N 3.39Å; S73-Q76 WeakPolarHBondContact O-CB 3.36Å; S73-Q76 PolarHBondContact O-N 3.3Å; S73-E77 PolarHBondContact O-N 3.31Å
74	V	67.8	Low	77.1	Confident	83 Å²	83	104.8 Å²	104.8	50%	0.503	52%	0.519	S	S	.	.	H	α-helix	trans	-60.9	-33.2	174.1	171.4	0	0	0	0	111.7	T70 Q76 K78	T70-V74 WeakPolarHBondContact O-CB 3.22Å; T70-V74 VanDerWaalsContact O-CG2 3.22Å; T70-V74 WeakPolarHBondContact O-CG2 3.5Å; T70-V74 PolarHBondContact O-N 3.12Å; V74-Q76 VanDerWaalsContact C-N 3.33Å; V74-K78 PolarHBondContact O-N 3.25Å
75	K	64.9	Low	76.1	Confident	139 Å²	139	104.6 Å²	104.6	60%	0.604	52%	0.517	S	S	*	.	H	α-helix	trans	-67.1	-32.6	173	-75.4	-176	178.5	-171.7	0	112.9	F71 Y72 S73 I79	F71-K75 PolarHBondContact O-N 3.28Å; Y72-K75 WeakPolarHBondContact O-CB 3.04Å; Y72-K75 PolarHBondContact O-N 2.87Å; S73-K75 PolarHBondContact O-N 3.39Å; K75-I79 WeakPolarHBondContact O-CB 3.23Å; K75-I79 WeakPolarHBondContact O-CD1 3.39Å; K75-I79 VanDerWaalsContact O-CG1 3.23Å; K75-I79 WeakPolarHBondContact O-CG1 3.46Å; K75-I79 PolarHBondContact O-N 3.29Å
76	Q	57.7	Low	74.9	Confident	101 Å²	101	109.2 Å²	109.2	47%	0.472	53%	0.527	S	S	.	.	H	α-helix	trans	-68.6	-40.2	178.6	-70	-178.6	47.2	0	0	112.1	Y72 S73 V74 K78 I79 M80	Y72-Q76 PolarHBondContact O-N 3.43Å; S73-Q76 WeakPolarHBondContact O-CB 3.36Å; S73-Q76 PolarHBondContact O-N 3.3Å; V74-Q76 VanDerWaalsContact C-N 3.33Å; Q76-K78 VanDerWaalsContact C-N 3.34Å; Q76-K78 PolarHBondContact O-N 2.99Å; Q76-I79 PolarHBondContact O-N 3.34Å; Q76-M80 PolarHBondContact O-N 3.29Å
77	E	59.3	Low	73.8	Confident	140 Å²	140	106.5 Å²	106.5	65%	0.654	52%	0.52	S	S	*	.	H	α-helix	trans	-60.2	-46.8	175.2	-68.4	-178.7	169.9	0	0	110.8	S73 I79 M80 D81	S73-E77 PolarHBondContact O-N 3.31Å; E77-I79 PolarHBondContact O-N 3.02Å; E77-M80 PolarHBondContact O-N 3.05Å; E77-D81 PolarHBondContact O-N 3.02Å
78	K	62.8	Low	73	Confident	134 Å²	134	105.3 Å²	105.3	58%	0.583	52%	0.518	S	S	*	.	H	α-helix	trans	-64.4	-39	179.1	-168.7	177.4	-179.7	-165	0	113.5	V74 Q76 D81 E82	V74-K78 PolarHBondContact O-N 3.25Å; Q76-K78 VanDerWaalsContact C-N 3.34Å; Q76-K78 PolarHBondContact O-N 2.99Å; K78-D81 PolarHBondContact O-N 3.02Å; K78-E82 VanDerWaalsContact CE-OE1 3.22Å; K78-E82 WeakPolarHBondContact CE-OE1 3.26Å; K78-E82 IonicContact NZ-OE1 3.83Å; K78-E82 WeakPolarHBondContact O-CG 3.29Å; K78-E82 PolarHBondContact O-N 3.41Å
79	I	61.4	Low	72.1	Confident	93 Å²	93	108 Å²	108	48%	0.477	53%	0.526	S	S	.	.	H	α-helix	trans	-68.7	-38.1	177.9	-70.6	166.6	0	0	0	110.9	K75 Q76 E77 D81 E82 L83	K75-I79 WeakPolarHBondContact O-CB 3.23Å; K75-I79 WeakPolarHBondContact O-CD1 3.39Å; K75-I79 VanDerWaalsContact O-CG1 3.23Å; K75-I79 WeakPolarHBondContact O-CG1 3.46Å; K75-I79 PolarHBondContact O-N 3.29Å; Q76-I79 PolarHBondContact O-N 3.34Å; E77-I79 PolarHBondContact O-N 3.02Å; I79-D81 VanDerWaalsContact C-N 3.33Å; I79-E82 PolarHBondContact O-N 3Å; I79-L83 HydrophobicContact CG2-CD1 4.03Å; I79-L83 HydrophobicContact CG2-CG 4.4Å; I79-L83 VanDerWaalsContact O-CG 3.29Å; I79-L83 WeakPolarHBondContact O-CG 3.48Å; I79-L83 PolarHBondContact O-N 3.39Å
80	M	66.8	Low	71.2	Confident	106 Å²	106	103.6 Å²	103.6	52%	0.522	52%	0.522	S	S	.	.	H	α-helix	trans	-64.3	-40.7	176	-169.2	62.9	-156.1	0	0	111.2	Q76 E77 L83 D84	Q76-M80 PolarHBondContact O-N 3.29Å; E77-M80 PolarHBondContact O-N 3.05Å; M80-L83 PolarHBondContact O-N 3.43Å; M80-D84 PolarHBondContact O-N 3.43Å
81	D	67.6	Low	70.5	Confident	111 Å²	111	110 Å²	110	59%	0.594	54%	0.539	S	S	*	.	H	α-helix	trans	-62.9	-43.7	175.2	-72.5	-19.6	0	0	0	112.2	E77 K78 I79 D84 E85	E77-D81 PolarHBondContact O-N 3.02Å; K78-D81 PolarHBondContact O-N 3.02Å; I79-D81 VanDerWaalsContact C-N 3.33Å; D81-D84 PolarHBondContact O-N 3.39Å; D81-E85 WeakPolarHBondContact O-CB 3.44Å; D81-E85 PolarHBondContact O-N 2.92Å
82	E	69.9	Low	70	Confident	103 Å²	103	109.3 Å²	109.3	48%	0.481	54%	0.539	S	S	.	.	H	α-helix	trans	-62.8	-41.2	177.1	-75.2	174.5	-169.7	0	0	111.9	K78 I79 E85 E86	K78-E82 VanDerWaalsContact CE-OE1 3.22Å; K78-E82 WeakPolarHBondContact CE-OE1 3.26Å; K78-E82 IonicContact NZ-OE1 3.83Å; K78-E82 WeakPolarHBondContact O-CG 3.29Å; K78-E82 PolarHBondContact O-N 3.41Å; I79-E82 PolarHBondContact O-N 3Å; E82-E85 PolarHBondContact O-N 2.98Å; E82-E86 WeakPolarHBondContact O-CB 3.31Å; E82-E86 PolarHBondContact O-N 3.02Å
83	L	71.1	Confident	69.1	Low	92 Å²	92	105 Å²	105	48%	0.482	54%	0.537	S	S	.	.	H	α-helix	trans	-66.6	-40.7	176.9	-72.2	171.8	0	0	0	112.7	I79 M80 E85 E86 A87	I79-L83 HydrophobicContact CG2-CD1 4.03Å; I79-L83 HydrophobicContact CG2-CG 4.4Å; I79-L83 VanDerWaalsContact O-CG 3.29Å; I79-L83 WeakPolarHBondContact O-CG 3.48Å; I79-L83 PolarHBondContact O-N 3.39Å; M80-L83 PolarHBondContact O-N 3.43Å; L83-E85 VanDerWaalsContact C-N 3.32Å; L83-E86 PolarHBondContact O-N 3.42Å; L83-A87 VanDerWaalsContact O-CB 3.31Å; L83-A87 WeakPolarHBondContact O-CB 3.22Å; L83-A87 PolarHBondContact O-N 3.05Å
84	D	72.9	Confident	68.2	Low	80 Å²	80	105.6 Å²	105.6	43%	0.428	55%	0.549	S	S	.	.	H	α-helix	trans	-67.3	-35.6	177.6	-108.5	23.5	0	0	0	111.6	M80 D81 K88	M80-D84 PolarHBondContact O-N 3.43Å; D81-D84 PolarHBondContact O-N 3.39Å; D84-K88 WeakPolarHBondContact O-CB 3.49Å; D84-K88 VanDerWaalsContact O-CG 3.26Å; D84-K88 WeakPolarHBondContact O-CG 3.48Å; D84-K88 PolarHBondContact O-N 3.47Å
85	E	75.9	Confident	67.7	Low	134 Å²	134	105.7 Å²	105.7	63%	0.626	56%	0.559	S	S	*	*	H	α-helix	trans	-68.4	-45.6	175	-158.1	178.2	-165.6	0	0	111.4	D81 E82 L83 A87 K88 V89	D81-E85 WeakPolarHBondContact O-CB 3.44Å; D81-E85 PolarHBondContact O-N 2.92Å; E82-E85 PolarHBondContact O-N 2.98Å; L83-E85 VanDerWaalsContact C-N 3.32Å; E85-A87 VanDerWaalsContact C-N 3.34Å; E85-A87 PolarHBondContact O-N 3.37Å; E85-K88 WeakPolarHBondContact O-CB 3.37Å; E85-K88 PolarHBondContact O-N 3.44Å; E85-V89 WeakPolarHBondContact O-CG2 3.48Å; E85-V89 PolarHBondContact O-N 2.97Å
86	E	70.9	Confident	67.3	Low	138 Å²	138	107.6 Å²	107.6	65%	0.645	57%	0.567	S	S	*	*	H	α-helix	trans	-63.2	-39.5	176.7	-163	172.3	-158.3	0	0	111.8	E82 L83 V89 A90	E82-E86 WeakPolarHBondContact O-CB 3.31Å; E82-E86 PolarHBondContact O-N 3.02Å; L83-E86 PolarHBondContact O-N 3.42Å; E86-V89 PolarHBondContact O-N 3.49Å; E86-A90 WeakPolarHBondContact O-CB 3.33Å; E86-A90 PolarHBondContact O-N 2.83Å
87	A	73.6	Confident	67.4	Low	46 Å²	46	109 Å²	109	38%	0.38	58%	0.583	S	S	.	*	H	α-helix	trans	-65.1	-38.2	174.1	0	0	0	0	0	112.7	L83 E85 A90 R91	L83-A87 VanDerWaalsContact O-CB 3.31Å; L83-A87 WeakPolarHBondContact O-CB 3.22Å; L83-A87 PolarHBondContact O-N 3.05Å; E85-A87 VanDerWaalsContact C-N 3.34Å; E85-A87 PolarHBondContact O-N 3.37Å; A87-A90 PolarHBondContact O-N 3.33Å; A87-R91 WeakPolarHBondContact O-CB 3.37Å; A87-R91 WeakPolarHBondContact O-CG 3.47Å; A87-R91 PolarHBondContact O-N 3.19Å
88	K	75.8	Confident	67.3	Low	121 Å²	121	106 Å²	106	53%	0.526	59%	0.589	S	S	.	*	H	α-helix	trans	-64.3	-44.4	173.5	-77.7	169	-173.5	164.9	0	111.2	D84 E85 R91 M92	D84-K88 WeakPolarHBondContact O-CB 3.49Å; D84-K88 VanDerWaalsContact O-CG 3.26Å; D84-K88 WeakPolarHBondContact O-CG 3.48Å; D84-K88 PolarHBondContact O-N 3.47Å; E85-K88 WeakPolarHBondContact O-CB 3.37Å; E85-K88 PolarHBondContact O-N 3.44Å; K88-R91 PolarHBondContact O-N 3.43Å; K88-M92 HydrophobicContact CB-CE 3.95Å; K88-M92 WeakPolarHBondContact O-CG 3.37Å; K88-M92 PolarHBondContact O-N 2.96Å
89	V	76.8	Confident	66.8	Low	95 Å²	95	103.6 Å²	103.6	58%	0.576	59%	0.594	S	S	*	*	H	α-helix	trans	-63.2	-44.1	176.5	173.8	0	0	0	0	110.8	E85 E86 R91 M92 G93	E85-V89 WeakPolarHBondContact O-CG2 3.48Å; E85-V89 PolarHBondContact O-N 2.97Å; E86-V89 PolarHBondContact O-N 3.49Å; V89-R91 PolarHBondContact O-N 3.26Å; V89-M92 PolarHBondContact O-N 3.21Å; V89-G93 PolarHBondContact O-N 2.86Å
90	A	73.5	Confident	66	Low	65 Å²	65	110.5 Å²	110.5	54%	0.537	63%	0.632	S	S	.	*	H	α-helix	trans	-62.1	-40	176.8	0	0	0	0	0	112.6	E86 A87 G93 G94	E86-A90 WeakPolarHBondContact O-CB 3.33Å; E86-A90 PolarHBondContact O-N 2.83Å; A87-A90 PolarHBondContact O-N 3.33Å; A90-G93 PolarHBondContact O-N 2.94Å; A90-G94 PolarHBondContact O-N 3.41Å
91	R	72.3	Confident	66	Low	206 Å²	206	110.7 Å²	110.7	78%	0.777	64%	0.637	S	S	*	*	H	α-helix	trans	-67.5	-39.4	174.4	-75.7	-174.8	178.3	-176.3	2.8	112.7	A87 K88 V89 G93 A95	A87-R91 WeakPolarHBondContact O-CB 3.37Å; A87-R91 WeakPolarHBondContact O-CG 3.47Å; A87-R91 PolarHBondContact O-N 3.19Å; K88-R91 PolarHBondContact O-N 3.43Å; V89-R91 PolarHBondContact O-N 3.26Å; R91-G93 VanDerWaalsContact C-N 3.33Å; R91-A95 PolarHBondContact O-N 3.25Å
92	M	70	Confident	65.9	Low	132 Å²	132	110.7 Å²	110.7	65%	0.65	64%	0.64	S	S	*	*	H	α-helix	trans	-69.4	-30.9	175.7	-72.4	-173.2	-114.5	0	0	112.5	K88 V89	K88-M92 HydrophobicContact CB-CE 3.95Å; K88-M92 WeakPolarHBondContact O-CG 3.37Å; K88-M92 PolarHBondContact O-N 2.96Å; V89-M92 PolarHBondContact O-N 3.21Å
93	G	63.3	Low	65.6	Low	50 Å²	50	111.1 Å²	111.1	52%	0.515	65%	0.648	S	S	.	*	H	α-helix	trans	-75.9	-38	173.5	0	0	0	0	0	113.8	V89 A90 R91	V89-G93 PolarHBondContact O-N 2.86Å; A90-G93 PolarHBondContact O-N 2.94Å; R91-G93 VanDerWaalsContact C-N 3.33Å
94	G	58.4	Low	65.3	Low	49 Å²	49	112.2 Å²	112.2	51%	0.505	66%	0.658	S	S	.	*	H	α-helix	trans	-75.9	-18.1	-179.4	0	0	0	0	0	115	A90 K96	A90-G94 PolarHBondContact O-N 3.41Å; G94-K96 PolarHBondContact O-N 2.86Å
95	A	57.3	Low	64.8	Low	84 Å²	84	114.3 Å²	114.3	69%	0.694	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.6	-1.9	178.9	0	0	0	0	0	114.5	R91	R91-A95 PolarHBondContact O-N 3.25Å
96	K	56.9	Low	64.1	Low	180 Å²	180	112.9 Å²	112.9	78%	0.783	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.5	6.7	-174.1	-61.1	-171.4	-176.7	179.1	0	115.6	G94	G94-K96 PolarHBondContact O-N 2.86Å
97	T	58.6	Low	63.6	Low	130 Å²	130	111.1 Å²	111.1	80%	0.798	68%	0.678	S	S	*	*	S	Bend	trans	-120.2	18.4	-177.6	56.3	0	0	0	0	114.8
98	G	57.7	Low	62.8	Low	76 Å²	76	116.2 Å²	116.2	78%	0.784	70%	0.701	S	S	*	*	S	Bend	trans	-121.8	52	179.5	0	0	0	0	0	114
99	A	52.2	Low	61.8	Low	84 Å²	84	115.8 Å²	115.8	69%	0.694	72%	0.715	S	S	*	*			trans	-169.4	125.5	158	0	0	0	0	0	110.7
100	N	44.4	Very low	60.4	Low	238 Å²	238	117.6 Å²	117.6	100%	1.273	73%	0.728	S	S	*	*			trans	88.8	0	171.7	-47.3	-40.6	0	0	0	116.6

Retrieved 100 of 100 residues in 566.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).