A0A060WF73_ONCMY Loading...

Signal recognition particle 14 kDa protein

Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER). SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.

AlphaFold DB , UniProt , Accession A0A060WF73, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 110 aa.

						>A0A060WF73_ONCMY|A0A060WF73
MVLLENDSFLTELTRLFQKCRTTGSVAITLKKYDGRTKPVPRKGHPESYEPADNKCLLRASDGKKKISTVVSTKEVIKFQMAYSNLLRAHMDGLKKKDKKSKSKKTKATQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	82.9	Confident	95.2	Very high	134 Å²	134	72.1 Å²	72.1	66%	0.66	39%	0.388	S	S	*	.				0	127.3	0	174.7	175.2	-86.9	0	0	105.8	R59 K66	M1-R59 HydrophobicContact CE-CB 4.27Å; M1-R59 HydrophobicContact CE-CG 4.22Å; M1-R59 HydrophobicContact SD-CG 4.35Å; M1-K66 WeakPolarHBondContact CA-O 3.26Å; M1-K66 HydrophobicContact CB-CB 4.09Å; M1-K66 HydrophobicContact CE-CB 4.14Å; M1-K66 HydrophobicContact CE-CD 4.3Å; M1-K66 HydrophobicContact CG-CB 4.22Å
2	V	93.2	Very high	95.3	Very high	81 Å²	81	68.6 Å²	68.6	49%	0.491	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.6	128.7	-173	-174.7	0	0	0	0	109.3	L4 K66 I67 S68	V2-L4 HydrophobicContact CG1-CD2 3.61Å; V2-L4 HydrophobicContact CG1-CG 4.06Å; V2-K66 PolarHBondContact N-O 2.99Å; V2-I67 CarbonylContact O-C 3.58Å; V2-S68 PolarHBondContact O-N 3.31Å; V2-S68 PolarHBondContact O-OG 3.45Å
3	L	95.3	Very high	95.5	Very high	119 Å²	119	63.3 Å²	63.3	62%	0.623	34%	0.339	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.7	122.2	170.9	-177.7	65.1	0	0	0	108.5	S68 V70	L3-S68 WeakPolarHBondContact CA-O 3.49Å; L3-V70 HydrophobicContact CD1-CG2 4.07Å
4	L	97.1	Very high	95.6	Very high	41 Å²	41	61.2 Å²	61.2	22%	0.215	33%	0.33	C	S	.	.			trans	-120.5	154.3	-176.1	-62.4	175.9	0	0	0	110.4	V2 F9 E12 I67 S68 T69	V2-L4 HydrophobicContact CG1-CD2 3.61Å; V2-L4 HydrophobicContact CG1-CG 4.06Å; L4-F9 HydrophobicContact CB-CB 4.26Å; L4-E12 HydrophobicContact CD1-CB 4.11Å; L4-E12 HydrophobicContact CD1-CG 3.92Å; L4-I67 HydrophobicContact CD1-CB 4.1Å; L4-I67 HydrophobicContact CD1-CG2 3.99Å; L4-S68 PolarHBondContact N-O 2.74Å; L4-T69 WeakPolarHBondContact O-CB 3.27Å; L4-T69 PolarHBondContact O-OG1 2.59Å
5	E	96.5	Very high	95.6	Very high	154 Å²	154	66.9 Å²	66.9	72%	0.72	35%	0.345	S	S	*	.			trans	-62.7	158.1	164.2	-65.8	-177.1	172.9	0	0	111.2	D7 S8 F9	E5-D7 PolarHBondContact O-N 2.97Å; E5-S8 PolarHBondContact O-N 3.38Å; E5-F9 WeakPolarHBondContact O-CB 3.36Å; E5-F9 PolarHBondContact O-N 3.41Å
6	N	96.2	Very high	95.7	Very high	22 Å²	22	63 Å²	63	12%	0.118	33%	0.325	C	S	.	.	H	α-helix	trans	-58.3	-46.7	-172.1	-70.7	175.1	0	0	0	113.2	F9 L10 T69 V70 F79	N6-F9 PolarHBondContact O-N 2.74Å; N6-L10 WeakPolarHBondContact O-CG 3.5Å; N6-L10 PolarHBondContact O-N 3.48Å; N6-L10 VanDerWaalsContact O-N 3.13Å; N6-T69 PolarHBondContact ND2-OG1 3.48Å; N6-V70 PolarHBondContact ND2-O 3.25Å; N6-F79 HydrophobicContact CB-CD2 3.89Å; N6-F79 HydrophobicContact CB-CE2 4.25Å
7	D	96	Very high	95.7	Very high	91 Å²	91	60.9 Å²	60.9	49%	0.487	31%	0.313	S	S	.	.	H	α-helix	trans	-70	-38.4	-178	-68.2	-18.9	0	0	0	111.5	E5 L10 T11 K78	E5-D7 PolarHBondContact O-N 2.97Å; D7-L10 PolarHBondContact O-N 2.87Å; D7-T11 PolarHBondContact O-N 3.01Å; D7-T11 PolarHBondContact O-OG1 3.31Å; D7-K78 IonicContact OD1-NZ 3.29Å; D7-K78 IonicContact OD2-NZ 2.77Å; D7-K78 PolarHBondContact OD2-NZ 3.37Å
8	S	97.2	Very high	95.7	Very high	56 Å²	56	64.2 Å²	64.2	39%	0.392	33%	0.327	S	S	.	.	H	α-helix	trans	-64.6	-39.7	173.3	-71.3	0	0	0	0	112.2	E5 T11 E12	E5-S8 PolarHBondContact O-N 3.38Å; S8-T11 PolarHBondContact O-N 3.47Å; S8-E12 WeakPolarHBondContact O-CB 3.26Å; S8-E12 PolarHBondContact O-N 3.01Å
9	F	97.9	Very high	95.7	Very high	0 Å²	0	67.4 Å²	67.4	0%	0	34%	0.338	C	S	.	.	H	α-helix	trans	-61.7	-43.3	176.1	175.4	-91.2	0	0	0	111.8	L4 E5 N6 T11 E12 L13 L58 A60 I67 T69 F79	L4-F9 HydrophobicContact CB-CB 4.26Å; E5-F9 WeakPolarHBondContact O-CB 3.36Å; E5-F9 PolarHBondContact O-N 3.41Å; N6-F9 PolarHBondContact O-N 2.74Å; F9-T11 VanDerWaalsContact C-N 3.33Å; F9-T11 PolarHBondContact O-N 3.39Å; F9-E12 PolarHBondContact O-N 3Å; F9-L13 HydrophobicContact CE1-CD2 4.06Å; F9-L13 VanDerWaalsContact O-CB 3.24Å; F9-L13 WeakPolarHBondContact O-CB 3.49Å; F9-L13 PolarHBondContact O-N 3.4Å; F9-L58 HydrophobicContact CE1-CB 4.45Å; F9-L58 HydrophobicContact CE1-CD2 4.47Å; F9-L58 HydrophobicContact CZ-CB 4.08Å; F9-A60 HydrophobicContact CE2-CB 4.32Å; F9-A60 HydrophobicContact CZ-CB 4.15Å; F9-I67 HydrophobicContact CD2-CB 4.36Å; F9-I67 HydrophobicContact CD2-CD1 3.94Å; F9-I67 HydrophobicContact CD2-CG1 4.05Å; F9-I67 HydrophobicContact CE2-CB 4.45Å; F9-I67 HydrophobicContact CE2-CD1 3.92Å; F9-I67 HydrophobicContact CE2-CG1 3.8Å; F9-T69 HydrophobicContact CB-CG2 3.86Å; F9-T69 HydrophobicContact CD1-CG2 3.61Å; F9-T69 HydrophobicContact CD2-CG2 3.74Å; F9-T69 HydrophobicContact CE1-CG2 4.04Å; F9-T69 HydrophobicContact CE2-CG2 4.15Å; F9-T69 HydrophobicContact CG-CG2 3.44Å; F9-T69 VanDerWaalsContact CG-CG2 3.44Å; F9-T69 HydrophobicContact CZ-CG2 4.3Å; F9-F79 HydrophobicContact CD1-CE2 4.19Å; F9-F79 HydrophobicContact CD1-CZ 4.04Å; F9-F79 HydrophobicContact CE1-CZ 4.16Å
10	L	97.6	Very high	95.7	Very high	18 Å²	18	65 Å²	65	9%	0.094	33%	0.328	C	S	.	.	H	α-helix	trans	-63.5	-40.6	178	-67.5	172.1	0	0	0	111.5	N6 D7 L13 T14 F79 A82 Y83 L86	N6-L10 WeakPolarHBondContact O-CG 3.5Å; N6-L10 PolarHBondContact O-N 3.48Å; N6-L10 VanDerWaalsContact O-N 3.13Å; D7-L10 PolarHBondContact O-N 2.87Å; L10-L13 PolarHBondContact O-N 3.15Å; L10-T14 PolarHBondContact O-N 2.98Å; L10-T14 PolarHBondContact O-OG1 3.01Å; L10-F79 HydrophobicContact CD1-CD2 4.27Å; L10-F79 HydrophobicContact CD1-CE2 4.26Å; L10-F79 HydrophobicContact CD2-CE2 3.9Å; L10-F79 HydrophobicContact CD2-CZ 4.11Å; L10-F79 HydrophobicContact CG-CD2 4.46Å; L10-F79 HydrophobicContact CG-CE2 3.95Å; L10-A82 HydrophobicContact CD1-CB 3.61Å; L10-Y83 HydrophobicContact CD2-CD2 4.04Å; L10-L86 HydrophobicContact CB-CD1 4.19Å; L10-L86 HydrophobicContact CD2-CD1 4.04Å; L10-L86 VanDerWaalsContact O-CD1 3.29Å; L10-L86 WeakPolarHBondContact O-CD1 3.33Å
11	T	97.4	Very high	95.6	Very high	77 Å²	77	68.3 Å²	68.3	47%	0.472	34%	0.336	S	S	.	.	H	α-helix	trans	-65.2	-44.7	177.4	-61.3	0	0	0	0	111.7	D7 S8 F9 L13 T14 R15	D7-T11 PolarHBondContact O-N 3.01Å; D7-T11 PolarHBondContact O-OG1 3.31Å; S8-T11 PolarHBondContact O-N 3.47Å; F9-T11 VanDerWaalsContact C-N 3.33Å; F9-T11 PolarHBondContact O-N 3.39Å; T11-L13 VanDerWaalsContact C-N 3.33Å; T11-L13 PolarHBondContact O-N 3.34Å; T11-T14 WeakPolarHBondContact O-CB 3.43Å; T11-T14 PolarHBondContact O-N 2.71Å; T11-R15 PolarHBondContact O-N 3.27Å; T11-R15 VanDerWaalsContact O-N 3.15Å
12	E	96.9	Very high	96.1	Very high	30 Å²	30	68 Å²	68	14%	0.14	34%	0.342	C	S	.	.	H	α-helix	trans	-68.2	-32.7	176.8	-75.6	-63.2	141.3	0	0	112.6	L4 S8 F9 R15 L16 K65 I67	L4-E12 HydrophobicContact CD1-CB 4.11Å; L4-E12 HydrophobicContact CD1-CG 3.92Å; S8-E12 WeakPolarHBondContact O-CB 3.26Å; S8-E12 PolarHBondContact O-N 3.01Å; F9-E12 PolarHBondContact O-N 3Å; E12-R15 WeakPolarHBondContact O-CB 3.45Å; E12-R15 PolarHBondContact O-N 3.26Å; E12-R15 WeakPolarHBondContact OE1-CD 3.49Å; E12-R15 IonicContact OE1-CZ 3.49Å; E12-R15 IonicContact OE1-NE 3Å; E12-R15 IonicContact OE1-NH1 2.59Å; E12-R15 PolarHBondContact OE1-NH1 3.4Å; E12-L16 WeakPolarHBondContact O-CG 3.45Å; E12-L16 PolarHBondContact O-N 3.04Å; E12-K65 WeakPolarHBondContact OE2-CE 3.37Å; E12-K65 IonicContact OE2-NZ 2.74Å; E12-K65 PolarHBondContact OE2-NZ 2.92Å; E12-I67 HydrophobicContact CB-CD1 3.75Å; E12-I67 HydrophobicContact CB-CG2 4.35Å
13	L	97.3	Very high	96.1	Very high	0 Å²	0	69.4 Å²	69.4	0%	0	35%	0.351	C	S	.	.	H	α-helix	trans	-65.3	-42.3	173.8	-178.1	60.5	0	0	0	111.6	F9 L10 T11 R15 L16 F17 V26 I28 A60 I67 Y83 L86	F9-L13 HydrophobicContact CE1-CD2 4.06Å; F9-L13 VanDerWaalsContact O-CB 3.24Å; F9-L13 WeakPolarHBondContact O-CB 3.49Å; F9-L13 PolarHBondContact O-N 3.4Å; L10-L13 PolarHBondContact O-N 3.15Å; T11-L13 VanDerWaalsContact C-N 3.33Å; T11-L13 PolarHBondContact O-N 3.34Å; L13-R15 VanDerWaalsContact C-N 3.3Å; L13-R15 PolarHBondContact O-N 3.35Å; L13-L16 WeakPolarHBondContact O-CB 3.49Å; L13-L16 PolarHBondContact O-N 3.15Å; L13-L16 VanDerWaalsContact O-N 3.15Å; L13-F17 HydrophobicContact CD1-CD2 4.1Å; L13-F17 HydrophobicContact CD1-CE2 3.74Å; L13-F17 HydrophobicContact CD2-CE2 4.2Å; L13-F17 HydrophobicContact CG-CD2 3.99Å; L13-F17 HydrophobicContact CG-CE2 3.75Å; L13-F17 WeakPolarHBondContact O-CD2 3.49Å; L13-F17 PolarHBondContact O-N 3.42Å; L13-V26 HydrophobicContact CD1-CG1 4.42Å; L13-I28 HydrophobicContact CD1-CD1 4.02Å; L13-I28 HydrophobicContact CD1-CG1 4.42Å; L13-I28 HydrophobicContact CD2-CD1 4.37Å; L13-A60 HydrophobicContact CD1-CB 3.7Å; L13-I67 HydrophobicContact CB-CD1 4.32Å; L13-Y83 HydrophobicContact CD2-CD2 4.09Å; L13-Y83 HydrophobicContact CD2-CE2 3.72Å; L13-L86 HydrophobicContact CB-CD1 4.33Å; L13-L86 HydrophobicContact CD2-CD1 4.2Å; L13-L86 HydrophobicContact CD2-CD2 3.8Å; L13-L86 HydrophobicContact CG-CD1 4.37Å; L13-L86 HydrophobicContact CG-CD2 3.94Å
14	T	97.3	Very high	96.1	Very high	34 Å²	34	66.7 Å²	66.7	21%	0.209	35%	0.352	C	S	.	.	H	α-helix	trans	-57	-44.9	172.3	-65.7	0	0	0	0	111.4	L10 T11 L16 F17 Q18 L86	L10-T14 PolarHBondContact O-N 2.98Å; L10-T14 PolarHBondContact O-OG1 3.01Å; T11-T14 WeakPolarHBondContact O-CB 3.43Å; T11-T14 PolarHBondContact O-N 2.71Å; T14-L16 VanDerWaalsContact C-N 3.32Å; T14-L16 PolarHBondContact O-N 3.36Å; T14-F17 PolarHBondContact O-N 2.99Å; T14-Q18 HydrophobicContact CG2-CG 4.48Å; T14-Q18 WeakPolarHBondContact O-CG 3.33Å; T14-Q18 PolarHBondContact O-N 3.5Å; T14-L86 VanDerWaalsContact OG1-CD1 3.31Å; T14-L86 WeakPolarHBondContact OG1-CD1 3.38Å
15	R	96.1	Very high	96	Very high	147 Å²	147	69.3 Å²	69.3	56%	0.555	37%	0.374	S	S	*	.	H	α-helix	trans	-60.9	-39.1	176.1	-69.9	174.9	177.5	-176	-5.9	112.2	T11 E12 L13 K19	T11-R15 PolarHBondContact O-N 3.27Å; T11-R15 VanDerWaalsContact O-N 3.15Å; E12-R15 WeakPolarHBondContact O-CB 3.45Å; E12-R15 PolarHBondContact O-N 3.26Å; E12-R15 WeakPolarHBondContact OE1-CD 3.49Å; E12-R15 IonicContact OE1-CZ 3.49Å; E12-R15 IonicContact OE1-NE 3Å; E12-R15 IonicContact OE1-NH1 2.59Å; E12-R15 PolarHBondContact OE1-NH1 3.4Å; L13-R15 VanDerWaalsContact C-N 3.3Å; L13-R15 PolarHBondContact O-N 3.35Å; R15-K19 VanDerWaalsContact O-CB 3.27Å; R15-K19 WeakPolarHBondContact O-CB 3.38Å; R15-K19 PolarHBondContact O-N 2.83Å
16	L	96.3	Very high	96	Very high	4 Å²	4	63.7 Å²	63.7	2%	0.021	35%	0.35	C	S	.	.	H	α-helix	trans	-63	-45.2	175.7	-73.8	173.6	0	0	0	112	E12 L13 T14 K19 C20 V26 A60 D62 K65 I67	E12-L16 WeakPolarHBondContact O-CG 3.45Å; E12-L16 PolarHBondContact O-N 3.04Å; L13-L16 WeakPolarHBondContact O-CB 3.49Å; L13-L16 PolarHBondContact O-N 3.15Å; L13-L16 VanDerWaalsContact O-N 3.15Å; T14-L16 VanDerWaalsContact C-N 3.32Å; T14-L16 PolarHBondContact O-N 3.36Å; L16-K19 PolarHBondContact O-N 3.01Å; L16-C20 WeakPolarHBondContact O-CB 3.44Å; L16-C20 PolarHBondContact O-N 3.06Å; L16-C20 PolarHBondContact O-SG 3.21Å; L16-V26 HydrophobicContact CB-CG2 4.46Å; L16-A60 HydrophobicContact CD1-CB 4.16Å; L16-D62 HydrophobicContact CD2-CB 3.95Å; L16-K65 HydrophobicContact CD2-CB 4.27Å; L16-K65 HydrophobicContact CD2-CD 4.43Å; L16-I67 HydrophobicContact CD1-CD1 3.67Å; L16-I67 HydrophobicContact CD1-CG1 3.91Å
17	F	96.7	Very high	96	Very high	28 Å²	28	65.5 Å²	65.5	12%	0.123	37%	0.368	C	S	.	.	H	α-helix	trans	-62.7	-44.3	177.1	-83	-66.8	0	0	0	112.5	L13 T14 C20 R21 V26 I28 L86 L87 H90 M91	L13-F17 HydrophobicContact CD1-CD2 4.1Å; L13-F17 HydrophobicContact CD1-CE2 3.74Å; L13-F17 HydrophobicContact CD2-CE2 4.2Å; L13-F17 HydrophobicContact CG-CD2 3.99Å; L13-F17 HydrophobicContact CG-CE2 3.75Å; L13-F17 WeakPolarHBondContact O-CD2 3.49Å; L13-F17 PolarHBondContact O-N 3.42Å; T14-F17 PolarHBondContact O-N 2.99Å; F17-C20 PolarHBondContact O-N 3.49Å; F17-R21 PolarHBondContact O-N 3.28Å; F17-V26 HydrophobicContact CD1-CG2 4.27Å; F17-V26 HydrophobicContact CE1-CB 4.33Å; F17-I28 HydrophobicContact CE2-CD1 4.21Å; F17-I28 HydrophobicContact CZ-CD1 3.9Å; F17-L86 HydrophobicContact CD2-CD2 3.77Å; F17-L86 HydrophobicContact CE2-CD2 3.62Å; F17-L87 HydrophobicContact CE2-CD2 4.22Å; F17-L87 HydrophobicContact CZ-CD2 3.99Å; F17-H90 HydrophobicContact CB-CB 3.78Å; F17-H90 HydrophobicContact CD1-CB 3.94Å; F17-H90 HydrophobicContact CD2-CB 3.96Å; F17-H90 HydrophobicContact CG-CB 3.64Å; F17-M91 HydrophobicContact CE1-CG 4.15Å; F17-M91 HydrophobicContact CZ-CG 4.42Å
18	Q	95.3	Very high	96.1	Very high	120 Å²	120	63.8 Å²	63.8	56%	0.561	36%	0.358	S	S	*	.	H	α-helix	trans	-62.3	-44	177.3	-70.9	171.4	-8.7	0	0	111.6	T14 C20 R21	T14-Q18 HydrophobicContact CG2-CG 4.48Å; T14-Q18 WeakPolarHBondContact O-CG 3.33Å; T14-Q18 PolarHBondContact O-N 3.5Å; Q18-C20 PolarHBondContact O-N 3Å; Q18-R21 WeakPolarHBondContact O-CB 3.47Å; Q18-R21 PolarHBondContact O-N 2.87Å
19	K	95.5	Very high	96.1	Very high	124 Å²	124	64.1 Å²	64.1	54%	0.539	36%	0.357	S	S	.	.	H	α-helix	trans	-63.5	-39.1	178.4	-176.5	-174.3	174.5	-163.1	0	112.7	R15 L16 R21 D62	R15-K19 VanDerWaalsContact O-CB 3.27Å; R15-K19 WeakPolarHBondContact O-CB 3.38Å; R15-K19 PolarHBondContact O-N 2.83Å; L16-K19 PolarHBondContact O-N 3.01Å; K19-R21 VanDerWaalsContact C-N 3.31Å; K19-R21 PolarHBondContact O-N 2.82Å; K19-D62 IonicContact NZ-OD2 3.06Å; K19-D62 PolarHBondContact NZ-OD2 3.39Å
20	C	95.3	Very high	96	Very high	20 Å²	20	69.8 Å²	69.8	14%	0.135	39%	0.387	C	S	.	.	T	Hydrogen-bonded Turn	trans	-91.7	15.6	-177.4	-54.9	0	0	0	0	113.5	L16 F17 Q18 T23 V26 D62	L16-C20 WeakPolarHBondContact O-CB 3.44Å; L16-C20 PolarHBondContact O-N 3.06Å; L16-C20 PolarHBondContact O-SG 3.21Å; F17-C20 PolarHBondContact O-N 3.49Å; Q18-C20 PolarHBondContact O-N 3Å; C20-T23 CarbonylContact C-O 3.46Å; C20-T23 VanDerWaalsContact CA-O 3.26Å; C20-T23 WeakPolarHBondContact CA-O 3.48Å; C20-V26 HydrophobicContact CB-CG2 3.78Å; C20-D62 WeakPolarHBondContact SG-CB 3.31Å
21	R	94.3	Very high	95.9	Very high	135 Å²	135	75.6 Å²	75.6	51%	0.509	41%	0.412	S	S	.	.	S	Bend	trans	-70	-35.2	-172	-172.3	62.5	177.5	82.8	-6.6	113.7	F17 Q18 K19 D92	F17-R21 PolarHBondContact O-N 3.28Å; Q18-R21 WeakPolarHBondContact O-CB 3.47Å; Q18-R21 PolarHBondContact O-N 2.87Å; K19-R21 VanDerWaalsContact C-N 3.31Å; K19-R21 PolarHBondContact O-N 2.82Å; R21-D92 IonicContact CZ-OD1 3.21Å; R21-D92 IonicContact NE-OD1 3.27Å; R21-D92 PolarHBondContact NE-OD1 2.5Å; R21-D92 IonicContact NH2-OD1 3.61Å; R21-D92 PolarHBondContact NH2-OD1 2.87Å; R21-D92 IonicContact NH2-OD2 2.74Å; R21-D92 PolarHBondContact NH2-OD2 2.9Å
22	T	92.8	Very high	95.6	Very high	127 Å²	127	79.5 Å²	79.5	78%	0.779	42%	0.422	S	S	*	.	S	Bend	trans	-94.3	-39.8	-180	53	0	0	0	0	112
23	T	94	Very high	95.3	Very high	111 Å²	111	80.5 Å²	80.5	68%	0.681	43%	0.425	S	S	*	.	S	Bend	trans	-145.3	148	-177.4	61	0	0	0	0	110.4	C20	C20-T23 CarbonylContact C-O 3.46Å; C20-T23 VanDerWaalsContact CA-O 3.26Å; C20-T23 WeakPolarHBondContact CA-O 3.48Å
24	G	94.4	Very high	94.7	Very high	62 Å²	62	82.8 Å²	82.8	64%	0.639	44%	0.437	S	S	*	.			trans	101.7	-171.7	177.9	0	0	0	0	0	113.6
25	S	94.8	Very high	94	Very high	96 Å²	96	81.8 Å²	81.8	67%	0.671	43%	0.434	S	S	*	.			trans	-147.6	141.6	-178.1	-60.4	0	0	0	0	109.4	D62	S25-D62 WeakPolarHBondContact O-CA 3.46Å
26	V	96.8	Very high	93.4	Very high	36 Å²	36	79.2 Å²	79.2	22%	0.218	42%	0.424	C	S	.	.			trans	-104.6	117.8	174.7	-177.7	0	0	0	0	108.3	L13 L16 F17 C20 I28 S61	L13-V26 HydrophobicContact CD1-CG1 4.42Å; L16-V26 HydrophobicContact CB-CG2 4.46Å; F17-V26 HydrophobicContact CD1-CG2 4.27Å; F17-V26 HydrophobicContact CE1-CB 4.33Å; C20-V26 HydrophobicContact CB-CG2 3.78Å; V26-I28 HydrophobicContact CG1-CG1 4.13Å; V26-S61 WeakPolarHBondContact CA-O 3.35Å
27	A	97.2	Very high	92.8	Very high	60 Å²	60	85 Å²	85	50%	0.496	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.1	124.6	174.2	0	0	0	0	0	109.6	A60 S61	A27-A60 CarbonylContact O-C 3.51Å; A27-A60 VanDerWaalsContact O-CA 3.26Å; A27-A60 WeakPolarHBondContact O-CA 3.38Å; A27-S61 PolarHBondContact N-O 3.38Å; A27-S61 PolarHBondContact O-N 3.45Å
28	I	97.3	Very high	92.1	Very high	54 Å²	54	91.6 Å²	91.6	28%	0.277	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	133.5	175	-52.3	175.6	0	0	0	108.7	L13 F17 V26 R59 A60 L87	L13-I28 HydrophobicContact CD1-CD1 4.02Å; L13-I28 HydrophobicContact CD1-CG1 4.42Å; L13-I28 HydrophobicContact CD2-CD1 4.37Å; F17-I28 HydrophobicContact CE2-CD1 4.21Å; F17-I28 HydrophobicContact CZ-CD1 3.9Å; V26-I28 HydrophobicContact CG1-CG1 4.13Å; I28-R59 CarbonylContact C-O 3.53Å; I28-R59 VanDerWaalsContact CA-O 3.31Å; I28-R59 WeakPolarHBondContact CA-O 3.35Å; I28-A60 HydrophobicContact CG1-CB 4.17Å; I28-L87 HydrophobicContact CD1-CD2 4.07Å
29	T	97.5	Very high	91.5	Very high	63 Å²	63	91.7 Å²	91.7	39%	0.387	50%	0.499	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	142.2	176.9	66.8	0	0	0	0	110.4	L58 R59	T29-L58 CarbonylContact O-C 3.52Å; T29-L58 WeakPolarHBondContact O-CA 3.16Å; T29-R59 PolarHBondContact N-O 3.24Å; T29-R59 PolarHBondContact O-N 3.07Å; T29-R59 PolarHBondContact OG1-NE 2.97Å
30	L	95.9	Very high	90.8	Very high	120 Å²	120	89.8 Å²	89.8	63%	0.628	50%	0.498	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.9	129.5	176.2	175.6	68.4	0	0	0	108.2	C56 L58	L30-C56 HydrophobicContact CD1-CB 3.81Å; L30-L58 HydrophobicContact CD1-CD1 3.34Å; L30-L58 HydrophobicContact CD1-CD2 4.48Å; L30-L58 HydrophobicContact CD1-CG 3.61Å
31	K	94.4	Very high	90.1	Very high	140 Å²	140	91.7 Å²	91.7	61%	0.609	51%	0.51	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-139.5	145.5	176.7	-164.6	179.2	177.9	179.5	0	110.3	Y33 C56 L57	K31-Y33 PolarHBondContact O-N 2.95Å; K31-C56 CarbonylContact O-C 3.58Å; K31-C56 WeakPolarHBondContact O-CA 3.37Å; K31-L57 PolarHBondContact N-O 2.98Å; K31-L57 PolarHBondContact O-N 2.85Å
32	K	91.7	Very high	89.6	Confident	158 Å²	158	95.8 Å²	95.8	69%	0.687	53%	0.525	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-55.9	131	166.3	-173.2	177.7	-178.4	-176.5	0	108.5
33	Y	90.2	Very high	88.8	Confident	51 Å²	51	100.2 Å²	100.2	20%	0.2	53%	0.534	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	119.9	179.1	-173.2	-131.9	0	0	0	108.6	K31 G35 R36 K55 L57 V70	K31-Y33 PolarHBondContact O-N 2.95Å; Y33-G35 VanDerWaalsContact C-N 3.26Å; Y33-G35 VanDerWaalsContact CE1-CA 3.44Å; Y33-G35 VanDerWaalsContact CZ-CA 3.45Å; Y33-R36 WeakPolarHBondContact CE2-O 3.5Å; Y33-R36 PolarHBondContact OH-O 3.34Å; Y33-K55 HydrophobicContact CD1-CB 4.42Å; Y33-K55 PolarHBondContact N-O 2.93Å; Y33-L57 HydrophobicContact CD2-CB 4.38Å; Y33-L57 HydrophobicContact CG-CB 4.11Å; Y33-V70 HydrophobicContact CD1-CB 4.38Å; Y33-V70 HydrophobicContact CD1-CG1 3.73Å; Y33-V70 HydrophobicContact CD1-CG2 3.64Å; Y33-V70 HydrophobicContact CE1-CG1 4.23Å; Y33-V70 HydrophobicContact CE1-CG2 3.65Å
34	D	85.4	Confident	87.8	Confident	49 Å²	49	98.9 Å²	98.9	26%	0.262	54%	0.542	S	S	.	.			trans	-79.9	-12	177.7	50.1	12.6	0	0	0	111.9	R36 Y49 A52	D34-R36 HydrophobicContact CB-CG 4.43Å; D34-R36 WeakPolarHBondContact OD1-CB 3.26Å; D34-R36 WeakPolarHBondContact OD1-CG 3.33Å; D34-R36 PolarHBondContact OD1-N 2.72Å; D34-R36 VanDerWaalsContact OD1-N 3.15Å; D34-R36 WeakPolarHBondContact OD2-CD 3.38Å; D34-R36 IonicContact OD2-CZ 3.59Å; D34-R36 VanDerWaalsContact OD2-CZ 3.27Å; D34-R36 IonicContact OD2-NE 3.53Å; D34-R36 PolarHBondContact OD2-NE 2.84Å; D34-R36 IonicContact OD2-NH1 3.85Å; D34-R36 PolarHBondContact OD2-NH1 3.32Å; D34-Y49 VanDerWaalsContact C-OH 3.31Å; D34-Y49 HydrophobicContact CB-CE1 4.42Å; D34-Y49 WeakPolarHBondContact O-CE1 3.24Å; D34-Y49 PolarHBondContact O-OH 3.43Å; D34-A52 PolarHBondContact O-N 3.41Å
35	G	83.4	Confident	86.5	Confident	13 Å²	13	102.6 Å²	102.6	13%	0.134	54%	0.542	C	S	.	.			trans	89.9	6.7	-177.9	0	0	0	0	0	114	Y33 T37 Y49	Y33-G35 VanDerWaalsContact C-N 3.26Å; Y33-G35 VanDerWaalsContact CE1-CA 3.44Å; Y33-G35 VanDerWaalsContact CZ-CA 3.45Å; G35-T37 PolarHBondContact O-N 3.13Å; G35-Y49 WeakPolarHBondContact CA-OH 3.29Å; G35-Y49 PolarHBondContact N-OH 3.46Å; G35-Y49 PolarHBondContact O-OH 2.82Å
36	R	82.5	Confident	85	Confident	93 Å²	93	103.3 Å²	103.3	35%	0.351	55%	0.545	S	S	.	.			trans	-65.2	133.6	178.4	-68.1	178.8	178.9	148.9	-14.9	111	Y33 D34 E47 Y49	Y33-R36 WeakPolarHBondContact CE2-O 3.5Å; Y33-R36 PolarHBondContact OH-O 3.34Å; D34-R36 HydrophobicContact CB-CG 4.43Å; D34-R36 WeakPolarHBondContact OD1-CB 3.26Å; D34-R36 WeakPolarHBondContact OD1-CG 3.33Å; D34-R36 PolarHBondContact OD1-N 2.72Å; D34-R36 VanDerWaalsContact OD1-N 3.15Å; D34-R36 WeakPolarHBondContact OD2-CD 3.38Å; D34-R36 IonicContact OD2-CZ 3.59Å; D34-R36 VanDerWaalsContact OD2-CZ 3.27Å; D34-R36 IonicContact OD2-NE 3.53Å; D34-R36 PolarHBondContact OD2-NE 2.84Å; D34-R36 IonicContact OD2-NH1 3.85Å; D34-R36 PolarHBondContact OD2-NH1 3.32Å; R36-E47 IonicContact NH2-OE1 3.99Å; R36-Y49 HydrophobicContact CG-CD1 3.55Å; R36-Y49 HydrophobicContact CG-CD2 4.41Å; R36-Y49 HydrophobicContact CG-CE1 3.55Å; R36-Y49 HydrophobicContact CG-CE2 4.45Å; R36-Y49 HydrophobicContact CG-CG 4.03Å
37	T	83	Confident	83.5	Confident	125 Å²	125	107.8 Å²	107.8	77%	0.767	56%	0.563	S	S	*	*			trans	-112	-11.8	173.1	57.5	0	0	0	0	112.6	G35	G35-T37 PolarHBondContact O-N 3.13Å
38	K	82.8	Confident	81.8	Confident	167 Å²	167	110.7 Å²	110.7	73%	0.726	58%	0.58	S	S	*	*	S	Bend	trans	-123.9	154.4	178.9	-64.6	-178.6	-176.9	177.3	0	110.3
39	P	83.3	Confident	80.2	Confident	122 Å²	122	111.3 Å²	111.3	79%	0.792	58%	0.58	S	S	*	*	P	Polyproline II helix	trans	-57.8	154.4	173.2	-21.5	32.8	0	0	0	112
40	V	79.9	Confident	78.7	Confident	84 Å²	84	116.2 Å²	116.2	51%	0.509	60%	0.598	S	S	.	*	P	Polyproline II helix	trans	-62.6	128.9	172.2	-179	0	0	0	0	108.6
41	P	80.9	Confident	77.3	Confident	59 Å²	59	114.4 Å²	114.4	38%	0.383	59%	0.593	S	S	.	*	P	Polyproline II helix	trans	-57.4	152.6	178.2	-22.2	31.9	0	0	0	112.3	H45	P41-H45 HydrophobicContact CB-CB 3.79Å
42	R	82.6	Confident	75.9	Confident	221 Å²	221	109 Å²	109	83%	0.834	58%	0.575	S	S	*	*	P	Polyproline II helix	trans	-65.2	150.6	170.2	-64.5	-177.4	-169.2	167.3	3.4	109.5	G44 H45	R42-G44 PolarHBondContact O-N 3.39Å; R42-H45 PolarHBondContact O-N 3.48Å
43	K	77.2	Confident	74.9	Confident	221 Å²	221	107.6 Å²	107.6	96%	0.961	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-47.6	127	176.7	-79.4	-173.4	175.3	-176.5	0	110.3
44	G	71.8	Confident	74.6	Confident	83 Å²	83	109.8 Å²	109.8	86%	0.856	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	108.1	-9	179.9	0	0	0	0	0	115.2	R42	R42-G44 PolarHBondContact O-N 3.39Å
45	H	67.4	Low	74.9	Confident	139 Å²	139	111.4 Å²	111.4	64%	0.644	60%	0.595	S	S	*	*	S	Bend	trans	-100	141	169.4	-73.6	-73.2	0	0	0	111.3	P41 R42 E47	P41-H45 HydrophobicContact CB-CB 3.79Å; R42-H45 PolarHBondContact O-N 3.48Å; H45-E47 PolarHBondContact O-N 3.18Å
46	P	64.4	Low	75.3	Confident	112 Å²	112	112.4 Å²	112.4	73%	0.727	60%	0.6	S	S	*	*			trans	-61.6	131.9	179.1	23.2	-31	0	0	0	111	S48	P46-S48 PolarHBondContact O-N 3.39Å
47	E	65.1	Low	75.9	Confident	129 Å²	129	109.5 Å²	109.5	60%	0.603	59%	0.591	S	S	*	*			trans	-69.7	107.6	169.3	-75.7	-154.3	136.6	0	0	108.4	R36 H45 Y49	R36-E47 IonicContact NH2-OE1 3.99Å; H45-E47 PolarHBondContact O-N 3.18Å; E47-Y49 PolarHBondContact O-N 3.2Å
48	S	61.8	Low	76.6	Confident	122 Å²	122	103.9 Å²	103.9	85%	0.853	56%	0.556	S	S	*	*			trans	-87.5	14	179	83.9	0	0	0	0	113	P46	P46-S48 PolarHBondContact O-N 3.39Å
49	Y	62.3	Low	77.3	Confident	67 Å²	67	100 Å²	100	26%	0.263	54%	0.537	S	S	.	.			trans	-118.2	105.8	-164.2	-170.9	-98.4	0	0	0	112	D34 G35 R36 E47 P51 A52	D34-Y49 VanDerWaalsContact C-OH 3.31Å; D34-Y49 HydrophobicContact CB-CE1 4.42Å; D34-Y49 WeakPolarHBondContact O-CE1 3.24Å; D34-Y49 PolarHBondContact O-OH 3.43Å; G35-Y49 WeakPolarHBondContact CA-OH 3.29Å; G35-Y49 PolarHBondContact N-OH 3.46Å; G35-Y49 PolarHBondContact O-OH 2.82Å; R36-Y49 HydrophobicContact CG-CD1 3.55Å; R36-Y49 HydrophobicContact CG-CD2 4.41Å; R36-Y49 HydrophobicContact CG-CE1 3.55Å; R36-Y49 HydrophobicContact CG-CE2 4.45Å; R36-Y49 HydrophobicContact CG-CG 4.03Å; E47-Y49 PolarHBondContact O-N 3.2Å; Y49-P51 WeakPolarHBondContact O-CD 3.42Å; Y49-A52 PolarHBondContact OH-N 3.34Å
50	E	66.4	Low	78	Confident	166 Å²	166	94.3 Å²	94.3	78%	0.776	50%	0.5	S	S	*	.			trans	-72.2	120.1	166.1	-73.3	-59.9	136.3	0	0	109.5	A52	E50-A52 PolarHBondContact O-N 3.15Å; E50-A52 VanDerWaalsContact O-N 3.1Å
51	P	66.1	Low	78.8	Confident	81 Å²	81	91.4 Å²	91.4	53%	0.526	48%	0.483	S	S	.	.			trans	-55.1	117.8	175.3	-22.7	33.3	0	0	0	110.8	Y49 D53	Y49-P51 WeakPolarHBondContact O-CD 3.42Å; P51-D53 PolarHBondContact O-N 3Å; P51-D53 VanDerWaalsContact O-N 3.1Å
52	A	66.1	Low	79.5	Confident	26 Å²	26	89.9 Å²	89.9	22%	0.215	47%	0.472	C	S	.	.			trans	-67.4	114.5	172.3	0	0	0	0	0	108	D34 Y49 E50 N54 K55	D34-A52 PolarHBondContact O-N 3.41Å; Y49-A52 PolarHBondContact OH-N 3.34Å; E50-A52 PolarHBondContact O-N 3.15Å; E50-A52 VanDerWaalsContact O-N 3.1Å; A52-N54 PolarHBondContact O-N 3.21Å; A52-K55 HydrophobicContact CB-CD 4.26Å
53	D	70.4	Confident	80	Confident	129 Å²	129	82.2 Å²	82.2	69%	0.69	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.9	127.6	-174	-92.3	-28.5	0	0	0	112.2	P51	P51-D53 PolarHBondContact O-N 3Å; P51-D53 VanDerWaalsContact O-N 3.1Å
54	N	83.1	Confident	80.6	Confident	98 Å²	98	80.7 Å²	80.7	52%	0.524	46%	0.455	S	S	.	.	T	Hydrogen-bonded Turn	trans	59.2	48.1	163	-56.6	-47.4	0	0	0	117	A52 T73	A52-N54 PolarHBondContact O-N 3.21Å; N54-T73 HydrophobicContact CB-CG2 3.61Å; N54-T73 WeakPolarHBondContact O-CG2 3.31Å
55	K	91.6	Very high	81.7	Confident	82 Å²	82	81.1 Å²	81.1	36%	0.357	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.3	155.3	166.8	-60.8	-179.7	-175.2	176.6	0	111.9	Y33 A52 V70 V71	Y33-K55 HydrophobicContact CD1-CB 4.42Å; Y33-K55 PolarHBondContact N-O 2.93Å; A52-K55 HydrophobicContact CB-CD 4.26Å; K55-V70 HydrophobicContact CB-CG1 4.02Å; K55-V70 HydrophobicContact CD-CG1 3.99Å; K55-V70 HydrophobicContact CG-CG1 4.42Å; K55-V71 WeakPolarHBondContact CA-O 3.47Å
56	C	93.3	Very high	83.2	Confident	35 Å²	35	79.4 Å²	79.4	24%	0.236	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126	144.3	168.8	66.9	0	0	0	0	111.6	L30 K31 V70 V71	L30-C56 HydrophobicContact CD1-CB 3.81Å; K31-C56 CarbonylContact O-C 3.58Å; K31-C56 WeakPolarHBondContact O-CA 3.37Å; C56-V70 CarbonylContact O-C 3.58Å; C56-V70 WeakPolarHBondContact O-CA 3.42Å; C56-V71 PolarHBondContact N-O 3.37Å; C56-V71 PolarHBondContact O-N 3.4Å
57	L	95.1	Very high	84.8	Confident	31 Å²	31	74.2 Å²	74.2	16%	0.162	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.2	120.6	176.4	177.6	70.4	0	0	0	108.4	K31 Y33 R59 V70	K31-L57 PolarHBondContact N-O 2.98Å; K31-L57 PolarHBondContact O-N 2.85Å; Y33-L57 HydrophobicContact CD2-CB 4.38Å; Y33-L57 HydrophobicContact CG-CB 4.11Å; L57-R59 HydrophobicContact CD2-CG 4.26Å; L57-R59 HydrophobicContact CG-CG 4.07Å; L57-V70 HydrophobicContact CD1-CG2 3.77Å
58	L	97.2	Very high	86.3	Confident	7 Å²	7	68.5 Å²	68.5	4%	0.037	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	139.1	169.8	-76.3	82.8	0	0	0	109.5	F9 T29 L30 S68 T69 V71 F79 Y83	F9-L58 HydrophobicContact CE1-CB 4.45Å; F9-L58 HydrophobicContact CE1-CD2 4.47Å; F9-L58 HydrophobicContact CZ-CB 4.08Å; T29-L58 CarbonylContact O-C 3.52Å; T29-L58 WeakPolarHBondContact O-CA 3.16Å; L30-L58 HydrophobicContact CD1-CD1 3.34Å; L30-L58 HydrophobicContact CD1-CD2 4.48Å; L30-L58 HydrophobicContact CD1-CG 3.61Å; L58-S68 CarbonylContact O-C 3.59Å; L58-S68 WeakPolarHBondContact O-CA 3.37Å; L58-S68 WeakPolarHBondContact O-CB 3.47Å; L58-T69 HydrophobicContact CB-CG2 4.11Å; L58-T69 PolarHBondContact N-O 3.46Å; L58-T69 PolarHBondContact O-N 2.82Å; L58-V71 HydrophobicContact CD1-CB 4.48Å; L58-V71 HydrophobicContact CD1-CG2 3.85Å; L58-F79 HydrophobicContact CD1-CE1 4.4Å; L58-F79 HydrophobicContact CD2-CE1 3.65Å; L58-F79 HydrophobicContact CD2-CZ 3.88Å; L58-Y83 HydrophobicContact CD2-CE2 4.36Å
59	R	97.6	Very high	88	Confident	87 Å²	87	62.7 Å²	62.7	33%	0.328	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	136.1	175.1	-55.6	177.2	-79.1	-179.6	-3	109.5	M1 I28 T29 L57 I67	M1-R59 HydrophobicContact CE-CB 4.27Å; M1-R59 HydrophobicContact CE-CG 4.22Å; M1-R59 HydrophobicContact SD-CG 4.35Å; I28-R59 CarbonylContact C-O 3.53Å; I28-R59 VanDerWaalsContact CA-O 3.31Å; I28-R59 WeakPolarHBondContact CA-O 3.35Å; T29-R59 PolarHBondContact N-O 3.24Å; T29-R59 PolarHBondContact O-N 3.07Å; T29-R59 PolarHBondContact OG1-NE 2.97Å; L57-R59 HydrophobicContact CD2-CG 4.26Å; L57-R59 HydrophobicContact CG-CG 4.07Å; R59-I67 WeakPolarHBondContact CA-O 3.44Å
60	A	97.8	Very high	89.6	Confident	2 Å²	2	61.2 Å²	61.2	2%	0.017	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	145.2	175.2	0	0	0	0	0	111.1	F9 L13 L16 A27 I28 I67	F9-A60 HydrophobicContact CE2-CB 4.32Å; F9-A60 HydrophobicContact CZ-CB 4.15Å; L13-A60 HydrophobicContact CD1-CB 3.7Å; L16-A60 HydrophobicContact CD1-CB 4.16Å; A27-A60 CarbonylContact O-C 3.51Å; A27-A60 VanDerWaalsContact O-CA 3.26Å; A27-A60 WeakPolarHBondContact O-CA 3.38Å; I28-A60 HydrophobicContact CG1-CB 4.17Å; A60-I67 HydrophobicContact CB-CD1 4.21Å; A60-I67 HydrophobicContact CB-CG1 3.87Å; A60-I67 PolarHBondContact N-O 3.4Å; A60-I67 PolarHBondContact O-N 3.23Å
61	S	96.9	Very high	90.9	Very high	22 Å²	22	53.5 Å²	53.5	15%	0.154	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.4	138.5	-176	175.2	0	0	0	0	112.4	V26 A27 G63 K65	V26-S61 WeakPolarHBondContact CA-O 3.35Å; A27-S61 PolarHBondContact N-O 3.38Å; A27-S61 PolarHBondContact O-N 3.45Å; S61-G63 VanDerWaalsContact C-N 3.31Å; S61-G63 PolarHBondContact OG-N 2.81Å; S61-K65 VanDerWaalsContact CA-O 3.26Å; S61-K65 WeakPolarHBondContact CA-O 3.09Å
62	D	94.7	Very high	92.2	Very high	27 Å²	27	50.9 Å²	50.9	14%	0.144	27%	0.269	C	S	.	.	S	Bend	trans	-91.9	8.6	167	67.8	-4.6	0	0	0	112.8	L16 K19 C20 S25 K64 K65	L16-D62 HydrophobicContact CD2-CB 3.95Å; K19-D62 IonicContact NZ-OD2 3.06Å; K19-D62 PolarHBondContact NZ-OD2 3.39Å; C20-D62 WeakPolarHBondContact SG-CB 3.31Å; S25-D62 WeakPolarHBondContact O-CA 3.46Å; D62-K64 VanDerWaalsContact C-N 3.33Å; D62-K64 WeakPolarHBondContact OD1-CA 3.35Å; D62-K64 PolarHBondContact OD1-N 2.88Å; D62-K65 PolarHBondContact N-O 2.88Å; D62-K65 PolarHBondContact OD1-N 2.92Å
63	G	92.9	Very high	93.4	Very high	60 Å²	60	53.8 Å²	53.8	62%	0.619	29%	0.285	S	S	*	.	S	Bend	trans	95.1	-25.8	-173.4	0	0	0	0	0	113.1	S61	S61-G63 VanDerWaalsContact C-N 3.31Å; S61-G63 PolarHBondContact OG-N 2.81Å
64	K	91.5	Very high	94.4	Very high	189 Å²	189	56.9 Å²	56.9	82%	0.822	29%	0.292	S	S	*	.	S	Bend	trans	-105.9	-61.8	178.9	-60.3	179.2	-177.9	180	0	110.8	D62	D62-K64 VanDerWaalsContact C-N 3.33Å; D62-K64 WeakPolarHBondContact OD1-CA 3.35Å; D62-K64 PolarHBondContact OD1-N 2.88Å
65	K	94.6	Very high	94.8	Very high	92 Å²	92	56.9 Å²	56.9	40%	0.4	29%	0.289	S	S	.	.			trans	-87.5	131.7	178.7	-170.1	176.1	-171.9	178.7	0	109.8	E12 L16 S61 D62	E12-K65 WeakPolarHBondContact OE2-CE 3.37Å; E12-K65 IonicContact OE2-NZ 2.74Å; E12-K65 PolarHBondContact OE2-NZ 2.92Å; L16-K65 HydrophobicContact CD2-CB 4.27Å; L16-K65 HydrophobicContact CD2-CD 4.43Å; S61-K65 VanDerWaalsContact CA-O 3.26Å; S61-K65 WeakPolarHBondContact CA-O 3.09Å; D62-K65 PolarHBondContact N-O 2.88Å; D62-K65 PolarHBondContact OD1-N 2.92Å
66	K	97.4	Very high	94.9	Very high	104 Å²	104	56 Å²	56	45%	0.452	29%	0.29	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.5	116.8	-179.3	-63.8	179	-178.1	176.6	0	110.5	M1 V2	M1-K66 WeakPolarHBondContact CA-O 3.26Å; M1-K66 HydrophobicContact CB-CB 4.09Å; M1-K66 HydrophobicContact CE-CB 4.14Å; M1-K66 HydrophobicContact CE-CD 4.3Å; M1-K66 HydrophobicContact CG-CB 4.22Å; V2-K66 PolarHBondContact N-O 2.99Å
67	I	97.9	Very high	95	Very high	3 Å²	3	59.8 Å²	59.8	2%	0.015	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	153.4	175.8	61.9	174	0	0	0	110.4	V2 L4 F9 E12 L13 L16 R59 A60	V2-I67 CarbonylContact O-C 3.58Å; L4-I67 HydrophobicContact CD1-CB 4.1Å; L4-I67 HydrophobicContact CD1-CG2 3.99Å; F9-I67 HydrophobicContact CD2-CB 4.36Å; F9-I67 HydrophobicContact CD2-CD1 3.94Å; F9-I67 HydrophobicContact CD2-CG1 4.05Å; F9-I67 HydrophobicContact CE2-CB 4.45Å; F9-I67 HydrophobicContact CE2-CD1 3.92Å; F9-I67 HydrophobicContact CE2-CG1 3.8Å; E12-I67 HydrophobicContact CB-CD1 3.75Å; E12-I67 HydrophobicContact CB-CG2 4.35Å; L13-I67 HydrophobicContact CB-CD1 4.32Å; L16-I67 HydrophobicContact CD1-CD1 3.67Å; L16-I67 HydrophobicContact CD1-CG1 3.91Å; R59-I67 WeakPolarHBondContact CA-O 3.44Å; A60-I67 HydrophobicContact CB-CD1 4.21Å; A60-I67 HydrophobicContact CB-CG1 3.87Å; A60-I67 PolarHBondContact N-O 3.4Å; A60-I67 PolarHBondContact O-N 3.23Å
68	S	97.6	Very high	95	Very high	8 Å²	8	64.3 Å²	64.3	6%	0.056	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149	152.6	179.8	56.8	0	0	0	0	111.2	V2 L3 L4 L58	V2-S68 PolarHBondContact O-N 3.31Å; V2-S68 PolarHBondContact O-OG 3.45Å; L3-S68 WeakPolarHBondContact CA-O 3.49Å; L4-S68 PolarHBondContact N-O 2.74Å; L58-S68 CarbonylContact O-C 3.59Å; L58-S68 WeakPolarHBondContact O-CA 3.37Å; L58-S68 WeakPolarHBondContact O-CB 3.47Å
69	T	97.3	Very high	95	Very high	1 Å²	1	64.7 Å²	64.7	1%	0.006	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.3	151.3	173.1	-163.5	0	0	0	0	110	L4 N6 F9 L58 V71 F79	L4-T69 WeakPolarHBondContact O-CB 3.27Å; L4-T69 PolarHBondContact O-OG1 2.59Å; N6-T69 PolarHBondContact ND2-OG1 3.48Å; F9-T69 HydrophobicContact CB-CG2 3.86Å; F9-T69 HydrophobicContact CD1-CG2 3.61Å; F9-T69 HydrophobicContact CD2-CG2 3.74Å; F9-T69 HydrophobicContact CE1-CG2 4.04Å; F9-T69 HydrophobicContact CE2-CG2 4.15Å; F9-T69 HydrophobicContact CG-CG2 3.44Å; F9-T69 VanDerWaalsContact CG-CG2 3.44Å; F9-T69 HydrophobicContact CZ-CG2 4.3Å; L58-T69 HydrophobicContact CB-CG2 4.11Å; L58-T69 PolarHBondContact N-O 3.46Å; L58-T69 PolarHBondContact O-N 2.82Å; T69-V71 HydrophobicContact CG2-CG2 4.23Å; T69-F79 HydrophobicContact CG2-CE2 4.26Å; T69-F79 HydrophobicContact CG2-CZ 4.22Å
70	V	95.4	Very high	94.9	Very high	36 Å²	36	66.4 Å²	66.4	22%	0.218	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	129.3	173.6	175.2	0	0	0	0	107.7	L3 N6 Y33 K55 C56 L57	L3-V70 HydrophobicContact CD1-CG2 4.07Å; N6-V70 PolarHBondContact ND2-O 3.25Å; Y33-V70 HydrophobicContact CD1-CB 4.38Å; Y33-V70 HydrophobicContact CD1-CG1 3.73Å; Y33-V70 HydrophobicContact CD1-CG2 3.64Å; Y33-V70 HydrophobicContact CE1-CG1 4.23Å; Y33-V70 HydrophobicContact CE1-CG2 3.65Å; K55-V70 HydrophobicContact CB-CG1 4.02Å; K55-V70 HydrophobicContact CD-CG1 3.99Å; K55-V70 HydrophobicContact CG-CG1 4.42Å; C56-V70 CarbonylContact O-C 3.58Å; C56-V70 WeakPolarHBondContact O-CA 3.42Å; L57-V70 HydrophobicContact CD1-CG2 3.77Å
71	V	94.9	Very high	94.8	Very high	3 Å²	3	71.7 Å²	71.7	2%	0.018	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	127.3	177.8	-178	0	0	0	0	108.4	K55 C56 L58 T69 V76 F79	K55-V71 WeakPolarHBondContact CA-O 3.47Å; C56-V71 PolarHBondContact N-O 3.37Å; C56-V71 PolarHBondContact O-N 3.4Å; L58-V71 HydrophobicContact CD1-CB 4.48Å; L58-V71 HydrophobicContact CD1-CG2 3.85Å; T69-V71 HydrophobicContact CG2-CG2 4.23Å; V71-V76 HydrophobicContact CG1-CB 4.32Å; V71-V76 HydrophobicContact CG1-CG2 4.4Å; V71-F79 HydrophobicContact CG1-CB 4.19Å; V71-F79 HydrophobicContact CG1-CD1 4.31Å; V71-F79 HydrophobicContact CG1-CG 4.25Å; V71-F79 HydrophobicContact CG2-CD1 3.83Å; V71-F79 HydrophobicContact CG2-CD2 4.1Å; V71-F79 HydrophobicContact CG2-CE1 3.9Å; V71-F79 HydrophobicContact CG2-CE2 4.15Å; V71-F79 HydrophobicContact CG2-CG 3.92Å; V71-F79 HydrophobicContact CG2-CZ 4.05Å
72	S	93.2	Very high	94.8	Very high	26 Å²	26	72.6 Å²	72.6	18%	0.182	37%	0.373	C	S	.	.			trans	-91.6	164.4	176.4	73	0	0	0	0	111	K74 E75 V76	S72-K74 PolarHBondContact O-N 3.12Å; S72-K74 PolarHBondContact OG-N 3.5Å; S72-E75 PolarHBondContact O-N 2.85Å; S72-E75 PolarHBondContact OG-OE2 2.82Å; S72-V76 PolarHBondContact O-N 2.94Å
73	T	91.2	Very high	95	Very high	88 Å²	88	73.6 Å²	73.6	54%	0.54	38%	0.375	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.1	-29.5	173	49.4	0	0	0	0	113.2	N54 V76	N54-T73 HydrophobicContact CB-CG2 3.61Å; N54-T73 WeakPolarHBondContact O-CG2 3.31Å; T73-V76 WeakPolarHBondContact O-CG1 3.37Å
74	K	91.6	Very high	95.2	Very high	193 Å²	193	72.2 Å²	72.2	84%	0.839	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.7	-35.4	-178.1	-63.7	-177.3	178.6	-178.4	0	112.5	S72	S72-K74 PolarHBondContact O-N 3.12Å; S72-K74 PolarHBondContact OG-N 3.5Å
75	E	91.4	Very high	95.5	Very high	98 Å²	98	67.9 Å²	67.9	46%	0.458	34%	0.342	S	S	.	.	T	Hydrogen-bonded Turn	trans	-104.1	-4.1	-172.1	-64.9	151.1	156.5	0	0	112.6	S72 I77 K78 F79	S72-E75 PolarHBondContact O-N 2.85Å; S72-E75 PolarHBondContact OG-OE2 2.82Å; E75-I77 VanDerWaalsContact C-N 3.3Å; E75-I77 PolarHBondContact O-N 3.02Å; E75-K78 PolarHBondContact O-N 3.42Å; E75-F79 WeakPolarHBondContact O-CB 3.37Å; E75-F79 PolarHBondContact O-N 3.15Å
76	V	93.4	Very high	95.6	Very high	63 Å²	63	64.2 Å²	64.2	38%	0.382	33%	0.327	S	S	.	.	H	α-helix	trans	-58.6	-38.7	-172	75.4	0	0	0	0	113	V71 S72 T73 F79 Q80	V71-V76 HydrophobicContact CG1-CB 4.32Å; V71-V76 HydrophobicContact CG1-CG2 4.4Å; S72-V76 PolarHBondContact O-N 2.94Å; T73-V76 WeakPolarHBondContact O-CG1 3.37Å; V76-F79 PolarHBondContact O-N 2.82Å; V76-Q80 WeakPolarHBondContact O-CB 3.15Å; V76-Q80 PolarHBondContact O-N 3.33Å
77	I	95.1	Very high	95.6	Very high	116 Å²	116	60.8 Å²	60.8	60%	0.595	31%	0.313	S	S	*	.	H	α-helix	trans	-67.1	-48.6	-177.5	-61.8	173.4	0	0	0	110.2	E75 Q80 M81	E75-I77 VanDerWaalsContact C-N 3.3Å; E75-I77 PolarHBondContact O-N 3.02Å; I77-Q80 PolarHBondContact O-N 2.82Å; I77-M81 HydrophobicContact CG2-CE 4.27Å; I77-M81 PolarHBondContact O-N 2.85Å
78	K	95.3	Very high	95.4	Very high	126 Å²	126	69.4 Å²	69.4	55%	0.548	35%	0.345	S	S	.	.	H	α-helix	trans	-61.5	-48	176.8	-175.3	-171	175.1	-157.9	0	110.3	D7 E75 Q80 M81 A82	D7-K78 IonicContact OD1-NZ 3.29Å; D7-K78 IonicContact OD2-NZ 2.77Å; D7-K78 PolarHBondContact OD2-NZ 3.37Å; E75-K78 PolarHBondContact O-N 3.42Å; K78-Q80 PolarHBondContact O-N 3.42Å; K78-M81 PolarHBondContact O-N 3.46Å; K78-A82 PolarHBondContact O-N 2.84Å
79	F	96.4	Very high	95.4	Very high	15 Å²	15	72 Å²	72	7%	0.066	37%	0.367	C	S	.	.	H	α-helix	trans	-62	-44.6	-179.1	-173.9	-94.6	0	0	0	111.9	N6 F9 L10 L58 T69 V71 E75 V76 M81 A82 Y83	N6-F79 HydrophobicContact CB-CD2 3.89Å; N6-F79 HydrophobicContact CB-CE2 4.25Å; F9-F79 HydrophobicContact CD1-CE2 4.19Å; F9-F79 HydrophobicContact CD1-CZ 4.04Å; F9-F79 HydrophobicContact CE1-CZ 4.16Å; L10-F79 HydrophobicContact CD1-CD2 4.27Å; L10-F79 HydrophobicContact CD1-CE2 4.26Å; L10-F79 HydrophobicContact CD2-CE2 3.9Å; L10-F79 HydrophobicContact CD2-CZ 4.11Å; L10-F79 HydrophobicContact CG-CD2 4.46Å; L10-F79 HydrophobicContact CG-CE2 3.95Å; L58-F79 HydrophobicContact CD1-CE1 4.4Å; L58-F79 HydrophobicContact CD2-CE1 3.65Å; L58-F79 HydrophobicContact CD2-CZ 3.88Å; T69-F79 HydrophobicContact CG2-CE2 4.26Å; T69-F79 HydrophobicContact CG2-CZ 4.22Å; V71-F79 HydrophobicContact CG1-CB 4.19Å; V71-F79 HydrophobicContact CG1-CD1 4.31Å; V71-F79 HydrophobicContact CG1-CG 4.25Å; V71-F79 HydrophobicContact CG2-CD1 3.83Å; V71-F79 HydrophobicContact CG2-CD2 4.1Å; V71-F79 HydrophobicContact CG2-CE1 3.9Å; V71-F79 HydrophobicContact CG2-CE2 4.15Å; V71-F79 HydrophobicContact CG2-CG 3.92Å; V71-F79 HydrophobicContact CG2-CZ 4.05Å; E75-F79 WeakPolarHBondContact O-CB 3.37Å; E75-F79 PolarHBondContact O-N 3.15Å; V76-F79 PolarHBondContact O-N 2.82Å; F79-M81 PolarHBondContact O-N 3.19Å; F79-A82 PolarHBondContact O-N 3.48Å; F79-Y83 HydrophobicContact CE1-CD2 4.28Å; F79-Y83 HydrophobicContact CE1-CG 4Å; F79-Y83 HydrophobicContact CZ-CD2 4.34Å; F79-Y83 HydrophobicContact CZ-CG 4.47Å; F79-Y83 WeakPolarHBondContact O-CB 3.14Å; F79-Y83 PolarHBondContact O-N 2.98Å
80	Q	96.1	Very high	95.3	Very high	123 Å²	123	74.4 Å²	74.4	58%	0.575	38%	0.379	S	S	*	.	H	α-helix	trans	-60.2	-45.5	-179.1	-176.4	-151.9	-22.5	0	0	111.9	V76 I77 K78 Y83 S84	V76-Q80 WeakPolarHBondContact O-CB 3.15Å; V76-Q80 PolarHBondContact O-N 3.33Å; I77-Q80 PolarHBondContact O-N 2.82Å; K78-Q80 PolarHBondContact O-N 3.42Å; Q80-Y83 PolarHBondContact O-N 3.28Å; Q80-S84 WeakPolarHBondContact O-CB 3.11Å; Q80-S84 PolarHBondContact O-N 3.24Å
81	M	96.8	Very high	95.2	Very high	112 Å²	112	77.5 Å²	77.5	55%	0.552	39%	0.392	S	S	*	.	H	α-helix	trans	-61.2	-49.2	180	-70.6	-171.9	-68.4	0	0	111.2	I77 K78 F79 N85	I77-M81 HydrophobicContact CG2-CE 4.27Å; I77-M81 PolarHBondContact O-N 2.85Å; K78-M81 PolarHBondContact O-N 3.46Å; F79-M81 PolarHBondContact O-N 3.19Å; M81-N85 VanDerWaalsContact O-CG 3.3Å; M81-N85 PolarHBondContact O-N 3.25Å; M81-N85 VanDerWaalsContact O-N 3.12Å; M81-N85 PolarHBondContact O-ND2 3.49Å
82	A	97.1	Very high	95.2	Very high	42 Å²	42	81.9 Å²	81.9	35%	0.347	42%	0.415	S	S	.	.	H	α-helix	trans	-65.7	-44	179.6	0	0	0	0	0	112	L10 K78 F79 N85 L86	L10-A82 HydrophobicContact CD1-CB 3.61Å; K78-A82 PolarHBondContact O-N 2.84Å; F79-A82 PolarHBondContact O-N 3.48Å; A82-N85 PolarHBondContact O-N 2.82Å; A82-L86 WeakPolarHBondContact O-CB 3.12Å; A82-L86 PolarHBondContact O-N 2.88Å
83	Y	97.6	Very high	95.1	Very high	47 Å²	47	83.6 Å²	83.6	18%	0.184	44%	0.437	C	S	.	.	H	α-helix	trans	-63.4	-43	178.1	-178.7	-113.3	0	0	0	112.4	L10 L13 L58 F79 Q80 L86 L87	L10-Y83 HydrophobicContact CD2-CD2 4.04Å; L13-Y83 HydrophobicContact CD2-CD2 4.09Å; L13-Y83 HydrophobicContact CD2-CE2 3.72Å; L58-Y83 HydrophobicContact CD2-CE2 4.36Å; F79-Y83 HydrophobicContact CE1-CD2 4.28Å; F79-Y83 HydrophobicContact CE1-CG 4Å; F79-Y83 HydrophobicContact CZ-CD2 4.34Å; F79-Y83 HydrophobicContact CZ-CG 4.47Å; F79-Y83 WeakPolarHBondContact O-CB 3.14Å; F79-Y83 PolarHBondContact O-N 2.98Å; Q80-Y83 PolarHBondContact O-N 3.28Å; Y83-L86 PolarHBondContact O-N 2.99Å; Y83-L87 HydrophobicContact CD1-CD1 4.04Å; Y83-L87 HydrophobicContact CD1-CG 4.49Å; Y83-L87 HydrophobicContact CD2-CG 4.47Å; Y83-L87 HydrophobicContact CE1-CD1 3.45Å; Y83-L87 VanDerWaalsContact CE1-CD1 3.45Å; Y83-L87 HydrophobicContact CE1-CG 4.13Å; Y83-L87 HydrophobicContact CE2-CD1 4.27Å; Y83-L87 HydrophobicContact CE2-CD2 4.21Å; Y83-L87 HydrophobicContact CE2-CG 4.11Å; Y83-L87 WeakPolarHBondContact O-CB 3.4Å; Y83-L87 WeakPolarHBondContact O-CG 3.45Å; Y83-L87 PolarHBondContact O-N 2.92Å
84	S	97.5	Very high	95.1	Very high	32 Å²	32	86.1 Å²	86.1	22%	0.224	45%	0.447	C	S	.	.	H	α-helix	trans	-62.1	-44.2	176.8	-178.1	0	0	0	0	111.9	Q80 L87 R88	Q80-S84 WeakPolarHBondContact O-CB 3.11Å; Q80-S84 PolarHBondContact O-N 3.24Å; S84-L87 PolarHBondContact O-N 3.08Å; S84-R88 WeakPolarHBondContact O-CG 3.38Å; S84-R88 PolarHBondContact O-N 3.29Å
85	N	97.1	Very high	95.1	Very high	98 Å²	98	86.9 Å²	86.9	52%	0.524	45%	0.45	S	S	.	.	H	α-helix	trans	-64.7	-43.1	177.4	-71.5	-14.6	0	0	0	111.6	M81 A82 R88 A89	M81-N85 VanDerWaalsContact O-CG 3.3Å; M81-N85 PolarHBondContact O-N 3.25Å; M81-N85 VanDerWaalsContact O-N 3.12Å; M81-N85 PolarHBondContact O-ND2 3.49Å; A82-N85 PolarHBondContact O-N 2.82Å; N85-R88 PolarHBondContact O-N 3.47Å; N85-A89 WeakPolarHBondContact O-CB 3.35Å; N85-A89 PolarHBondContact O-N 3.15Å
86	L	97.3	Very high	95	Very high	15 Å²	15	91.4 Å²	91.4	8%	0.079	47%	0.468	C	S	.	.	H	α-helix	trans	-58.4	-49.7	175.4	-174.6	163	0	0	0	111.2	L10 L13 T14 F17 A82 Y83 R88 A89 H90	L10-L86 HydrophobicContact CB-CD1 4.19Å; L10-L86 HydrophobicContact CD2-CD1 4.04Å; L10-L86 VanDerWaalsContact O-CD1 3.29Å; L10-L86 WeakPolarHBondContact O-CD1 3.33Å; L13-L86 HydrophobicContact CB-CD1 4.33Å; L13-L86 HydrophobicContact CD2-CD1 4.2Å; L13-L86 HydrophobicContact CD2-CD2 3.8Å; L13-L86 HydrophobicContact CG-CD1 4.37Å; L13-L86 HydrophobicContact CG-CD2 3.94Å; T14-L86 VanDerWaalsContact OG1-CD1 3.31Å; T14-L86 WeakPolarHBondContact OG1-CD1 3.38Å; F17-L86 HydrophobicContact CD2-CD2 3.77Å; F17-L86 HydrophobicContact CE2-CD2 3.62Å; A82-L86 WeakPolarHBondContact O-CB 3.12Å; A82-L86 PolarHBondContact O-N 2.88Å; Y83-L86 PolarHBondContact O-N 2.99Å; L86-R88 PolarHBondContact O-N 2.89Å; L86-A89 PolarHBondContact O-N 3.47Å; L86-H90 PolarHBondContact O-CD2 2.95Å; L86-H90 VanDerWaalsContact O-CD2 3.28Å; L86-H90 PolarHBondContact O-N 3.1Å; L86-H90 VanDerWaalsContact O-N 3.07Å
87	L	96.8	Very high	94.6	Very high	32 Å²	32	98.1 Å²	98.1	17%	0.168	49%	0.492	C	S	.	.	H	α-helix	trans	-58.7	-46.7	178.8	-79.2	-171.1	0	0	0	112.2	F17 I28 Y83 S84 A89 H90 M91	F17-L87 HydrophobicContact CE2-CD2 4.22Å; F17-L87 HydrophobicContact CZ-CD2 3.99Å; I28-L87 HydrophobicContact CD1-CD2 4.07Å; Y83-L87 HydrophobicContact CD1-CD1 4.04Å; Y83-L87 HydrophobicContact CD1-CG 4.49Å; Y83-L87 HydrophobicContact CD2-CG 4.47Å; Y83-L87 HydrophobicContact CE1-CD1 3.45Å; Y83-L87 VanDerWaalsContact CE1-CD1 3.45Å; Y83-L87 HydrophobicContact CE1-CG 4.13Å; Y83-L87 HydrophobicContact CE2-CD1 4.27Å; Y83-L87 HydrophobicContact CE2-CD2 4.21Å; Y83-L87 HydrophobicContact CE2-CG 4.11Å; Y83-L87 WeakPolarHBondContact O-CB 3.4Å; Y83-L87 WeakPolarHBondContact O-CG 3.45Å; Y83-L87 PolarHBondContact O-N 2.92Å; S84-L87 PolarHBondContact O-N 3.08Å; L87-A89 VanDerWaalsContact C-N 3.32Å; L87-A89 PolarHBondContact O-N 2.86Å; L87-H90 PolarHBondContact O-N 2.91Å; L87-M91 HydrophobicContact CB-CE 3.7Å; L87-M91 HydrophobicContact CD1-CE 4.26Å; L87-M91 HydrophobicContact CD2-CE 3.9Å; L87-M91 HydrophobicContact CD2-SD 4.28Å; L87-M91 HydrophobicContact CG-CE 4.16Å; L87-M91 WeakPolarHBondContact O-CB 2.93Å; L87-M91 WeakPolarHBondContact O-CG 3.42Å; L87-M91 PolarHBondContact O-N 2.77Å
88	R	95.4	Very high	93.9	Very high	183 Å²	183	99.7 Å²	99.7	69%	0.691	50%	0.502	S	S	*	.	H	α-helix	trans	-63.7	-37.3	177.9	-72.9	174.7	-176.3	157.3	-1.1	112.6	S84 N85 L86	S84-R88 WeakPolarHBondContact O-CG 3.38Å; S84-R88 PolarHBondContact O-N 3.29Å; N85-R88 PolarHBondContact O-N 3.47Å; L86-R88 PolarHBondContact O-N 2.89Å
89	A	96.3	Very high	92.9	Very high	63 Å²	63	103.5 Å²	103.5	52%	0.521	52%	0.518	S	S	.	.	H	α-helix	trans	-70.5	-34.2	-179.5	0	0	0	0	0	112.9	N85 L86 L87	N85-A89 WeakPolarHBondContact O-CB 3.35Å; N85-A89 PolarHBondContact O-N 3.15Å; L86-A89 PolarHBondContact O-N 3.47Å; L87-A89 VanDerWaalsContact C-N 3.32Å; L87-A89 PolarHBondContact O-N 2.86Å
90	H	95.7	Very high	91.5	Very high	52 Å²	52	112.4 Å²	112.4	24%	0.241	56%	0.557	C	S	.	*	H	α-helix	trans	-104.1	-14.8	-172.2	-69.2	-60.8	0	0	0	115.6	F17 L86 L87 D92	F17-H90 HydrophobicContact CB-CB 3.78Å; F17-H90 HydrophobicContact CD1-CB 3.94Å; F17-H90 HydrophobicContact CD2-CB 3.96Å; F17-H90 HydrophobicContact CG-CB 3.64Å; L86-H90 PolarHBondContact O-CD2 2.95Å; L86-H90 VanDerWaalsContact O-CD2 3.28Å; L86-H90 PolarHBondContact O-N 3.1Å; L86-H90 VanDerWaalsContact O-N 3.07Å; L87-H90 PolarHBondContact O-N 2.91Å; H90-D92 VanDerWaalsContact C-N 3.3Å; H90-D92 PolarHBondContact O-N 3.48Å
91	M	94.1	Very high	89.7	Confident	101 Å²	101	111.5 Å²	111.5	50%	0.498	56%	0.564	S	S	.	*			trans	-96.5	48.5	173.8	-62	-170.8	-60.8	0	0	111.6	F17 L87	F17-M91 HydrophobicContact CE1-CG 4.15Å; F17-M91 HydrophobicContact CZ-CG 4.42Å; L87-M91 HydrophobicContact CB-CE 3.7Å; L87-M91 HydrophobicContact CD1-CE 4.26Å; L87-M91 HydrophobicContact CD2-CE 3.9Å; L87-M91 HydrophobicContact CD2-SD 4.28Å; L87-M91 HydrophobicContact CG-CE 4.16Å; L87-M91 WeakPolarHBondContact O-CB 2.93Å; L87-M91 WeakPolarHBondContact O-CG 3.42Å; L87-M91 PolarHBondContact O-N 2.77Å
92	D	93.8	Very high	88	Confident	94 Å²	94	116 Å²	116	50%	0.503	58%	0.581	S	S	.	*			trans	-89.4	-14.5	-174	67.3	-35.4	0	0	0	114	R21 H90 L94	R21-D92 IonicContact CZ-OD1 3.21Å; R21-D92 IonicContact NE-OD1 3.27Å; R21-D92 PolarHBondContact NE-OD1 2.5Å; R21-D92 IonicContact NH2-OD1 3.61Å; R21-D92 PolarHBondContact NH2-OD1 2.87Å; R21-D92 IonicContact NH2-OD2 2.74Å; R21-D92 PolarHBondContact NH2-OD2 2.9Å; H90-D92 VanDerWaalsContact C-N 3.3Å; H90-D92 PolarHBondContact O-N 3.48Å; D92-L94 PolarHBondContact O-N 3.29Å; D92-L94 VanDerWaalsContact O-N 3.15Å
93	G	90.8	Very high	86	Confident	63 Å²	63	118.7 Å²	118.7	65%	0.649	60%	0.597	S	S	*	*			trans	-78	12.9	-174.1	0	0	0	0	0	116.6
94	L	91.6	Very high	84	Confident	141 Å²	141	125.9 Å²	125.9	74%	0.738	63%	0.629	S	S	*	*	S	Bend	trans	-84.5	151.1	-179.2	-71.6	157.4	0	0	0	111.6	D92 K96	D92-L94 PolarHBondContact O-N 3.29Å; D92-L94 VanDerWaalsContact O-N 3.15Å; L94-K96 PolarHBondContact O-N 2.99Å
95	K	92.7	Very high	81.9	Confident	208 Å²	208	133.7 Å²	133.7	90%	0.904	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-58.9	132.2	174.1	-69.7	-174.4	178.8	-177.6	0	109.8
96	K	89	Confident	79.8	Confident	194 Å²	194	135.4 Å²	135.4	84%	0.843	67%	0.673	S	S	*	*	P	Polyproline II helix	trans	-64.4	139.4	172.2	-66	-178	-178.6	176.5	0	108.5	L94 D98	L94-K96 PolarHBondContact O-N 2.99Å; K96-D98 PolarHBondContact O-N 3.21Å
97	K	85.4	Confident	77.7	Confident	204 Å²	204	144.1 Å²	144.1	89%	0.887	71%	0.711	S	S	*	*	P	Polyproline II helix	trans	-62.5	122.5	173.4	-173.2	175	-178.1	175.9	0	108.3	K99	K97-K99 PolarHBondContact O-N 3.26Å; K97-K99 VanDerWaalsContact O-N 3.15Å
98	D	78.9	Confident	75.6	Confident	149 Å²	149	147.2 Å²	147.2	80%	0.797	74%	0.74	S	S	*	*	P	Polyproline II helix	trans	-57	122.2	172.7	-68.7	-45.4	0	0	0	108.6	K96 K100	K96-D98 PolarHBondContact O-N 3.21Å; D98-K100 VanDerWaalsContact C-N 3.28Å; D98-K100 PolarHBondContact O-N 3.34Å
99	K	73.9	Confident	73.3	Confident	205 Å²	205	145.1 Å²	145.1	89%	0.891	75%	0.748	S	S	*	*			trans	-64.5	100.1	165.7	-88.5	-178.8	176.7	173.9	0	105.4	K97 S101	K97-K99 PolarHBondContact O-N 3.26Å; K97-K99 VanDerWaalsContact O-N 3.15Å; K99-S101 PolarHBondContact O-N 3.07Å
100	K	67.1	Low	71.2	Confident	203 Å²	203	154.5 Å²	154.5	88%	0.883	78%	0.782	S	S	*	*			trans	-48.9	107.4	166.2	-154.4	177.1	-167.9	177.4	0	105.4	D98 K102	D98-K100 VanDerWaalsContact C-N 3.28Å; D98-K100 PolarHBondContact O-N 3.34Å; K100-K102 PolarHBondContact O-N 3.25Å
101	S	58.6	Low	70	Confident	104 Å²	104	159.7 Å²	159.7	73%	0.727	81%	0.809	S	S	*	*			trans	-57.4	116.9	-178.1	49.3	0	0	0	0	105.7	K99 S103	K99-S101 PolarHBondContact O-N 3.07Å; S101-S103 VanDerWaalsContact C-N 3.28Å; S101-S103 PolarHBondContact O-N 3.47Å
102	K	61.5	Low	68.7	Low	206 Å²	206	162.7 Å²	162.7	90%	0.896	83%	0.825	S	S	*	*			trans	-57.6	107.5	159.9	-95	-178.2	175	175.8	0	103.4	K100 K104	K100-K102 PolarHBondContact O-N 3.25Å; K102-K104 PolarHBondContact O-N 3.41Å; K102-K104 VanDerWaalsContact O-N 3.08Å
103	S	55.8	Low	67.3	Low	99 Å²	99	166.6 Å²	166.6	69%	0.692	84%	0.843	S	S	*	*			trans	-49.3	124.3	173	59.1	0	0	0	0	106.6	S101 K105	S101-S103 VanDerWaalsContact C-N 3.28Å; S101-S103 PolarHBondContact O-N 3.47Å; S103-K105 VanDerWaalsContact C-N 3.29Å; S103-K105 PolarHBondContact O-N 3.24Å
104	K	54.5	Low	65.9	Low	198 Å²	198	172.6 Å²	172.6	86%	0.861	85%	0.854	S	S	*	*			trans	-57.5	103.7	165.5	-85	178.9	175	176.7	0	104.8	K102 T106	K102-K104 PolarHBondContact O-N 3.41Å; K102-K104 VanDerWaalsContact O-N 3.08Å; K104-T106 PolarHBondContact O-N 3.24Å
105	K	53.9	Low	64.3	Low	195 Å²	195	174.6 Å²	174.6	85%	0.848	86%	0.861	S	S	*	*			trans	-59.8	99.3	158.1	-83.6	-173.7	175.1	-176.2	0	105	S103 K107	S103-K105 VanDerWaalsContact C-N 3.29Å; S103-K105 PolarHBondContact O-N 3.24Å; K105-K107 PolarHBondContact O-N 3.18Å
106	T	53.9	Low	62.4	Low	134 Å²	134	172.4 Å²	172.4	82%	0.822	86%	0.859	S	S	*	*			trans	-56.4	109	159.4	32	0	0	0	0	105.9	K104 A108	K104-T106 PolarHBondContact O-N 3.24Å; T106-A108 PolarHBondContact O-N 3.1Å
107	K	51.7	Low	60.5	Low	199 Å²	199	170.9 Å²	170.9	87%	0.865	86%	0.86	S	S	*	*	P	Polyproline II helix	trans	-63.2	118.1	162.9	-91.4	-176.4	171.2	-175.8	0	105.8	K105 T109	K105-K107 PolarHBondContact O-N 3.18Å; K107-T109 PolarHBondContact O-N 3.4Å
108	A	52.8	Low	58.6	Low	96 Å²	96	168.3 Å²	168.3	79%	0.793	86%	0.858	S	S	*	*	P	Polyproline II helix	trans	-67.1	124.6	163.2	0	0	0	0	0	107.7	T106	T106-A108 PolarHBondContact O-N 3.1Å
109	T	47.3	Very low	56.9	Low	140 Å²	140	169.9 Å²	169.9	86%	0.859	86%	0.863	S	S	*	*	P	Polyproline II helix	trans	-74	127.5	165.5	-59.9	0	0	0	0	107.5	K107	K107-T109 PolarHBondContact O-N 3.4Å
110	Q	52.1	Low	55.4	Low	260 Å²	260	166.7 Å²	166.7	100%	1.215	86%	0.86	S	S	*	*			trans	-91.3	0	159.8	-81.3	-172.3	14.3	0	0	108.8

Retrieved 110 of 110 residues in 618.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).