A0A060WH55_ONCMY Loading...

Translocase of outer mitochondrial membrane 6 homolog (yeast)

AlphaFold DB , UniProt , Accession A0A060WH55, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene tomm6, Length 66 aa.

						>A0A060WH55_ONCMY|A0A060WH55|tomm6
MSGAGKKAVGAPSGGVGEWISTACRFATDRNDFRRNLLVNLGLFAAGVWVARNLSDFDLMSPQPIT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.3	Very low	44.5	Very low	242 Å²	242	127.9 Å²	127.9	100%	1.192	84%	0.836	S	S	*	*				0	125.6	0	-71	137.9	80.7	0	0	108.5
2	S	43.6	Very low	45.4	Very low	135 Å²	135	126.4 Å²	126.4	94%	0.944	83%	0.826	S	S	*	*			trans	35.4	127.6	149.9	-151.3	0	0	0	0	118.9
3	G	36.4	Very low	46.5	Very low	68 Å²	68	124 Å²	124	70%	0.701	81%	0.813	S	S	*	*			cis	167.6	132	13.8	0	0	0	0	0	106
4	A	46.1	Very low	47.4	Very low	100 Å²	100	119.9 Å²	119.9	83%	0.826	80%	0.804	S	S	*	*			trans	-60.7	143.6	-175.6	0	0	0	0	0	112	K6	A4-K6 PolarHBondContact O-N 2.97Å
5	G	48.8	Very low	49.5	Very low	81 Å²	81	114.1 Å²	114.1	84%	0.835	77%	0.773	S	S	*	*			trans	-47.1	108.7	-179.4	0	0	0	0	0	113.4	K7	G5-K7 PolarHBondContact O-N 3.11Å
6	K	40.8	Very low	51.5	Low	200 Å²	200	113.8 Å²	113.8	87%	0.87	77%	0.766	S	S	*	*			trans	-83.4	98.3	156.4	-69.5	-174.1	178.8	-174.3	0	106.1	A4 A8	A4-K6 PolarHBondContact O-N 2.97Å; K6-A8 PolarHBondContact O-N 3.22Å
7	K	45.8	Very low	53.6	Low	201 Å²	201	110.2 Å²	110.2	87%	0.874	75%	0.753	S	S	*	*			trans	-48.4	112.4	157.1	-79.1	-177.9	176.6	179.3	0	105.4	G5 V9	G5-K7 PolarHBondContact O-N 3.11Å; K7-V9 PolarHBondContact O-N 3.42Å
8	A	41.6	Very low	55.3	Low	93 Å²	93	108.7 Å²	108.7	77%	0.769	73%	0.733	S	S	*	*			trans	-51.2	110.4	173	0	0	0	0	0	106.3	K6 G10	K6-A8 PolarHBondContact O-N 3.22Å; A8-G10 PolarHBondContact O-N 3.45Å
9	V	49.8	Very low	56.8	Low	144 Å²	144	113.4 Å²	113.4	87%	0.873	73%	0.734	S	S	*	*			trans	-51.9	114	161.8	169.1	0	0	0	0	103.9	K7 A11	K7-V9 PolarHBondContact O-N 3.42Å; V9-A11 PolarHBondContact O-N 3.43Å
10	G	47.8	Very low	58.2	Low	62 Å²	62	112.7 Å²	112.7	64%	0.639	72%	0.723	S	S	*	*			trans	-46.4	137.5	-172.7	0	0	0	0	0	110.4	A8	A8-G10 PolarHBondContact O-N 3.45Å
11	A	51.3	Low	59.4	Low	81 Å²	81	110.1 Å²	110.1	67%	0.669	71%	0.707	S	S	*	*			trans	-44.9	143.6	169.8	0	0	0	0	0	110.1	V9 S13	V9-A11 PolarHBondContact O-N 3.43Å; A11-S13 PolarHBondContact O-N 2.84Å
12	P	55.3	Low	61.5	Low	110 Å²	110	102.6 Å²	102.6	71%	0.714	68%	0.676	S	S	*	*			trans	-72.7	80.6	174.2	31.6	-31.2	0	0	0	107.3	G14	P12-G14 PolarHBondContact O-N 3.4Å
13	S	59.7	Low	63.2	Low	95 Å²	95	99.1 Å²	99.1	66%	0.664	66%	0.655	S	S	*	*			trans	-73.1	88.3	161.9	58	0	0	0	0	105.2	A11 G15	A11-S13 PolarHBondContact O-N 2.84Å; S13-G15 PolarHBondContact O-N 3.24Å
14	G	59.1	Low	65.2	Low	66 Å²	66	99.1 Å²	99.1	68%	0.68	64%	0.643	S	S	*	*			trans	-60.4	65.8	-178	0	0	0	0	0	113	P12	P12-G14 PolarHBondContact O-N 3.4Å
15	G	79.4	Confident	66.7	Low	33 Å²	33	103.4 Å²	103.4	34%	0.34	64%	0.638	S	S	.	*	S	Bend	trans	-115.1	164.8	-176.9	0	0	0	0	0	110.5	S13 G17 E18 W19	S13-G15 PolarHBondContact O-N 3.24Å; G15-G17 PolarHBondContact O-N 2.95Å; G15-E18 PolarHBondContact O-N 3.48Å; G15-W19 PolarHBondContact O-N 3.4Å
16	V	81.9	Confident	67.8	Low	110 Å²	110	104.2 Å²	104.2	67%	0.667	62%	0.619	S	S	*	*	H	α-helix	trans	-50.5	-32.2	-175.9	-173.2	0	0	0	0	112.6	E18 W19 I20	V16-E18 PolarHBondContact O-N 3.07Å; V16-W19 PolarHBondContact O-N 3.46Å; V16-I20 HydrophobicContact CG1-CD1 3.86Å; V16-I20 HydrophobicContact CG1-CG1 4.31Å; V16-I20 VanDerWaalsContact O-CG1 3.26Å; V16-I20 WeakPolarHBondContact O-CG1 3.44Å; V16-I20 PolarHBondContact O-N 3.49Å
17	G	86.4	Confident	69.2	Low	53 Å²	53	97 Å²	97	55%	0.546	60%	0.597	S	S	.	*	H	α-helix	trans	-64.1	-36.4	175.6	0	0	0	0	0	114.7	G15 S21	G15-G17 PolarHBondContact O-N 2.95Å; G17-S21 VanDerWaalsContact O-CB 3.3Å; G17-S21 WeakPolarHBondContact O-CB 3.29Å; G17-S21 PolarHBondContact O-N 3.48Å
18	E	83.8	Confident	70.3	Confident	83 Å²	83	92.9 Å²	92.9	39%	0.388	59%	0.589	S	S	.	*	H	α-helix	trans	-72.8	-36.2	176.6	-170.2	175.6	175.8	0	0	111	G15 V16 S21 T22	G15-E18 PolarHBondContact O-N 3.48Å; V16-E18 PolarHBondContact O-N 3.07Å; E18-S21 PolarHBondContact O-N 2.88Å; E18-T22 VanDerWaalsContact O-CB 3.29Å; E18-T22 WeakPolarHBondContact O-CB 3.39Å; E18-T22 PolarHBondContact O-N 2.83Å; E18-T22 PolarHBondContact O-OG1 2.82Å
19	W	85	Confident	71.8	Confident	197 Å²	197	91.8 Å²	91.8	75%	0.746	57%	0.569	S	S	*	*	H	α-helix	trans	-63.9	-47.5	172.5	-78.2	83.8	0	0	0	112	G15 V16 T22 A23	G15-W19 PolarHBondContact O-N 3.4Å; V16-W19 PolarHBondContact O-N 3.46Å; W19-T22 PolarHBondContact O-N 3.37Å; W19-A23 WeakPolarHBondContact O-CB 3.24Å; W19-A23 PolarHBondContact O-N 2.78Å
20	I	83.9	Confident	72.3	Confident	100 Å²	100	96.2 Å²	96.2	51%	0.513	57%	0.571	S	S	.	*	H	α-helix	trans	-61.6	-46.3	175.5	-68.1	166.4	0	0	0	109.7	V16 T22 A23 C24	V16-I20 HydrophobicContact CG1-CD1 3.86Å; V16-I20 HydrophobicContact CG1-CG1 4.31Å; V16-I20 VanDerWaalsContact O-CG1 3.26Å; V16-I20 WeakPolarHBondContact O-CG1 3.44Å; V16-I20 PolarHBondContact O-N 3.49Å; I20-T22 VanDerWaalsContact C-N 3.26Å; I20-T22 PolarHBondContact O-N 2.95Å; I20-A23 PolarHBondContact O-N 2.92Å; I20-C24 WeakPolarHBondContact O-CB 3.26Å; I20-C24 PolarHBondContact O-N 3.21Å; I20-C24 PolarHBondContact O-SG 3.02Å
21	S	83.2	Confident	73.6	Confident	58 Å²	58	96.9 Å²	96.9	41%	0.406	56%	0.56	S	S	.	*	H	α-helix	trans	-62.2	-34.3	178.1	-174	0	0	0	0	112.5	G17 E18 R25	G17-S21 VanDerWaalsContact O-CB 3.3Å; G17-S21 WeakPolarHBondContact O-CB 3.29Å; G17-S21 PolarHBondContact O-N 3.48Å; E18-S21 PolarHBondContact O-N 2.88Å; S21-R25 WeakPolarHBondContact O-CB 3.44Å; S21-R25 PolarHBondContact O-N 2.88Å
22	T	81.3	Confident	74.9	Confident	85 Å²	85	97.9 Å²	97.9	52%	0.521	55%	0.554	S	S	.	*	H	α-helix	trans	-72.5	-42.5	176.9	-59.9	0	0	0	0	111.2	E18 W19 I20 R25 F26	E18-T22 VanDerWaalsContact O-CB 3.29Å; E18-T22 WeakPolarHBondContact O-CB 3.39Å; E18-T22 PolarHBondContact O-N 2.83Å; E18-T22 PolarHBondContact O-OG1 2.82Å; W19-T22 PolarHBondContact O-N 3.37Å; I20-T22 VanDerWaalsContact C-N 3.26Å; I20-T22 PolarHBondContact O-N 2.95Å; T22-R25 PolarHBondContact O-N 3.27Å; T22-F26 VanDerWaalsContact O-CB 3.31Å; T22-F26 WeakPolarHBondContact O-CB 3.35Å; T22-F26 PolarHBondContact O-N 3.23Å
23	A	79.6	Confident	76.1	Confident	61 Å²	61	99.5 Å²	99.5	50%	0.504	55%	0.55	S	S	.	.	H	α-helix	trans	-63.3	-42.8	173.8	0	0	0	0	0	111.6	W19 I20 F26 A27	W19-A23 WeakPolarHBondContact O-CB 3.24Å; W19-A23 PolarHBondContact O-N 2.78Å; I20-A23 PolarHBondContact O-N 2.92Å; A23-F26 WeakPolarHBondContact O-CB 3.26Å; A23-F26 PolarHBondContact O-N 3.04Å; A23-A27 WeakPolarHBondContact O-CB 3.42Å; A23-A27 PolarHBondContact O-N 3.23Å
24	C	78.7	Confident	77.2	Confident	68 Å²	68	100.1 Å²	100.1	46%	0.459	54%	0.537	S	S	.	.	H	α-helix	trans	-62.7	-43.7	173.6	-72.1	0	0	0	0	111.3	I20 F26 A27 T28	I20-C24 WeakPolarHBondContact O-CB 3.26Å; I20-C24 PolarHBondContact O-N 3.21Å; I20-C24 PolarHBondContact O-SG 3.02Å; C24-F26 VanDerWaalsContact C-N 3.3Å; C24-F26 PolarHBondContact O-N 2.9Å; C24-A27 PolarHBondContact O-N 3.46Å; C24-T28 VanDerWaalsContact O-CB 3.25Å; C24-T28 WeakPolarHBondContact O-CB 3.49Å; C24-T28 PolarHBondContact O-N 3.26Å; C24-T28 PolarHBondContact O-OG1 3.42Å
25	R	77.3	Confident	78.3	Confident	191 Å²	191	103 Å²	103	72%	0.721	53%	0.528	S	S	*	.	H	α-helix	trans	-64.1	-34.3	174.3	-94.3	-177.1	169.9	149.9	-2	112.9	S21 T22 T28 D29	S21-R25 WeakPolarHBondContact O-CB 3.44Å; S21-R25 PolarHBondContact O-N 2.88Å; T22-R25 PolarHBondContact O-N 3.27Å; R25-T28 CarbonylContact O-C 3.4Å; R25-T28 PolarHBondContact O-N 2.93Å; R25-D29 VanDerWaalsContact O-CA 3.31Å; R25-D29 WeakPolarHBondContact O-CA 3.33Å; R25-D29 WeakPolarHBondContact O-CB 3.41Å; R25-D29 PolarHBondContact O-N 2.94Å
26	F	73	Confident	78.7	Confident	97 Å²	97	106 Å²	106	43%	0.425	54%	0.536	S	S	.	.	H	α-helix	trans	-69.6	-42	176.1	-175.3	-89.1	0	0	0	111.8	T22 A23 C24 T28 D29 L38	T22-F26 VanDerWaalsContact O-CB 3.31Å; T22-F26 WeakPolarHBondContact O-CB 3.35Å; T22-F26 PolarHBondContact O-N 3.23Å; A23-F26 WeakPolarHBondContact O-CB 3.26Å; A23-F26 PolarHBondContact O-N 3.04Å; C24-F26 VanDerWaalsContact C-N 3.3Å; C24-F26 PolarHBondContact O-N 2.9Å; F26-T28 VanDerWaalsContact C-N 3.31Å; F26-D29 VanDerWaalsContact O-CB 3.28Å; F26-D29 WeakPolarHBondContact O-CB 3.33Å; F26-D29 PolarHBondContact O-N 3.31Å; F26-L38 HydrophobicContact CD1-CD1 4.05Å; F26-L38 HydrophobicContact CE1-CD1 3.94Å
27	A	69.8	Low	79	Confident	50 Å²	50	105.2 Å²	105.2	41%	0.413	53%	0.528	S	S	.	.	H	α-helix	trans	-67.9	-31.9	173.8	0	0	0	0	0	112.4	A23 C24	A23-A27 WeakPolarHBondContact O-CB 3.42Å; A23-A27 PolarHBondContact O-N 3.23Å; C24-A27 PolarHBondContact O-N 3.46Å
28	T	69.1	Low	79.1	Confident	114 Å²	114	106.5 Å²	106.5	70%	0.699	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93	2.5	177.6	-40.6	0	0	0	0	112.4	C24 R25 F26 R30	C24-T28 VanDerWaalsContact O-CB 3.25Å; C24-T28 WeakPolarHBondContact O-CB 3.49Å; C24-T28 PolarHBondContact O-N 3.26Å; C24-T28 PolarHBondContact O-OG1 3.42Å; R25-T28 CarbonylContact O-C 3.4Å; R25-T28 PolarHBondContact O-N 2.93Å; F26-T28 VanDerWaalsContact C-N 3.31Å; T28-R30 PolarHBondContact O-N 3.5Å
29	D	71.3	Confident	79.3	Confident	69 Å²	69	106.6 Å²	106.6	37%	0.369	53%	0.528	S	S	.	.			trans	-61.3	132.8	-178.7	-173.1	-118.4	0	0	0	108.4	R25 F26 N31 R34	R25-D29 VanDerWaalsContact O-CA 3.31Å; R25-D29 WeakPolarHBondContact O-CA 3.33Å; R25-D29 WeakPolarHBondContact O-CB 3.41Å; R25-D29 PolarHBondContact O-N 2.94Å; F26-D29 VanDerWaalsContact O-CB 3.28Å; F26-D29 WeakPolarHBondContact O-CB 3.33Å; F26-D29 PolarHBondContact O-N 3.31Å; D29-N31 PolarHBondContact O-N 2.83Å; D29-N31 VanDerWaalsContact OD1-CB 3.29Å; D29-N31 WeakPolarHBondContact OD1-CB 3.35Å; D29-R34 IonicContact OD1-NE 3.98Å
30	R	61.5	Low	79.7	Confident	238 Å²	238	101 Å²	101	90%	0.898	51%	0.512	S	S	*	.	S	Bend	trans	-66.1	1.6	-173.5	-82.7	-168.9	178.8	-167.4	0.4	113.9	T28 D32	T28-R30 PolarHBondContact O-N 3.5Å; R30-D32 PolarHBondContact O-N 3.49Å; R30-D32 VanDerWaalsContact O-N 3.13Å
31	N	75	Confident	80.2	Confident	76 Å²	76	101.4 Å²	101.4	41%	0.406	52%	0.515	S	S	.	.			trans	-77.9	102.1	178.4	-157.8	-57.6	0	0	0	109.8	D29 F33 R34 R35	D29-N31 PolarHBondContact O-N 2.83Å; D29-N31 VanDerWaalsContact OD1-CB 3.29Å; D29-N31 WeakPolarHBondContact OD1-CB 3.35Å; N31-F33 PolarHBondContact O-N 2.91Å; N31-F33 WeakPolarHBondContact OD1-CB 3.25Å; N31-F33 PolarHBondContact OD1-N 3.31Å; N31-F33 VanDerWaalsContact OD1-N 3.16Å; N31-R34 HydrophobicContact CB-CB 4.36Å; N31-R34 HydrophobicContact CB-CG 4.11Å; N31-R34 PolarHBondContact O-N 3.38Å; N31-R35 PolarHBondContact O-N 2.91Å
32	D	78.9	Confident	80.7	Confident	102 Å²	102	100.6 Å²	100.6	55%	0.545	52%	0.516	S	S	.	.	H	α-helix	trans	-52.2	-28.2	178.2	-72.6	-56.7	0	0	0	112.3	R30 R35 N36	R30-D32 PolarHBondContact O-N 3.49Å; R30-D32 VanDerWaalsContact O-N 3.13Å; D32-R35 IonicContact OD1-CZ 3.54Å; D32-R35 IonicContact OD1-NH1 3.66Å; D32-R35 IonicContact OD1-NH2 2.75Å; D32-R35 PolarHBondContact OD1-NH2 2.92Å; D32-N36 WeakPolarHBondContact O-CB 3.36Å; D32-N36 PolarHBondContact O-N 3.42Å
33	F	80.4	Confident	81.4	Confident	143 Å²	143	102.4 Å²	102.4	63%	0.627	52%	0.522	S	S	*	.	H	α-helix	trans	-65.8	-45.5	173.5	-179.3	-98.1	0	0	0	112.8	N31 N36 L37	N31-F33 PolarHBondContact O-N 2.91Å; N31-F33 WeakPolarHBondContact OD1-CB 3.25Å; N31-F33 PolarHBondContact OD1-N 3.31Å; N31-F33 VanDerWaalsContact OD1-N 3.16Å; F33-N36 PolarHBondContact O-N 2.98Å; F33-L37 HydrophobicContact CE1-CD2 4.09Å; F33-L37 HydrophobicContact CZ-CD2 4.43Å; F33-L37 WeakPolarHBondContact O-CB 3.43Å; F33-L37 PolarHBondContact O-N 3.5Å
34	R	82.1	Confident	82.2	Confident	108 Å²	108	106.3 Å²	106.3	41%	0.408	53%	0.527	S	S	.	.	H	α-helix	trans	-68.5	-43.2	-176.4	-68.5	-179.8	-176	-112.1	-1.4	111.6	D29 N31 L37 L38	D29-R34 IonicContact OD1-NE 3.98Å; N31-R34 HydrophobicContact CB-CB 4.36Å; N31-R34 HydrophobicContact CB-CG 4.11Å; N31-R34 PolarHBondContact O-N 3.38Å; R34-L37 PolarHBondContact O-N 2.75Å; R34-L38 WeakPolarHBondContact O-CB 3.26Å; R34-L38 WeakPolarHBondContact O-CG 3.29Å; R34-L38 PolarHBondContact O-N 2.8Å
35	R	83.5	Confident	83	Confident	127 Å²	127	105.7 Å²	105.7	48%	0.479	53%	0.527	S	S	.	.	H	α-helix	trans	-64.9	-47.4	175.2	-171.7	-178.1	69.1	-129.4	-9.3	110.9	N31 D32 L37 L38 V39	N31-R35 PolarHBondContact O-N 2.91Å; D32-R35 IonicContact OD1-CZ 3.54Å; D32-R35 IonicContact OD1-NH1 3.66Å; D32-R35 IonicContact OD1-NH2 2.75Å; D32-R35 PolarHBondContact OD1-NH2 2.92Å; R35-L37 VanDerWaalsContact C-N 3.29Å; R35-L37 PolarHBondContact O-N 2.99Å; R35-L38 PolarHBondContact O-N 2.98Å; R35-V39 HydrophobicContact CG-CG2 4.41Å; R35-V39 WeakPolarHBondContact O-CB 3.38Å; R35-V39 VanDerWaalsContact O-CG2 3.25Å; R35-V39 WeakPolarHBondContact O-CG2 3.26Å; R35-V39 PolarHBondContact O-N 3.4Å
36	N	86.8	Confident	83.9	Confident	95 Å²	95	99 Å²	99	51%	0.508	51%	0.513	S	S	.	.	H	α-helix	trans	-62.3	-39	178.6	-171.3	54.7	0	0	0	111.4	D32 F33 V39 N40	D32-N36 WeakPolarHBondContact O-CB 3.36Å; D32-N36 PolarHBondContact O-N 3.42Å; F33-N36 PolarHBondContact O-N 2.98Å; N36-V39 PolarHBondContact O-N 2.9Å; N36-N40 PolarHBondContact ND2-ND2 3.47Å; N36-N40 WeakPolarHBondContact O-CB 3.25Å; N36-N40 PolarHBondContact O-N 3.37Å; N36-N40 PolarHBondContact O-ND2 3.46Å; N36-N40 PolarHBondContact OD1-ND2 3.36Å
37	L	88.4	Confident	85	Confident	95 Å²	95	96.4 Å²	96.4	50%	0.497	51%	0.513	S	S	.	.	H	α-helix	trans	-64.9	-48.2	175.7	-176.7	64.9	0	0	0	111.7	F33 R34 R35 V39 N40 L41	F33-L37 HydrophobicContact CE1-CD2 4.09Å; F33-L37 HydrophobicContact CZ-CD2 4.43Å; F33-L37 WeakPolarHBondContact O-CB 3.43Å; F33-L37 PolarHBondContact O-N 3.5Å; R34-L37 PolarHBondContact O-N 2.75Å; R35-L37 VanDerWaalsContact C-N 3.29Å; R35-L37 PolarHBondContact O-N 2.99Å; L37-V39 VanDerWaalsContact C-N 3.32Å; L37-V39 PolarHBondContact O-N 3.34Å; L37-N40 PolarHBondContact O-N 3.4Å; L37-L41 WeakPolarHBondContact O-CB 3.35Å; L37-L41 PolarHBondContact O-N 2.98Å
38	L	88.4	Confident	86.1	Confident	79 Å²	79	97.7 Å²	97.7	41%	0.414	52%	0.516	S	S	.	.	H	α-helix	trans	-58.9	-42.9	176.5	-79.3	170.4	0	0	0	111.9	F26 R34 R35 G42	F26-L38 HydrophobicContact CD1-CD1 4.05Å; F26-L38 HydrophobicContact CE1-CD1 3.94Å; R34-L38 WeakPolarHBondContact O-CB 3.26Å; R34-L38 WeakPolarHBondContact O-CG 3.29Å; R34-L38 PolarHBondContact O-N 2.8Å; R35-L38 PolarHBondContact O-N 2.98Å; L38-G42 PolarHBondContact O-N 3.29Å
39	V	89	Confident	87.3	Confident	86 Å²	86	100 Å²	100	52%	0.521	51%	0.512	S	S	.	.	H	α-helix	trans	-67.4	-49.5	179.3	170.9	0	0	0	0	111.3	R35 N36 L37 L41 G42 L43	R35-V39 HydrophobicContact CG-CG2 4.41Å; R35-V39 WeakPolarHBondContact O-CB 3.38Å; R35-V39 VanDerWaalsContact O-CG2 3.25Å; R35-V39 WeakPolarHBondContact O-CG2 3.26Å; R35-V39 PolarHBondContact O-N 3.4Å; N36-V39 PolarHBondContact O-N 2.9Å; L37-V39 VanDerWaalsContact C-N 3.32Å; L37-V39 PolarHBondContact O-N 3.34Å; V39-L41 VanDerWaalsContact C-N 3.31Å; V39-L41 PolarHBondContact O-N 2.66Å; V39-G42 PolarHBondContact O-N 2.77Å; V39-L43 VanDerWaalsContact O-CB 3.26Å; V39-L43 WeakPolarHBondContact O-CB 3.35Å; V39-L43 PolarHBondContact O-N 3.49Å
40	N	92.1	Very high	88.3	Confident	79 Å²	79	99.9 Å²	99.9	42%	0.422	51%	0.514	S	S	.	.	H	α-helix	trans	-63.3	-39.4	179.5	-75.6	-58	0	0	0	111.7	N36 L37 F44	N36-N40 PolarHBondContact ND2-ND2 3.47Å; N36-N40 WeakPolarHBondContact O-CB 3.25Å; N36-N40 PolarHBondContact O-N 3.37Å; N36-N40 PolarHBondContact O-ND2 3.46Å; N36-N40 PolarHBondContact OD1-ND2 3.36Å; L37-N40 PolarHBondContact O-N 3.4Å; N40-F44 VanDerWaalsContact O-CB 3.29Å; N40-F44 WeakPolarHBondContact O-CB 3Å; N40-F44 PolarHBondContact O-N 2.8Å
41	L	94.8	Very high	89.7	Confident	109 Å²	109	91.1 Å²	91.1	57%	0.571	49%	0.492	S	S	*	.	H	α-helix	trans	-67.1	-43.7	177	-175	62.9	0	0	0	111.8	L37 V39 F44 A45	L37-L41 WeakPolarHBondContact O-CB 3.35Å; L37-L41 PolarHBondContact O-N 2.98Å; V39-L41 VanDerWaalsContact C-N 3.31Å; V39-L41 PolarHBondContact O-N 2.66Å; L41-F44 PolarHBondContact O-N 2.9Å; L41-A45 PolarHBondContact O-N 3.31Å
42	G	94.8	Very high	90.2	Very high	41 Å²	41	96.9 Å²	96.9	42%	0.423	51%	0.508	S	S	.	.	H	α-helix	trans	-63.2	-43.7	175.7	0	0	0	0	0	112.3	L38 V39 F44 A45 A46	L38-G42 PolarHBondContact O-N 3.29Å; V39-G42 PolarHBondContact O-N 2.77Å; G42-F44 VanDerWaalsContact C-N 3.34Å; G42-F44 PolarHBondContact O-N 3.22Å; G42-A45 PolarHBondContact O-N 2.9Å; G42-A46 WeakPolarHBondContact O-CB 3.44Å; G42-A46 PolarHBondContact O-N 3.45Å
43	L	95.8	Very high	90.5	Very high	123 Å²	123	95.3 Å²	95.3	64%	0.644	50%	0.5	S	S	*	.	H	α-helix	trans	-63.1	-41.5	176.8	-175.5	64.1	0	0	0	111.5	V39 G47	V39-L43 VanDerWaalsContact O-CB 3.26Å; V39-L43 WeakPolarHBondContact O-CB 3.35Å; V39-L43 PolarHBondContact O-N 3.49Å; L43-G47 PolarHBondContact O-N 2.84Å
44	F	95.8	Very high	90.4	Very high	142 Å²	142	94 Å²	94	62%	0.623	50%	0.499	S	S	*	.	H	α-helix	trans	-61.6	-50.4	175.2	176.7	-103.8	0	0	0	111.7	N40 L41 G42 A46 G47 V48	N40-F44 VanDerWaalsContact O-CB 3.29Å; N40-F44 WeakPolarHBondContact O-CB 3Å; N40-F44 PolarHBondContact O-N 2.8Å; L41-F44 PolarHBondContact O-N 2.9Å; G42-F44 VanDerWaalsContact C-N 3.34Å; G42-F44 PolarHBondContact O-N 3.22Å; F44-A46 PolarHBondContact O-N 3.45Å; F44-G47 PolarHBondContact O-N 3.37Å; F44-V48 HydrophobicContact CD2-CG2 4.48Å; F44-V48 HydrophobicContact CE1-CG2 4.12Å; F44-V48 HydrophobicContact CE2-CG2 4.09Å; F44-V48 HydrophobicContact CZ-CG2 3.89Å; F44-V48 WeakPolarHBondContact O-CG2 3.47Å; F44-V48 PolarHBondContact O-N 2.87Å
45	A	96	Very high	89.9	Confident	55 Å²	55	92.6 Å²	92.6	46%	0.455	51%	0.506	S	S	.	.	H	α-helix	trans	-62.7	-42.2	179.8	0	0	0	0	0	112.3	L41 G42 V48 W49	L41-A45 PolarHBondContact O-N 3.31Å; G42-A45 PolarHBondContact O-N 2.9Å; A45-V48 PolarHBondContact O-N 3.45Å; A45-W49 WeakPolarHBondContact O-CB 3.43Å; A45-W49 PolarHBondContact O-N 3.24Å
46	A	96.1	Very high	89.1	Confident	52 Å²	52	91.5 Å²	91.5	43%	0.43	51%	0.509	S	S	.	.	H	α-helix	trans	-62.1	-43.9	174.7	0	0	0	0	0	111.4	G42 F44 W49 V50	G42-A46 WeakPolarHBondContact O-CB 3.44Å; G42-A46 PolarHBondContact O-N 3.45Å; F44-A46 PolarHBondContact O-N 3.45Å; A46-W49 PolarHBondContact O-N 2.81Å; A46-V50 WeakPolarHBondContact O-CB 3.3Å; A46-V50 VanDerWaalsContact O-CG2 3.26Å; A46-V50 WeakPolarHBondContact O-CG2 3.45Å; A46-V50 PolarHBondContact O-N 3.31Å
47	G	95.4	Very high	87.8	Confident	41 Å²	41	95.3 Å²	95.3	42%	0.423	52%	0.521	S	S	.	.	H	α-helix	trans	-60.6	-45	176.3	0	0	0	0	0	112.8	L43 F44 W49 V50 A51	L43-G47 PolarHBondContact O-N 2.84Å; F44-G47 PolarHBondContact O-N 3.37Å; G47-W49 VanDerWaalsContact C-N 3.35Å; G47-W49 PolarHBondContact O-N 3.29Å; G47-V50 PolarHBondContact O-N 3.23Å; G47-A51 WeakPolarHBondContact O-CB 3.29Å; G47-A51 PolarHBondContact O-N 3.44Å
48	V	93.9	Very high	86.5	Confident	78 Å²	78	97.1 Å²	97.1	47%	0.473	53%	0.532	S	S	.	.	H	α-helix	trans	-62.4	-42.7	175.2	172.8	0	0	0	0	111.1	F44 A45 R52	F44-V48 HydrophobicContact CD2-CG2 4.48Å; F44-V48 HydrophobicContact CE1-CG2 4.12Å; F44-V48 HydrophobicContact CE2-CG2 4.09Å; F44-V48 HydrophobicContact CZ-CG2 3.89Å; F44-V48 WeakPolarHBondContact O-CG2 3.47Å; F44-V48 PolarHBondContact O-N 2.87Å; A45-V48 PolarHBondContact O-N 3.45Å; V48-R52 WeakPolarHBondContact O-CB 3.38Å; V48-R52 PolarHBondContact O-N 2.81Å
49	W	93.2	Very high	84.9	Confident	161 Å²	161	100.6 Å²	100.6	61%	0.61	55%	0.55	S	S	*	.	H	α-helix	trans	-63.5	-47.8	177	-177.6	89.7	0	0	0	111.5	A45 A46 G47 A51 R52 N53	A45-W49 WeakPolarHBondContact O-CB 3.43Å; A45-W49 PolarHBondContact O-N 3.24Å; A46-W49 PolarHBondContact O-N 2.81Å; G47-W49 VanDerWaalsContact C-N 3.35Å; G47-W49 PolarHBondContact O-N 3.29Å; W49-A51 PolarHBondContact O-N 2.9Å; W49-R52 PolarHBondContact O-N 3.42Å; W49-N53 VanDerWaalsContact CD2-ND2 3.25Å; W49-N53 WeakPolarHBondContact CZ2-ND2 3.18Å; W49-N53 PolarHBondContact NE1-ND2 2.87Å; W49-N53 PolarHBondContact O-N 2.93Å; W49-N53 PolarHBondContact O-ND2 2.91Å
50	V	92.4	Very high	83.6	Confident	68 Å²	68	103.2 Å²	103.2	41%	0.412	56%	0.558	S	S	.	*	H	α-helix	trans	-59.3	-47.9	177.6	168.5	0	0	0	0	110.3	A46 G47 R52 N53 L54	A46-V50 WeakPolarHBondContact O-CB 3.3Å; A46-V50 VanDerWaalsContact O-CG2 3.26Å; A46-V50 WeakPolarHBondContact O-CG2 3.45Å; A46-V50 PolarHBondContact O-N 3.31Å; G47-V50 PolarHBondContact O-N 3.23Å; V50-R52 VanDerWaalsContact C-N 3.31Å; V50-R52 PolarHBondContact O-N 3.26Å; V50-N53 PolarHBondContact O-N 2.86Å; V50-L54 HydrophobicContact CG1-CD1 3.45Å; V50-L54 VanDerWaalsContact CG1-CD1 3.45Å; V50-L54 WeakPolarHBondContact O-CB 3.39Å; V50-L54 VanDerWaalsContact O-CD1 3.26Å; V50-L54 WeakPolarHBondContact O-CD1 3.28Å; V50-L54 PolarHBondContact O-N 2.63Å
51	A	90.3	Very high	82.2	Confident	54 Å²	54	103.6 Å²	103.6	45%	0.446	57%	0.567	S	S	.	*	H	α-helix	trans	-58.8	-42.9	177.1	0	0	0	0	0	111.8	G47 W49 S55	G47-A51 WeakPolarHBondContact O-CB 3.29Å; G47-A51 PolarHBondContact O-N 3.44Å; W49-A51 PolarHBondContact O-N 2.9Å; A51-S55 WeakPolarHBondContact O-CB 3.29Å; A51-S55 PolarHBondContact O-N 3.01Å; A51-S55 PolarHBondContact O-OG 2.89Å
52	R	87	Confident	80.7	Confident	197 Å²	197	103.7 Å²	103.7	74%	0.743	57%	0.574	S	S	*	*	H	α-helix	trans	-64.5	-43.5	177.9	-170.7	178.6	-176	147.3	2.2	112.5	V48 W49 V50 D56	V48-R52 WeakPolarHBondContact O-CB 3.38Å; V48-R52 PolarHBondContact O-N 2.81Å; W49-R52 PolarHBondContact O-N 3.42Å; V50-R52 VanDerWaalsContact C-N 3.31Å; V50-R52 PolarHBondContact O-N 3.26Å; R52-D56 WeakPolarHBondContact O-CB 3.31Å; R52-D56 PolarHBondContact O-N 2.86Å
53	N	83.6	Confident	79.4	Confident	69 Å²	69	110.1 Å²	110.1	37%	0.369	59%	0.593	S	S	.	*	H	α-helix	trans	-73.1	-35.2	179.9	-74.6	-99.1	0	0	0	111.9	W49 V50 D56 F57	W49-N53 VanDerWaalsContact CD2-ND2 3.25Å; W49-N53 WeakPolarHBondContact CZ2-ND2 3.18Å; W49-N53 PolarHBondContact NE1-ND2 2.87Å; W49-N53 PolarHBondContact O-N 2.93Å; W49-N53 PolarHBondContact O-ND2 2.91Å; V50-N53 PolarHBondContact O-N 2.86Å; N53-D56 PolarHBondContact O-N 2.74Å; N53-F57 PolarHBondContact O-N 2.89Å
54	L	78.4	Confident	78.1	Confident	115 Å²	115	109.8 Å²	109.8	60%	0.602	60%	0.598	S	S	*	*	H	α-helix	trans	-66.8	-43.8	172	-96.7	96.8	0	0	0	111.8	V50 D56 F57 D58	V50-L54 HydrophobicContact CG1-CD1 3.45Å; V50-L54 VanDerWaalsContact CG1-CD1 3.45Å; V50-L54 WeakPolarHBondContact O-CB 3.39Å; V50-L54 VanDerWaalsContact O-CD1 3.26Å; V50-L54 WeakPolarHBondContact O-CD1 3.28Å; V50-L54 PolarHBondContact O-N 2.63Å; L54-D56 VanDerWaalsContact C-N 3.26Å; L54-D56 PolarHBondContact O-N 3.39Å; L54-F57 PolarHBondContact O-N 3.13Å; L54-D58 VanDerWaalsContact O-CB 3.24Å; L54-D58 WeakPolarHBondContact O-CB 3.14Å; L54-D58 PolarHBondContact O-N 2.9Å
55	S	72.9	Confident	76.6	Confident	79 Å²	79	111.4 Å²	111.4	55%	0.552	61%	0.612	S	S	*	*	H	α-helix	trans	-61.8	-36.6	175.8	-66.3	0	0	0	0	111.9	A51 D58 L59	A51-S55 WeakPolarHBondContact O-CB 3.29Å; A51-S55 PolarHBondContact O-N 3.01Å; A51-S55 PolarHBondContact O-OG 2.89Å; S55-D58 PolarHBondContact O-N 2.94Å; S55-L59 VanDerWaalsContact O-CB 3.29Å; S55-L59 WeakPolarHBondContact O-CB 3.14Å; S55-L59 PolarHBondContact O-N 2.89Å
56	D	67.3	Low	75.2	Confident	104 Å²	104	118.2 Å²	118.2	56%	0.556	65%	0.648	S	S	*	*	H	α-helix	trans	-66.3	-40.1	175.7	-162.1	71.7	0	0	0	112	R52 N53 L54	R52-D56 WeakPolarHBondContact O-CB 3.31Å; R52-D56 PolarHBondContact O-N 2.86Å; N53-D56 PolarHBondContact O-N 2.74Å; L54-D56 VanDerWaalsContact C-N 3.26Å; L54-D56 PolarHBondContact O-N 3.39Å
57	F	59.3	Low	74.2	Confident	174 Å²	174	121.6 Å²	121.6	76%	0.763	66%	0.659	S	S	*	*	H	α-helix	trans	-69.4	-37.5	175.5	-141.5	-87.1	0	0	0	112.6	N53 L54 M60	N53-F57 PolarHBondContact O-N 2.89Å; L54-F57 PolarHBondContact O-N 3.13Å; F57-M60 PolarHBondContact O-N 3.16Å
58	D	59.5	Low	73	Confident	133 Å²	133	125.8 Å²	125.8	71%	0.711	67%	0.671	S	S	*	*	H	α-helix	trans	-76.2	-25.1	-179.9	-163.1	43.1	0	0	0	112.3	L54 S55 M60 S61	L54-D58 VanDerWaalsContact O-CB 3.24Å; L54-D58 WeakPolarHBondContact O-CB 3.14Å; L54-D58 PolarHBondContact O-N 2.9Å; S55-D58 PolarHBondContact O-N 2.94Å; D58-M60 VanDerWaalsContact C-N 3.3Å; D58-M60 PolarHBondContact O-N 3.01Å; D58-S61 PolarHBondContact O-N 3.42Å
59	L	56	Low	71.9	Confident	152 Å²	152	128.4 Å²	128.4	80%	0.796	68%	0.682	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.5	-7.9	173.5	-145.4	81.7	0	0	0	113.6	S55 S61	S55-L59 VanDerWaalsContact O-CB 3.29Å; S55-L59 WeakPolarHBondContact O-CB 3.14Å; S55-L59 PolarHBondContact O-N 2.89Å; L59-S61 PolarHBondContact O-N 2.75Å
60	M	60.6	Low	70.6	Confident	142 Å²	142	126.5 Å²	126.5	70%	0.7	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.9	8.8	168.9	-69.1	-169.8	-178.9	0	0	113	F57 D58 P62	F57-M60 PolarHBondContact O-N 3.16Å; D58-M60 VanDerWaalsContact C-N 3.3Å; D58-M60 PolarHBondContact O-N 3.01Å; M60-P62 WeakPolarHBondContact O-CD 3.31Å
61	S	63	Low	69.3	Low	87 Å²	87	130.2 Å²	130.2	61%	0.608	70%	0.704	S	S	*	*	S	Bend	trans	-51.5	117.2	162.9	171.5	0	0	0	0	108.1	D58 L59 Q63	D58-S61 PolarHBondContact O-N 3.42Å; L59-S61 PolarHBondContact O-N 2.75Å; S61-Q63 PolarHBondContact O-N 2.99Å
62	P	63.9	Low	67.9	Low	111 Å²	111	135.3 Å²	135.3	72%	0.721	72%	0.721	S	S	*	*	P	Polyproline II helix	trans	-53.8	131.9	-178	20.2	-30.3	0	0	0	108.7	M60	M60-P62 WeakPolarHBondContact O-CD 3.31Å
63	Q	67.9	Low	66.5	Low	176 Å²	176	130.9 Å²	130.9	82%	0.822	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-52.5	131.2	173.7	-69	-172.1	-3.5	0	0	107.9	S61 I65	S61-Q63 PolarHBondContact O-N 2.99Å; Q63-I65 PolarHBondContact O-N 3.35Å
64	P	67.4	Low	65.2	Low	115 Å²	115	135.6 Å²	135.6	75%	0.747	75%	0.746	S	S	*	*			trans	-59.2	114.8	178.4	22.5	-30.7	0	0	0	108.1	T66	P64-T66 PolarHBondContact O-N 3.06Å; P64-T66 VanDerWaalsContact O-N 3.11Å
65	I	65.4	Low	64.1	Low	177 Å²	177	137.3 Å²	137.3	91%	0.908	76%	0.758	S	S	*	*			trans	-71.9	103.5	173.9	-22	173.9	0	0	0	105.7	Q63	Q63-I65 PolarHBondContact O-N 3.35Å
66	T	66	Low	63.3	Low	198 Å²	198	142.6 Å²	142.6	100%	1.215	78%	0.777	S	S	*	*			trans	-100.2	0	166.5	55.5	0	0	0	0	110	P64	P64-T66 PolarHBondContact O-N 3.06Å; P64-T66 VanDerWaalsContact O-N 3.11Å

Retrieved 66 of 66 residues in 13.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).