A0A060WHW5_ONCMY Loading...

Transmembrane protein 141

AlphaFold DB , UniProt , Accession A0A060WHW5, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene tmem141, Length 126 aa.

						>A0A060WHW5_ONCMY|A0A060WHW5|tmem141
MVNLGLTKVDDALAAKHPGLQQYAACQSHAFMKGTATFILGTSGLFLIQKVIQKRLPYPLQWNLLISTAASSVGSYAVTRWETMKCTDLWMLIETGKVPDRTPLIAEPAPEEPAGPKKTPYGDVME
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	34.1	Very low	51	Low	228 Å²	228	118.6 Å²	118.6	100%	1.123	66%	0.663	S	S	*	*				0	110.2	0	-81.2	162.1	153.5	0	0	107.4	N3	M1-N3 PolarHBondContact O-N 2.97Å
2	V	40.8	Very low	51.9	Low	114 Å²	114	114.3 Å²	114.3	69%	0.691	65%	0.654	S	S	*	*			trans	-76.3	114.9	173.7	-82.9	0	0	0	0	107.3	L4	V2-L4 VanDerWaalsContact C-N 3.31Å; V2-L4 HydrophobicContact CG2-CD1 4.23Å; V2-L4 PolarHBondContact O-N 3.07Å
3	N	37.3	Very low	52.7	Low	151 Å²	151	111.1 Å²	111.1	81%	0.807	63%	0.633	S	S	*	*			trans	-69.1	90.6	172.9	-77.9	-76.8	0	0	0	107.7	M1 G5	M1-N3 PolarHBondContact O-N 2.97Å; N3-G5 PolarHBondContact O-N 3.16Å
4	L	53.3	Low	53.4	Low	103 Å²	103	105.1 Å²	105.1	54%	0.539	60%	0.604	S	S	.	*			trans	-64.6	118.8	156.3	-84.5	88.7	0	0	0	105.8	V2 L6	V2-L4 VanDerWaalsContact C-N 3.31Å; V2-L4 HydrophobicContact CG2-CD1 4.23Å; V2-L4 PolarHBondContact O-N 3.07Å; L4-L6 PolarHBondContact O-N 2.92Å
5	G	52.9	Low	53.8	Low	80 Å²	80	103.9 Å²	103.9	83%	0.825	61%	0.612	S	S	*	*	S	Bend	trans	-70.6	46	-177	0	0	0	0	0	114.1	N3	N3-G5 PolarHBondContact O-N 3.16Å
6	L	49.7	Very low	54.5	Low	89 Å²	89	107.7 Å²	107.7	47%	0.466	62%	0.618	S	S	.	*			trans	-127.6	19	-171.8	-83.8	161.5	0	0	0	113	L4 K8 V9 D10	L4-L6 PolarHBondContact O-N 2.92Å; L6-K8 PolarHBondContact O-N 3.37Å; L6-V9 HydrophobicContact CD2-CB 4.49Å; L6-V9 PolarHBondContact O-N 2.98Å; L6-D10 WeakPolarHBondContact CB-OD2 3.35Å; L6-D10 PolarHBondContact O-N 3.22Å
7	T	56.6	Low	55	Low	91 Å²	91	104.7 Å²	104.7	56%	0.558	60%	0.597	S	S	*	*	H	α-helix	trans	-46.6	-38.5	-170.9	49.3	0	0	0	0	115.4	D11	T7-D11 VanDerWaalsContact O-CG 3.23Å; T7-D11 PolarHBondContact O-N 2.92Å
8	K	53.8	Low	55.4	Low	183 Å²	183	104.1 Å²	104.1	80%	0.796	60%	0.597	S	S	*	*	H	α-helix	trans	-77.3	-32.8	-178	-73.9	-88.7	-175.6	169.6	0	114.2	L6	L6-K8 PolarHBondContact O-N 3.37Å
9	V	57.8	Low	56.1	Low	91 Å²	91	98.6 Å²	98.6	55%	0.552	57%	0.567	S	S	*	*	H	α-helix	trans	-84.2	-38.9	-178.8	-179.2	0	0	0	0	109.5	L6 D11 A12 L13	L6-V9 HydrophobicContact CD2-CB 4.49Å; L6-V9 PolarHBondContact O-N 2.98Å; V9-D11 PolarHBondContact O-N 3.46Å; V9-A12 PolarHBondContact O-N 3.15Å; V9-L13 WeakPolarHBondContact O-CB 3.48Å; V9-L13 PolarHBondContact O-N 3.46Å
10	D	63.4	Low	56.6	Low	54 Å²	54	96 Å²	96	29%	0.289	55%	0.55	S	S	.	*	H	α-helix	trans	-61.2	-40.5	175.2	-79.3	-53.4	0	0	0	112	L6 A12 L13 A14	L6-D10 WeakPolarHBondContact CB-OD2 3.35Å; L6-D10 PolarHBondContact O-N 3.22Å; D10-A12 PolarHBondContact O-N 2.93Å; D10-L13 PolarHBondContact O-N 3.05Å; D10-A14 WeakPolarHBondContact O-CA 3.34Å; D10-A14 WeakPolarHBondContact O-CB 3.43Å; D10-A14 PolarHBondContact O-N 3.01Å
11	D	61.3	Low	57.3	Low	121 Å²	121	98.7 Å²	98.7	65%	0.647	56%	0.558	S	S	*	*	H	α-helix	trans	-67.6	-39.1	-179.8	-73.5	-25.3	0	0	0	112.8	T7 V9 A15	T7-D11 VanDerWaalsContact O-CG 3.23Å; T7-D11 PolarHBondContact O-N 2.92Å; V9-D11 PolarHBondContact O-N 3.46Å; D11-A15 WeakPolarHBondContact O-CB 3.47Å; D11-A15 PolarHBondContact O-N 3.35Å
12	A	62.2	Low	59	Low	67 Å²	67	93 Å²	93	55%	0.554	53%	0.529	S	S	*	.	H	α-helix	trans	-73.2	-31.7	177.6	0	0	0	0	0	112.5	V9 D10	V9-A12 PolarHBondContact O-N 3.15Å; D10-A12 PolarHBondContact O-N 2.93Å
13	L	62.4	Low	60.4	Low	72 Å²	72	90.8 Å²	90.8	38%	0.377	51%	0.508	S	S	.	.	H	α-helix	trans	-84	-37	179	-166.2	65.2	0	0	0	112.1	V9 D10 A15 K16 H17 L20	V9-L13 WeakPolarHBondContact O-CB 3.48Å; V9-L13 PolarHBondContact O-N 3.46Å; D10-L13 PolarHBondContact O-N 3.05Å; L13-A15 VanDerWaalsContact C-N 3.26Å; L13-A15 PolarHBondContact O-N 3.16Å; L13-K16 CarbonylContact O-C 3.59Å; L13-K16 WeakPolarHBondContact O-CA 3.32Å; L13-K16 PolarHBondContact O-N 3.24Å; L13-H17 PolarHBondContact O-N 2.91Å; L13-L20 HydrophobicContact CD2-CD1 3.89Å; L13-L20 HydrophobicContact CG-CD1 3.93Å
14	A	61.4	Low	62.2	Low	28 Å²	28	86.1 Å²	86.1	23%	0.231	49%	0.491	C	S	.	.	H	α-helix	trans	-64.6	-31.3	173.6	0	0	0	0	0	111.8	D10 K16 H17	D10-A14 WeakPolarHBondContact O-CA 3.34Å; D10-A14 WeakPolarHBondContact O-CB 3.43Å; D10-A14 PolarHBondContact O-N 3.01Å; A14-K16 PolarHBondContact O-N 2.94Å; A14-H17 CarbonylContact O-C 3.3Å; A14-H17 VanDerWaalsContact O-C 3.3Å; A14-H17 PolarHBondContact O-N 3.49Å
15	A	60.1	Low	63.3	Low	87 Å²	87	84 Å²	84	72%	0.719	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.7	-28	171	0	0	0	0	0	113	D11 L13	D11-A15 WeakPolarHBondContact O-CB 3.47Å; D11-A15 PolarHBondContact O-N 3.35Å; L13-A15 VanDerWaalsContact C-N 3.26Å; L13-A15 PolarHBondContact O-N 3.16Å
16	K	65.1	Low	64.5	Low	164 Å²	164	82.2 Å²	82.2	71%	0.713	46%	0.463	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.3	-30.2	175.1	-71.4	-173.9	176.6	177.5	0	113.1	L13 A14	L13-K16 CarbonylContact O-C 3.59Å; L13-K16 WeakPolarHBondContact O-CA 3.32Å; L13-K16 PolarHBondContact O-N 3.24Å; A14-K16 PolarHBondContact O-N 2.94Å
17	H	62.9	Low	65.8	Low	57 Å²	57	82.3 Å²	82.3	26%	0.264	46%	0.461	S	S	.	.			trans	-129.8	88.3	-177.1	-59.6	-72.3	0	0	0	110.4	L13 A14 G19 L20 E94	L13-H17 PolarHBondContact O-N 2.91Å; A14-H17 CarbonylContact O-C 3.3Å; A14-H17 VanDerWaalsContact O-C 3.3Å; A14-H17 PolarHBondContact O-N 3.49Å; H17-G19 PolarHBondContact O-N 2.92Å; H17-L20 HydrophobicContact CB-CD1 4.12Å; H17-L20 PolarHBondContact O-N 3.38Å; H17-L20 VanDerWaalsContact O-N 3.14Å; H17-E94 IonicContact CE1-OE1 2.74Å; H17-E94 PolarHBondContact CE1-OE1 3.49Å; H17-E94 IonicContact CG-OE1 3.44Å; H17-E94 IonicContact ND1-OE1 3.67Å; H17-E94 PolarHBondContact ND1-OE1 3.14Å; H17-E94 IonicContact ND1-OE2 3.78Å
18	P	62.9	Low	66.9	Low	93 Å²	93	80.6 Å²	80.6	60%	0.604	45%	0.452	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.4	-16.6	-177.5	25.1	-34	0	0	0	113.4	L20	P18-L20 VanDerWaalsContact C-N 3.34Å; P18-L20 PolarHBondContact O-N 2.88Å
19	G	67	Low	68.1	Low	1 Å²	1	77.4 Å²	77.4	1%	0.01	44%	0.44	C	S	.	.	H	α-helix	trans	-71.7	-20.7	176.9	0	0	0	0	0	114.9	H17 Q21 Q22 Y23	H17-G19 PolarHBondContact O-N 2.92Å; G19-Q21 PolarHBondContact O-N 3.5Å; G19-Q22 PolarHBondContact O-N 3.48Å; G19-Y23 WeakPolarHBondContact O-CB 3.42Å; G19-Y23 PolarHBondContact O-N 3.23Å
20	L	67	Low	69.2	Low	45 Å²	45	73.1 Å²	73.1	24%	0.236	41%	0.414	C	S	.	.	H	α-helix	trans	-65.1	-39.7	-177.4	-114.3	152.9	0	0	0	112.2	L13 H17 P18 Y23 A24	L13-L20 HydrophobicContact CD2-CD1 3.89Å; L13-L20 HydrophobicContact CG-CD1 3.93Å; H17-L20 HydrophobicContact CB-CD1 4.12Å; H17-L20 PolarHBondContact O-N 3.38Å; H17-L20 VanDerWaalsContact O-N 3.14Å; P18-L20 VanDerWaalsContact C-N 3.34Å; P18-L20 PolarHBondContact O-N 2.88Å; L20-Y23 PolarHBondContact O-N 3.41Å; L20-A24 WeakPolarHBondContact O-CB 3.34Å; L20-A24 PolarHBondContact O-N 3.42Å
21	Q	70.3	Confident	69.8	Low	153 Å²	153	76.8 Å²	76.8	72%	0.715	43%	0.428	S	S	*	.	H	α-helix	trans	-67.9	-38.3	177.2	-165.9	-177.8	-1.6	0	0	111.7	G19 A24 A25	G19-Q21 PolarHBondContact O-N 3.5Å; Q21-A24 PolarHBondContact O-N 3.16Å; Q21-A25 WeakPolarHBondContact O-CB 3.5Å; Q21-A25 PolarHBondContact O-N 2.94Å
22	Q	70.3	Confident	71	Confident	109 Å²	109	77.1 Å²	77.1	51%	0.509	43%	0.427	S	S	.	.	H	α-helix	trans	-68	-39.3	175.3	-66.1	-156.2	-5.2	0	0	111.9	G19 A25 C26	G19-Q22 PolarHBondContact O-N 3.48Å; Q22-A25 PolarHBondContact O-N 3.22Å; Q22-C26 VanDerWaalsContact O-CB 3.25Å; Q22-C26 WeakPolarHBondContact O-CB 3.14Å; Q22-C26 PolarHBondContact O-N 2.83Å
23	Y	70.1	Confident	72.1	Confident	67 Å²	67	77.9 Å²	77.9	26%	0.263	42%	0.418	S	S	.	.	H	α-helix	trans	-61.6	-47.2	173.6	176.8	-100.7	0	0	0	111.7	G19 L20 A25 C26 Q27 C86 W90	G19-Y23 WeakPolarHBondContact O-CB 3.42Å; G19-Y23 PolarHBondContact O-N 3.23Å; L20-Y23 PolarHBondContact O-N 3.41Å; Y23-A25 PolarHBondContact O-N 3.4Å; Y23-C26 CarbonylContact O-C 3.6Å; Y23-C26 PolarHBondContact O-N 3.4Å; Y23-Q27 WeakPolarHBondContact O-CB 3.32Å; Y23-Q27 PolarHBondContact O-N 3Å; Y23-C86 HydrophobicContact CD2-CB 4.19Å; Y23-C86 HydrophobicContact CE2-CB 4.28Å; Y23-W90 HydrophobicContact CD2-CB 4.38Å
24	A	75.1	Confident	73	Confident	53 Å²	53	74.6 Å²	74.6	44%	0.438	40%	0.401	S	S	.	.	H	α-helix	trans	-62	-42.3	178.8	0	0	0	0	0	112.5	L20 Q21 Q27 S28	L20-A24 WeakPolarHBondContact O-CB 3.34Å; L20-A24 PolarHBondContact O-N 3.42Å; Q21-A24 PolarHBondContact O-N 3.16Å; A24-Q27 PolarHBondContact O-N 2.98Å; A24-S28 PolarHBondContact O-N 2.94Å
25	A	77	Confident	74.1	Confident	60 Å²	60	76 Å²	76	50%	0.496	41%	0.407	S	S	.	.	H	α-helix	trans	-61.1	-45.5	173.7	0	0	0	0	0	111.1	Q21 Q22 Y23 S28 H29	Q21-A25 WeakPolarHBondContact O-CB 3.5Å; Q21-A25 PolarHBondContact O-N 2.94Å; Q22-A25 PolarHBondContact O-N 3.22Å; Y23-A25 PolarHBondContact O-N 3.4Å; A25-S28 PolarHBondContact O-N 3.49Å; A25-S28 PolarHBondContact O-OG 3.47Å; A25-H29 PolarHBondContact O-N 3.31Å; A25-H29 VanDerWaalsContact O-N 3.17Å
26	C	78	Confident	75.5	Confident	41 Å²	41	74.1 Å²	74.1	28%	0.277	39%	0.391	S	S	.	.	H	α-helix	trans	-65.9	-39.6	179.5	-166	0	0	0	0	112.6	Q22 Y23 S28 H29 A30 C86	Q22-C26 VanDerWaalsContact O-CB 3.25Å; Q22-C26 WeakPolarHBondContact O-CB 3.14Å; Q22-C26 PolarHBondContact O-N 2.83Å; Y23-C26 CarbonylContact O-C 3.6Å; Y23-C26 PolarHBondContact O-N 3.4Å; C26-S28 VanDerWaalsContact C-N 3.33Å; C26-S28 PolarHBondContact O-N 3.01Å; C26-H29 PolarHBondContact O-N 3.27Å; C26-A30 WeakPolarHBondContact O-CB 3.42Å; C26-A30 PolarHBondContact O-N 2.9Å; C26-C86 HydrophobicContact CB-CB 3.59Å; C26-C86 WeakPolarHBondContact CB-SG 3.28Å; C26-C86 PolarHBondContact O-SG 3.35Å; C26-C86 VanDerWaalsContact O-SG 3.37Å; C26-C86 WeakPolarHBondContact SG-CA 3.25Å; C26-C86 WeakPolarHBondContact SG-CB 3.02Å; C26-C86 CovalentContact SG-SG 2.02Å; C26-C86 PolarHBondContact SG-SG 3.07Å
27	Q	77.9	Confident	76.5	Confident	91 Å²	91	68.5 Å²	68.5	43%	0.425	37%	0.371	S	S	.	.	H	α-helix	trans	-60.7	-42	175.9	-176.8	-180	-6.4	0	0	111.8	Y23 A24 H29 A30 F31	Y23-Q27 WeakPolarHBondContact O-CB 3.32Å; Y23-Q27 PolarHBondContact O-N 3Å; A24-Q27 PolarHBondContact O-N 2.98Å; Q27-H29 VanDerWaalsContact C-N 3.33Å; Q27-H29 PolarHBondContact O-N 3.17Å; Q27-A30 PolarHBondContact O-N 3.48Å; Q27-F31 WeakPolarHBondContact O-CB 3.17Å; Q27-F31 PolarHBondContact O-N 3.3Å
28	S	78.4	Confident	77.6	Confident	55 Å²	55	69.2 Å²	69.2	39%	0.385	37%	0.373	S	S	.	.	H	α-helix	trans	-65.8	-37.1	176.8	76.8	0	0	0	0	112.2	A24 A25 C26 F31 M32	A24-S28 PolarHBondContact O-N 2.94Å; A25-S28 PolarHBondContact O-N 3.49Å; A25-S28 PolarHBondContact O-OG 3.47Å; C26-S28 VanDerWaalsContact C-N 3.33Å; C26-S28 PolarHBondContact O-N 3.01Å; S28-F31 PolarHBondContact O-N 3.41Å; S28-M32 WeakPolarHBondContact O-CG 3.33Å; S28-M32 PolarHBondContact O-N 3.4Å
29	H	80.3	Confident	78.9	Confident	116 Å²	116	70.1 Å²	70.1	54%	0.537	37%	0.372	S	S	.	.	H	α-helix	trans	-69.4	-42.6	176.3	-174.7	-96.3	0	0	0	111.8	A25 C26 Q27 F31 M32 K33	A25-H29 PolarHBondContact O-N 3.31Å; A25-H29 VanDerWaalsContact O-N 3.17Å; C26-H29 PolarHBondContact O-N 3.27Å; Q27-H29 VanDerWaalsContact C-N 3.33Å; Q27-H29 PolarHBondContact O-N 3.17Å; H29-F31 VanDerWaalsContact C-N 3.32Å; H29-F31 PolarHBondContact O-N 2.94Å; H29-M32 PolarHBondContact O-N 2.66Å; H29-K33 WeakPolarHBondContact O-CB 3.34Å; H29-K33 PolarHBondContact O-N 3.5Å
30	A	79.1	Confident	80	Confident	1 Å²	1	76 Å²	76	1%	0.008	40%	0.403	C	S	.	.	H	α-helix	trans	-59.6	-42.7	173.9	0	0	0	0	0	111.5	C26 Q27 K33 G34 E82 T83	C26-A30 WeakPolarHBondContact O-CB 3.42Å; C26-A30 PolarHBondContact O-N 2.9Å; Q27-A30 PolarHBondContact O-N 3.48Å; A30-K33 PolarHBondContact O-N 2.83Å; A30-G34 PolarHBondContact O-N 3.49Å; A30-E82 HydrophobicContact CB-CB 3.64Å; A30-T83 HydrophobicContact CB-CG2 3.92Å
31	F	77.7	Confident	81	Confident	131 Å²	131	75.1 Å²	75.1	58%	0.575	40%	0.404	S	S	*	.	H	α-helix	trans	-64.1	-46.4	175.3	-179.1	-99.4	0	0	0	112.5	Q27 S28 H29 K33 G34 T35	Q27-F31 WeakPolarHBondContact O-CB 3.17Å; Q27-F31 PolarHBondContact O-N 3.3Å; S28-F31 PolarHBondContact O-N 3.41Å; H29-F31 VanDerWaalsContact C-N 3.32Å; H29-F31 PolarHBondContact O-N 2.94Å; F31-K33 VanDerWaalsContact C-N 3.29Å; F31-K33 PolarHBondContact O-N 3.46Å; F31-G34 PolarHBondContact O-N 2.88Å; F31-T35 HydrophobicContact CD1-CG2 4.39Å; F31-T35 HydrophobicContact CE1-CG2 3.92Å; F31-T35 HydrophobicContact CE2-CG2 4.26Å; F31-T35 HydrophobicContact CZ-CG2 3.85Å; F31-T35 PolarHBondContact O-N 3.31Å; F31-T35 PolarHBondContact O-OG1 2.94Å
32	M	85.6	Confident	81.8	Confident	128 Å²	128	69.3 Å²	69.3	63%	0.631	38%	0.379	S	S	*	.	H	α-helix	trans	-62	-37.9	176.2	-72.5	-133.4	-58.6	0	0	112.5	S28 H29 T35 A36	S28-M32 WeakPolarHBondContact O-CG 3.33Å; S28-M32 PolarHBondContact O-N 3.4Å; H29-M32 PolarHBondContact O-N 2.66Å; M32-T35 PolarHBondContact O-OG1 3.49Å; M32-A36 VanDerWaalsContact O-CB 3.3Å; M32-A36 WeakPolarHBondContact O-CB 3.3Å; M32-A36 PolarHBondContact O-N 2.91Å
33	K	85.3	Confident	82.6	Confident	84 Å²	84	66.9 Å²	66.9	37%	0.365	37%	0.374	S	S	.	.	H	α-helix	trans	-65.5	-42.8	175.5	-171.8	168.8	175.4	-175.5	0	111.1	H29 A30 F31 A36 T37 E82	H29-K33 WeakPolarHBondContact O-CB 3.34Å; H29-K33 PolarHBondContact O-N 3.5Å; A30-K33 PolarHBondContact O-N 2.83Å; F31-K33 VanDerWaalsContact C-N 3.29Å; F31-K33 PolarHBondContact O-N 3.46Å; K33-A36 PolarHBondContact O-N 3.42Å; K33-T37 WeakPolarHBondContact O-CG2 3.23Å; K33-T37 PolarHBondContact O-N 3.38Å; K33-T37 PolarHBondContact O-OG1 3.24Å; K33-E82 HydrophobicContact CD-CG 3.99Å; K33-E82 VanDerWaalsContact NZ-CD 3.34Å; K33-E82 IonicContact NZ-OE1 3.91Å; K33-E82 PolarHBondContact NZ-OE1 2.98Å; K33-E82 IonicContact NZ-OE2 2.71Å
34	G	82.1	Confident	83.5	Confident	2 Å²	2	65 Å²	65	2%	0.021	38%	0.375	C	S	.	.	H	α-helix	trans	-57.5	-49.9	174.5	0	0	0	0	0	113.4	A30 F31 T37 F38 T79	A30-G34 PolarHBondContact O-N 3.49Å; F31-G34 PolarHBondContact O-N 2.88Å; G34-T37 WeakPolarHBondContact CA-OG1 3.42Å; G34-T37 PolarHBondContact O-N 2.87Å; G34-T37 PolarHBondContact O-OG1 2.97Å; G34-F38 PolarHBondContact O-N 3.05Å; G34-T79 VanDerWaalsContact CA-OG1 3.26Å; G34-T79 WeakPolarHBondContact CA-OG1 3.48Å
35	T	85.1	Confident	84	Confident	59 Å²	59	65.4 Å²	65.4	36%	0.362	37%	0.37	S	S	.	.	H	α-helix	trans	-66.4	-38.2	178.4	56.2	0	0	0	0	112.2	F31 M32 F38 I39	F31-T35 HydrophobicContact CD1-CG2 4.39Å; F31-T35 HydrophobicContact CE1-CG2 3.92Å; F31-T35 HydrophobicContact CE2-CG2 4.26Å; F31-T35 HydrophobicContact CZ-CG2 3.85Å; F31-T35 PolarHBondContact O-N 3.31Å; F31-T35 PolarHBondContact O-OG1 2.94Å; M32-T35 PolarHBondContact O-OG1 3.49Å; T35-F38 WeakPolarHBondContact O-CB 3.4Å; T35-F38 PolarHBondContact O-N 2.71Å; T35-I39 WeakPolarHBondContact O-CG1 3.24Å; T35-I39 PolarHBondContact O-N 2.81Å; T35-I39 VanDerWaalsContact O-N 3.11Å
36	A	88.4	Confident	84.4	Confident	46 Å²	46	65.9 Å²	65.9	38%	0.38	36%	0.361	S	S	.	.	H	α-helix	trans	-61.5	-44.2	173.3	0	0	0	0	0	111.7	M32 K33 F38 I39 L40	M32-A36 VanDerWaalsContact O-CB 3.3Å; M32-A36 WeakPolarHBondContact O-CB 3.3Å; M32-A36 PolarHBondContact O-N 2.91Å; K33-A36 PolarHBondContact O-N 3.42Å; A36-F38 VanDerWaalsContact C-N 3.29Å; A36-F38 PolarHBondContact O-N 2.88Å; A36-I39 PolarHBondContact O-N 3.45Å; A36-L40 WeakPolarHBondContact O-CB 3.39Å; A36-L40 WeakPolarHBondContact O-CG 3.2Å; A36-L40 PolarHBondContact O-N 3.09Å
37	T	86.1	Confident	84.8	Confident	46 Å²	46	69.2 Å²	69.2	28%	0.282	38%	0.375	S	S	.	.	H	α-helix	trans	-65.4	-31.4	176.1	53	0	0	0	0	113	K33 G34 G41 V78	K33-T37 WeakPolarHBondContact O-CG2 3.23Å; K33-T37 PolarHBondContact O-N 3.38Å; K33-T37 PolarHBondContact O-OG1 3.24Å; G34-T37 WeakPolarHBondContact CA-OG1 3.42Å; G34-T37 PolarHBondContact O-N 2.87Å; G34-T37 PolarHBondContact O-OG1 2.97Å; T37-G41 WeakPolarHBondContact O-CA 3.39Å; T37-G41 PolarHBondContact O-N 3.49Å; T37-V78 HydrophobicContact CG2-CG1 4.21Å
38	F	86.4	Confident	85.1	Confident	72 Å²	72	69.8 Å²	69.8	32%	0.316	38%	0.38	S	S	.	.	H	α-helix	trans	-64.8	-48.8	174.5	-178.2	-107.8	0	0	0	112.1	G34 T35 A36 G41 T42 T68 S71 S75	G34-F38 PolarHBondContact O-N 3.05Å; T35-F38 WeakPolarHBondContact O-CB 3.4Å; T35-F38 PolarHBondContact O-N 2.71Å; A36-F38 VanDerWaalsContact C-N 3.29Å; A36-F38 PolarHBondContact O-N 2.88Å; F38-G41 PolarHBondContact O-N 3.49Å; F38-T42 WeakPolarHBondContact O-CB 3.44Å; F38-T42 PolarHBondContact O-N 3.24Å; F38-T42 PolarHBondContact O-OG1 3.41Å; F38-T68 HydrophobicContact CZ-CG2 4.28Å; F38-S71 VanDerWaalsContact CD2-OG 3.23Å; F38-S71 WeakPolarHBondContact CD2-OG 3.11Å; F38-S71 PolarHBondContact O-OG 2.92Å; F38-S75 WeakPolarHBondContact CA-OG 3.39Å; F38-S75 WeakPolarHBondContact CB-OG 3.3Å; F38-S75 PolarHBondContact N-OG 3.06Å; F38-S75 VanDerWaalsContact N-OG 3.15Å
39	I	89.7	Confident	85.3	Confident	113 Å²	113	68.4 Å²	68.4	58%	0.579	37%	0.367	S	S	*	.	H	α-helix	trans	-65.1	-46.4	-178.4	-64.7	167.7	0	0	0	110.3	T35 A36 S43	T35-I39 WeakPolarHBondContact O-CG1 3.24Å; T35-I39 PolarHBondContact O-N 2.81Å; T35-I39 VanDerWaalsContact O-N 3.11Å; A36-I39 PolarHBondContact O-N 3.45Å; I39-S43 WeakPolarHBondContact O-CB 3.36Å; I39-S43 PolarHBondContact O-N 2.77Å; I39-S43 VanDerWaalsContact O-N 3.14Å; I39-S43 PolarHBondContact O-OG 3.05Å
40	L	90.3	Very high	85.3	Confident	125 Å²	125	68.9 Å²	68.9	65%	0.654	37%	0.368	S	S	*	.	H	α-helix	trans	-67.9	-38.1	178	-67.8	175.6	0	0	0	112.3	A36 S43 G44	A36-L40 WeakPolarHBondContact O-CB 3.39Å; A36-L40 WeakPolarHBondContact O-CG 3.2Å; A36-L40 PolarHBondContact O-N 3.09Å; L40-S43 WeakPolarHBondContact CA-OG 3.28Å; L40-S43 PolarHBondContact O-OG 2.89Å; L40-S43 VanDerWaalsContact O-OG 3.05Å; L40-G44 PolarHBondContact O-N 3.03Å
41	G	88.1	Confident	85.6	Confident	26 Å²	26	73.6 Å²	73.6	27%	0.268	40%	0.396	S	S	.	.	H	α-helix	trans	-64.6	-48.9	177.6	0	0	0	0	0	112.3	T37 F38 S43 G44 L45	T37-G41 WeakPolarHBondContact O-CA 3.39Å; T37-G41 PolarHBondContact O-N 3.49Å; F38-G41 PolarHBondContact O-N 3.49Å; G41-S43 PolarHBondContact O-N 2.91Å; G41-G44 PolarHBondContact O-N 3.46Å; G41-L45 VanDerWaalsContact O-CB 3.3Å; G41-L45 WeakPolarHBondContact O-CB 3.35Å; G41-L45 VanDerWaalsContact O-CG 3.32Å; G41-L45 WeakPolarHBondContact O-CG 3.45Å; G41-L45 PolarHBondContact O-N 2.72Å
42	T	87.6	Confident	85.7	Confident	31 Å²	31	71.8 Å²	71.8	19%	0.19	39%	0.392	C	S	.	.	H	α-helix	trans	-64.1	-43.4	179.8	-55.4	0	0	0	0	111.3	F38 F46 S67 S71	F38-T42 WeakPolarHBondContact O-CB 3.44Å; F38-T42 PolarHBondContact O-N 3.24Å; F38-T42 PolarHBondContact O-OG1 3.41Å; T42-F46 VanDerWaalsContact O-CB 3.23Å; T42-F46 WeakPolarHBondContact O-CB 3.44Å; T42-F46 PolarHBondContact O-N 3.23Å; T42-S67 PolarHBondContact O-OG 3.41Å; T42-S67 VanDerWaalsContact O-OG 3.09Å; T42-S71 PolarHBondContact N-OG 3.33Å; T42-S71 WeakPolarHBondContact OG1-CB 3.38Å; T42-S71 PolarHBondContact OG1-OG 2.68Å
43	S	87.2	Confident	85.2	Confident	58 Å²	58	68 Å²	68	41%	0.406	37%	0.372	S	S	.	.	H	α-helix	trans	-67.9	-43.8	178.5	55.8	0	0	0	0	112.3	I39 L40 G41 F46 L47	I39-S43 WeakPolarHBondContact O-CB 3.36Å; I39-S43 PolarHBondContact O-N 2.77Å; I39-S43 VanDerWaalsContact O-N 3.14Å; I39-S43 PolarHBondContact O-OG 3.05Å; L40-S43 WeakPolarHBondContact CA-OG 3.28Å; L40-S43 PolarHBondContact O-OG 2.89Å; L40-S43 VanDerWaalsContact O-OG 3.05Å; G41-S43 PolarHBondContact O-N 2.91Å; S43-F46 PolarHBondContact O-N 3.25Å; S43-L47 WeakPolarHBondContact O-CG 3.23Å; S43-L47 PolarHBondContact O-N 3.05Å; S43-L47 VanDerWaalsContact O-N 3.07Å
44	G	88.2	Confident	84.8	Confident	28 Å²	28	72.8 Å²	72.8	29%	0.289	39%	0.393	S	S	.	.	H	α-helix	trans	-61.1	-50.1	175.7	0	0	0	0	0	112.6	L40 G41 F46 L47 I48	L40-G44 PolarHBondContact O-N 3.03Å; G41-G44 PolarHBondContact O-N 3.46Å; G44-F46 VanDerWaalsContact C-N 3.31Å; G44-F46 PolarHBondContact O-N 3.09Å; G44-L47 PolarHBondContact O-N 2.8Å; G44-I48 WeakPolarHBondContact O-CG1 3.4Å; G44-I48 PolarHBondContact O-N 3.39Å
45	L	86.2	Confident	84.5	Confident	61 Å²	61	83.5 Å²	83.5	32%	0.319	43%	0.433	S	S	.	.	H	α-helix	trans	-61.4	-39.6	177.8	-75.6	171.1	0	0	0	111.9	G41 I48 Q49 S67 A70	G41-L45 VanDerWaalsContact O-CB 3.3Å; G41-L45 WeakPolarHBondContact O-CB 3.35Å; G41-L45 VanDerWaalsContact O-CG 3.32Å; G41-L45 WeakPolarHBondContact O-CG 3.45Å; G41-L45 PolarHBondContact O-N 2.72Å; L45-I48 PolarHBondContact O-N 3.14Å; L45-Q49 WeakPolarHBondContact O-CB 3.08Å; L45-Q49 WeakPolarHBondContact O-CG 3.36Å; L45-Q49 PolarHBondContact O-N 2.92Å; L45-S67 WeakPolarHBondContact CB-OG 3.11Å; L45-A70 HydrophobicContact CD1-CB 3.94Å
46	F	84.2	Confident	83.8	Confident	70 Å²	70	85.8 Å²	85.8	31%	0.307	44%	0.443	S	S	.	.	H	α-helix	trans	-64.2	-41.2	177.5	-176.6	-103.2	0	0	0	112.6	T42 S43 G44 Q49 K50 L60	T42-F46 VanDerWaalsContact O-CB 3.23Å; T42-F46 WeakPolarHBondContact O-CB 3.44Å; T42-F46 PolarHBondContact O-N 3.23Å; S43-F46 PolarHBondContact O-N 3.25Å; G44-F46 VanDerWaalsContact C-N 3.31Å; G44-F46 PolarHBondContact O-N 3.09Å; F46-Q49 PolarHBondContact O-N 2.97Å; F46-K50 WeakPolarHBondContact O-CB 3.3Å; F46-K50 PolarHBondContact O-N 3.24Å; F46-L60 HydrophobicContact CE2-CD2 4.4Å
47	L	86.8	Confident	82.8	Confident	111 Å²	111	89.6 Å²	89.6	58%	0.581	46%	0.464	S	S	*	.	H	α-helix	trans	-65.2	-43.5	176.1	-69.9	176.5	0	0	0	111.7	S43 G44 K50 V51	S43-L47 WeakPolarHBondContact O-CG 3.23Å; S43-L47 PolarHBondContact O-N 3.05Å; S43-L47 VanDerWaalsContact O-N 3.07Å; G44-L47 PolarHBondContact O-N 2.8Å; L47-K50 PolarHBondContact O-N 3.16Å; L47-V51 WeakPolarHBondContact O-CG2 3.42Å; L47-V51 PolarHBondContact O-N 3.46Å
48	I	85.1	Confident	81.8	Confident	102 Å²	102	95.1 Å²	95.1	52%	0.523	48%	0.481	S	S	.	.	H	α-helix	trans	-61.8	-47.3	177	-67.4	165.3	0	0	0	110.3	G44 L45 K50 V51 I52	G44-I48 WeakPolarHBondContact O-CG1 3.4Å; G44-I48 PolarHBondContact O-N 3.39Å; L45-I48 PolarHBondContact O-N 3.14Å; I48-K50 VanDerWaalsContact C-N 3.28Å; I48-K50 PolarHBondContact O-N 3.4Å; I48-V51 PolarHBondContact O-N 3.29Å; I48-V51 VanDerWaalsContact O-N 3.16Å; I48-I52 HydrophobicContact CG2-CD1 3.75Å; I48-I52 WeakPolarHBondContact O-CG1 3.45Å; I48-I52 PolarHBondContact O-N 3.25Å
49	Q	81.4	Confident	81.1	Confident	26 Å²	26	95.2 Å²	95.2	12%	0.121	49%	0.488	C	S	.	.	H	α-helix	trans	-59.6	-38.2	176.2	-73.8	169.5	-15.4	0	0	112	L45 F46 I52 Q53 N63	L45-Q49 WeakPolarHBondContact O-CB 3.08Å; L45-Q49 WeakPolarHBondContact O-CG 3.36Å; L45-Q49 PolarHBondContact O-N 2.92Å; F46-Q49 PolarHBondContact O-N 2.97Å; Q49-I52 PolarHBondContact O-N 3.12Å; Q49-Q53 WeakPolarHBondContact O-CB 3.49Å; Q49-Q53 WeakPolarHBondContact O-CG 3.09Å; Q49-Q53 PolarHBondContact O-N 3.33Å; Q49-N63 HydrophobicContact CB-CB 4.27Å; Q49-N63 PolarHBondContact NE2-O 2.74Å; Q49-N63 PolarHBondContact OE1-O 3.16Å
50	K	81.3	Confident	80	Confident	126 Å²	126	94.7 Å²	94.7	55%	0.548	49%	0.486	S	S	.	.	H	α-helix	trans	-67.6	-34.3	176.5	-172	172.2	-177	163.3	0	112.9	F46 L47 I48	F46-K50 WeakPolarHBondContact O-CB 3.3Å; F46-K50 PolarHBondContact O-N 3.24Å; L47-K50 PolarHBondContact O-N 3.16Å; I48-K50 VanDerWaalsContact C-N 3.28Å; I48-K50 PolarHBondContact O-N 3.4Å
51	V	84.6	Confident	79.4	Confident	100 Å²	100	96.5 Å²	96.5	61%	0.606	49%	0.491	S	S	*	.	H	α-helix	trans	-70.1	-42.3	173.7	173	0	0	0	0	110.7	L47 I48 Q53 K54	L47-V51 WeakPolarHBondContact O-CG2 3.42Å; L47-V51 PolarHBondContact O-N 3.46Å; I48-V51 PolarHBondContact O-N 3.29Å; I48-V51 VanDerWaalsContact O-N 3.16Å; V51-Q53 VanDerWaalsContact C-N 3.32Å; V51-Q53 PolarHBondContact O-N 3.11Å; V51-K54 WeakPolarHBondContact O-CB 3.18Å; V51-K54 PolarHBondContact O-N 2.9Å; V51-K54 VanDerWaalsContact O-N 3.15Å
52	I	81.3	Confident	78.9	Confident	94 Å²	94	102.8 Å²	102.8	48%	0.482	51%	0.507	S	S	.	.	H	α-helix	trans	-65.5	-35.8	177.7	-66.6	166.7	0	0	0	111.3	I48 Q49 K54 R55 L56	I48-I52 HydrophobicContact CG2-CD1 3.75Å; I48-I52 WeakPolarHBondContact O-CG1 3.45Å; I48-I52 PolarHBondContact O-N 3.25Å; Q49-I52 PolarHBondContact O-N 3.12Å; I52-K54 PolarHBondContact O-N 3.33Å; I52-K54 VanDerWaalsContact O-N 3.16Å; I52-R55 PolarHBondContact O-N 2.92Å; I52-L56 PolarHBondContact O-N 3Å; I52-L56 VanDerWaalsContact O-N 3.07Å
53	Q	74.4	Confident	78.4	Confident	47 Å²	47	102.2 Å²	102.2	22%	0.22	50%	0.503	C	S	.	.	H	α-helix	trans	-59.6	-23.6	173.9	-87.8	-172.9	-34.5	0	0	114	Q49 V51 R55 L56 Y58 N63	Q49-Q53 WeakPolarHBondContact O-CB 3.49Å; Q49-Q53 WeakPolarHBondContact O-CG 3.09Å; Q49-Q53 PolarHBondContact O-N 3.33Å; V51-Q53 VanDerWaalsContact C-N 3.32Å; V51-Q53 PolarHBondContact O-N 3.11Å; Q53-R55 PolarHBondContact O-N 2.9Å; Q53-L56 WeakPolarHBondContact CA-O 3.25Å; Q53-Y58 PolarHBondContact NE2-O 3.44Å; Q53-N63 WeakPolarHBondContact CG-ND2 3.5Å; Q53-N63 PolarHBondContact NE2-ND2 3.21Å
54	K	76.4	Confident	78.1	Confident	185 Å²	185	104 Å²	104	80%	0.804	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.8	-18.9	172.8	-67.3	-164.3	173.6	-173.5	0	112.9	V51 I52	V51-K54 WeakPolarHBondContact O-CB 3.18Å; V51-K54 PolarHBondContact O-N 2.9Å; V51-K54 VanDerWaalsContact O-N 3.15Å; I52-K54 PolarHBondContact O-N 3.33Å; I52-K54 VanDerWaalsContact O-N 3.16Å
55	R	76.4	Confident	78	Confident	227 Å²	227	108.4 Å²	108.4	86%	0.857	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-110.8	-29.9	-178.3	-71.4	-68.7	-167.4	148.2	0.8	113.5	I52 Q53	I52-R55 PolarHBondContact O-N 2.92Å; Q53-R55 PolarHBondContact O-N 2.9Å
56	L	70.1	Confident	77.9	Confident	107 Å²	107	109.3 Å²	109.3	56%	0.56	53%	0.528	S	S	*	.	S	Bend	trans	-130.8	108	-178.8	-81.3	150.1	0	0	0	109.7	I52 Q53 Y58	I52-L56 PolarHBondContact O-N 3Å; I52-L56 VanDerWaalsContact O-N 3.07Å; Q53-L56 WeakPolarHBondContact CA-O 3.25Å; L56-Y58 PolarHBondContact O-N 3.43Å
57	P	66.9	Low	77.8	Confident	127 Å²	127	106 Å²	106	83%	0.825	51%	0.514	S	S	*	.			trans	-73.2	93.7	-178.7	28.3	-32.5	0	0	0	111.1
58	Y	65.6	Low	77.7	Confident	162 Å²	162	103.4 Å²	103.4	64%	0.635	50%	0.502	S	S	*	.			trans	-108.2	149.1	171.7	-108	-99.5	0	0	0	111.1	Q53 L56 L60	Q53-Y58 PolarHBondContact NE2-O 3.44Å; L56-Y58 PolarHBondContact O-N 3.43Å; Y58-L60 PolarHBondContact O-N 3.41Å
59	P	70.9	Confident	77.9	Confident	74 Å²	74	101.3 Å²	101.3	48%	0.481	50%	0.5	S	S	.	.			trans	-61.9	132.1	178.7	24.8	-34.7	0	0	0	112.6	Q61 W62	P59-Q61 PolarHBondContact O-N 2.83Å; P59-Q61 VanDerWaalsContact O-N 3.16Å; P59-W62 PolarHBondContact O-N 3.33Å
60	L	67.1	Low	78.2	Confident	102 Å²	102	102.5 Å²	102.5	53%	0.534	51%	0.514	S	S	.	.	H	α-helix	trans	-60.1	-26.8	-174.4	-122.2	146.3	0	0	0	114.2	F46 Y58 W62 N63 L64	F46-L60 HydrophobicContact CE2-CD2 4.4Å; Y58-L60 PolarHBondContact O-N 3.41Å; L60-W62 PolarHBondContact O-N 2.86Å; L60-N63 PolarHBondContact O-N 2.87Å; L60-L64 PolarHBondContact O-N 2.97Å
61	Q	77.2	Confident	78.5	Confident	162 Å²	162	96.7 Å²	96.7	76%	0.757	49%	0.49	S	S	*	.	H	α-helix	trans	-64.4	-38	179.5	-65.7	176.9	-44.5	0	0	112.6	P59 L65	P59-Q61 PolarHBondContact O-N 2.83Å; P59-Q61 VanDerWaalsContact O-N 3.16Å; Q61-L65 PolarHBondContact O-N 2.98Å
62	W	78.3	Confident	78.6	Confident	158 Å²	158	95 Å²	95	60%	0.598	48%	0.482	S	S	*	.	H	α-helix	trans	-70.8	-32.8	-179.6	-101.1	94.4	0	0	0	112.6	P59 L60 L65 I66	P59-W62 PolarHBondContact O-N 3.33Å; L60-W62 PolarHBondContact O-N 2.86Å; W62-L65 PolarHBondContact O-N 2.65Å; W62-I66 HydrophobicContact CE3-CD1 3.54Å; W62-I66 HydrophobicContact CE3-CG1 3.79Å; W62-I66 HydrophobicContact CZ3-CD1 4.01Å; W62-I66 HydrophobicContact CZ3-CG1 4.11Å; W62-I66 WeakPolarHBondContact O-CB 3.49Å; W62-I66 VanDerWaalsContact O-CG1 3.28Å; W62-I66 WeakPolarHBondContact O-CG1 3.37Å; W62-I66 PolarHBondContact O-N 2.88Å
63	N	77.3	Confident	79	Confident	19 Å²	19	95.5 Å²	95.5	10%	0.102	49%	0.49	C	S	.	.	H	α-helix	trans	-65.7	-44.5	177.1	-74.1	-13.8	0	0	0	111.8	Q49 Q53 L60 L65 I66 S67	Q49-N63 HydrophobicContact CB-CB 4.27Å; Q49-N63 PolarHBondContact NE2-O 2.74Å; Q49-N63 PolarHBondContact OE1-O 3.16Å; Q53-N63 WeakPolarHBondContact CG-ND2 3.5Å; Q53-N63 PolarHBondContact NE2-ND2 3.21Å; L60-N63 PolarHBondContact O-N 2.87Å; N63-L65 PolarHBondContact O-N 3.21Å; N63-I66 PolarHBondContact O-N 3.25Å; N63-S67 WeakPolarHBondContact O-CB 3.48Å; N63-S67 PolarHBondContact O-N 2.98Å
64	L	79.8	Confident	79.6	Confident	95 Å²	95	95 Å²	95	50%	0.497	50%	0.496	S	S	.	.	H	α-helix	trans	-64.3	-41.5	179.2	-126	156.2	0	0	0	111.6	L60 T68	L60-L64 PolarHBondContact O-N 2.97Å; L64-T68 WeakPolarHBondContact O-CB 3.35Å; L64-T68 PolarHBondContact O-N 2.89Å; L64-T68 PolarHBondContact O-OG1 3.28Å
65	L	85.7	Confident	79.9	Confident	121 Å²	121	86.6 Å²	86.6	63%	0.634	46%	0.461	S	S	*	.	H	α-helix	trans	-63.5	-51.8	174.2	-92.4	166.8	0	0	0	112.1	Q61 W62 N63 S67 T68 A69	Q61-L65 PolarHBondContact O-N 2.98Å; W62-L65 PolarHBondContact O-N 2.65Å; N63-L65 PolarHBondContact O-N 3.21Å; L65-S67 PolarHBondContact O-N 2.92Å; L65-T68 PolarHBondContact O-N 3.15Å; L65-A69 VanDerWaalsContact O-CB 3.28Å; L65-A69 WeakPolarHBondContact O-CB 3.26Å; L65-A69 PolarHBondContact O-N 2.92Å
66	I	84.1	Confident	80.2	Confident	81 Å²	81	82.3 Å²	82.3	42%	0.415	45%	0.446	S	S	.	.	H	α-helix	trans	-62.9	-42.9	-179.4	-68.9	167.8	0	0	0	110.8	W62 N63 A70	W62-I66 HydrophobicContact CE3-CD1 3.54Å; W62-I66 HydrophobicContact CE3-CG1 3.79Å; W62-I66 HydrophobicContact CZ3-CD1 4.01Å; W62-I66 HydrophobicContact CZ3-CG1 4.11Å; W62-I66 WeakPolarHBondContact O-CB 3.49Å; W62-I66 VanDerWaalsContact O-CG1 3.28Å; W62-I66 WeakPolarHBondContact O-CG1 3.37Å; W62-I66 PolarHBondContact O-N 2.88Å; N63-I66 PolarHBondContact O-N 3.25Å; I66-A70 WeakPolarHBondContact O-CB 3.31Å; I66-A70 PolarHBondContact O-N 2.98Å
67	S	83.2	Confident	81	Confident	1 Å²	1	79.9 Å²	79.9	1%	0.007	44%	0.441	C	S	.	.	H	α-helix	trans	-61.7	-46.7	179.4	179.7	0	0	0	0	111.4	T42 L45 N63 L65 S71	T42-S67 PolarHBondContact O-OG 3.41Å; T42-S67 VanDerWaalsContact O-OG 3.09Å; L45-S67 WeakPolarHBondContact CB-OG 3.11Å; N63-S67 WeakPolarHBondContact O-CB 3.48Å; N63-S67 PolarHBondContact O-N 2.98Å; L65-S67 PolarHBondContact O-N 2.92Å; S67-S71 WeakPolarHBondContact O-CB 3.27Å; S67-S71 PolarHBondContact O-N 3.11Å
68	T	85.3	Confident	81.7	Confident	56 Å²	56	75.8 Å²	75.8	34%	0.344	41%	0.414	S	S	.	.	H	α-helix	trans	-68	-43.4	-179.4	-50.8	0	0	0	0	111.5	F38 L64 L65 S71 S72	F38-T68 HydrophobicContact CZ-CG2 4.28Å; L64-T68 WeakPolarHBondContact O-CB 3.35Å; L64-T68 PolarHBondContact O-N 2.89Å; L64-T68 PolarHBondContact O-OG1 3.28Å; L65-T68 PolarHBondContact O-N 3.15Å; T68-S71 PolarHBondContact O-N 3.31Å; T68-S72 VanDerWaalsContact O-CB 3.27Å; T68-S72 WeakPolarHBondContact O-CB 2.97Å; T68-S72 PolarHBondContact O-N 3.38Å
69	A	89.5	Confident	82.4	Confident	58 Å²	58	69.7 Å²	69.7	48%	0.479	39%	0.394	S	S	.	.	H	α-helix	trans	-64.1	-47.7	178	0	0	0	0	0	111.6	L65 S71 S72 V73	L65-A69 VanDerWaalsContact O-CB 3.28Å; L65-A69 WeakPolarHBondContact O-CB 3.26Å; L65-A69 PolarHBondContact O-N 2.92Å; A69-S71 PolarHBondContact O-N 3.37Å; A69-S72 PolarHBondContact O-N 3.37Å; A69-V73 WeakPolarHBondContact O-CG2 3.42Å; A69-V73 PolarHBondContact O-N 3.38Å
70	A	87.7	Confident	82.8	Confident	50 Å²	50	70.6 Å²	70.6	41%	0.413	39%	0.387	S	S	.	.	H	α-helix	trans	-63	-43.2	177.7	0	0	0	0	0	111.7	L45 I66 V73 G74	L45-A70 HydrophobicContact CD1-CB 3.94Å; I66-A70 WeakPolarHBondContact O-CB 3.31Å; I66-A70 PolarHBondContact O-N 2.98Å; A70-V73 PolarHBondContact O-N 3.01Å; A70-G74 PolarHBondContact O-N 2.84Å
71	S	86.4	Confident	83.6	Confident	5 Å²	5	73.7 Å²	73.7	4%	0.035	39%	0.392	C	S	.	.	H	α-helix	trans	-64.2	-40.4	176.5	-173.8	0	0	0	0	112.1	F38 T42 S67 T68 A69 G74 S75	F38-S71 VanDerWaalsContact CD2-OG 3.23Å; F38-S71 WeakPolarHBondContact CD2-OG 3.11Å; F38-S71 PolarHBondContact O-OG 2.92Å; T42-S71 PolarHBondContact N-OG 3.33Å; T42-S71 WeakPolarHBondContact OG1-CB 3.38Å; T42-S71 PolarHBondContact OG1-OG 2.68Å; S67-S71 WeakPolarHBondContact O-CB 3.27Å; S67-S71 PolarHBondContact O-N 3.11Å; T68-S71 PolarHBondContact O-N 3.31Å; A69-S71 PolarHBondContact O-N 3.37Å; S71-G74 PolarHBondContact O-N 3.41Å; S71-S75 VanDerWaalsContact O-CB 3.24Å; S71-S75 WeakPolarHBondContact O-CB 3.45Å; S71-S75 PolarHBondContact O-N 3.28Å; S71-S75 PolarHBondContact O-OG 3.26Å
72	S	86.5	Confident	83.8	Confident	64 Å²	64	67.2 Å²	67.2	45%	0.448	36%	0.362	S	S	.	.	H	α-helix	trans	-60.9	-50.4	176.7	-178.2	0	0	0	0	111.6	T68 A69 G74 S75 Y76	T68-S72 VanDerWaalsContact O-CB 3.27Å; T68-S72 WeakPolarHBondContact O-CB 2.97Å; T68-S72 PolarHBondContact O-N 3.38Å; A69-S72 PolarHBondContact O-N 3.37Å; S72-G74 PolarHBondContact O-N 3.24Å; S72-S75 PolarHBondContact O-N 3.11Å; S72-Y76 WeakPolarHBondContact O-CB 3.42Å; S72-Y76 PolarHBondContact O-N 3.4Å
73	V	90.8	Very high	83.9	Confident	105 Å²	105	61.4 Å²	61.4	64%	0.636	34%	0.344	S	S	*	.	H	α-helix	trans	-61.6	-44.8	177.7	175.2	0	0	0	0	111.1	A69 A70 S75 Y76 A77	A69-V73 WeakPolarHBondContact O-CG2 3.42Å; A69-V73 PolarHBondContact O-N 3.38Å; A70-V73 PolarHBondContact O-N 3.01Å; V73-S75 PolarHBondContact O-N 3.21Å; V73-Y76 PolarHBondContact O-N 3.36Å; V73-A77 WeakPolarHBondContact O-CB 3.16Å; V73-A77 PolarHBondContact O-N 2.93Å
74	G	87.1	Confident	84.1	Confident	35 Å²	35	64.4 Å²	64.4	36%	0.361	36%	0.358	S	S	.	.	H	α-helix	trans	-61.7	-43.3	177.5	0	0	0	0	0	112.6	A70 S71 S72 A77 V78	A70-G74 PolarHBondContact O-N 2.84Å; S71-G74 PolarHBondContact O-N 3.41Å; S72-G74 PolarHBondContact O-N 3.24Å; G74-A77 PolarHBondContact O-N 2.92Å; G74-V78 WeakPolarHBondContact O-CG2 3.36Å; G74-V78 PolarHBondContact O-N 3.18Å
75	S	81.2	Confident	84.2	Confident	10 Å²	10	64 Å²	64	7%	0.07	35%	0.352	C	S	.	.	H	α-helix	trans	-68.6	-39	179.7	-56.2	0	0	0	0	111.8	F38 S71 S72 V73 V78 T79	F38-S75 WeakPolarHBondContact CA-OG 3.39Å; F38-S75 WeakPolarHBondContact CB-OG 3.3Å; F38-S75 PolarHBondContact N-OG 3.06Å; F38-S75 VanDerWaalsContact N-OG 3.15Å; S71-S75 VanDerWaalsContact O-CB 3.24Å; S71-S75 WeakPolarHBondContact O-CB 3.45Å; S71-S75 PolarHBondContact O-N 3.28Å; S71-S75 PolarHBondContact O-OG 3.26Å; S72-S75 PolarHBondContact O-N 3.11Å; V73-S75 PolarHBondContact O-N 3.21Å; S75-V78 PolarHBondContact O-N 2.97Å; S75-T79 VanDerWaalsContact O-CB 3.31Å; S75-T79 WeakPolarHBondContact O-CB 3.28Å; S75-T79 PolarHBondContact O-N 2.02Å; S75-T79 PolarHBondContact O-OG1 3.17Å
76	Y	84.5	Confident	83.9	Confident	137 Å²	137	58.4 Å²	58.4	54%	0.537	32%	0.323	S	S	.	.	H	α-helix	trans	-62	-45.9	173.1	-179.3	-102	0	0	0	111.1	S72 V73 V78 T79 R80	S72-Y76 WeakPolarHBondContact O-CB 3.42Å; S72-Y76 PolarHBondContact O-N 3.4Å; V73-Y76 PolarHBondContact O-N 3.36Å; Y76-V78 PolarHBondContact O-N 3.15Å; Y76-T79 PolarHBondContact O-N 3.37Å; Y76-R80 VanDerWaalsContact O-CB 3.25Å; Y76-R80 WeakPolarHBondContact O-CB 3.49Å; Y76-R80 PolarHBondContact O-N 2.83Å
77	A	86.1	Confident	83.6	Confident	55 Å²	55	56.3 Å²	56.3	46%	0.455	31%	0.314	S	S	.	.	H	α-helix	trans	-61.4	-45.1	177.9	0	0	0	0	0	112.2	V73 G74 R80 W81	V73-A77 WeakPolarHBondContact O-CB 3.16Å; V73-A77 PolarHBondContact O-N 2.93Å; G74-A77 PolarHBondContact O-N 2.92Å; A77-R80 PolarHBondContact O-N 2.97Å; A77-W81 WeakPolarHBondContact O-CB 3.47Å; A77-W81 PolarHBondContact O-N 3.4Å
78	V	82.6	Confident	83.5	Confident	42 Å²	42	58.9 Å²	58.9	26%	0.255	33%	0.328	S	S	.	.	H	α-helix	trans	-62.9	-46.5	175.8	170	0	0	0	0	111.2	T37 G74 S75 Y76 R80 W81 E82	T37-V78 HydrophobicContact CG2-CG1 4.21Å; G74-V78 WeakPolarHBondContact O-CG2 3.36Å; G74-V78 PolarHBondContact O-N 3.18Å; S75-V78 PolarHBondContact O-N 2.97Å; Y76-V78 PolarHBondContact O-N 3.15Å; V78-R80 VanDerWaalsContact C-N 3.32Å; V78-R80 PolarHBondContact O-N 3.45Å; V78-W81 PolarHBondContact O-N 3.43Å; V78-E82 HydrophobicContact CG1-CG 4.38Å; V78-E82 WeakPolarHBondContact O-CG 3.45Å; V78-E82 PolarHBondContact O-N 3.33Å
79	T	80.4	Confident	83.1	Confident	34 Å²	34	60.6 Å²	60.6	21%	0.209	34%	0.335	C	S	.	.	H	α-helix	trans	-59.8	-46	178.5	-53.7	0	0	0	0	110.3	G34 S75 Y76 W81 E82 T83	G34-T79 VanDerWaalsContact CA-OG1 3.26Å; G34-T79 WeakPolarHBondContact CA-OG1 3.48Å; S75-T79 VanDerWaalsContact O-CB 3.31Å; S75-T79 WeakPolarHBondContact O-CB 3.28Å; S75-T79 PolarHBondContact O-N 2.02Å; S75-T79 PolarHBondContact O-OG1 3.17Å; Y76-T79 PolarHBondContact O-N 3.37Å; T79-W81 VanDerWaalsContact C-N 3.31Å; T79-W81 PolarHBondContact O-N 3.49Å; T79-E82 PolarHBondContact O-N 3.4Å; T79-T83 WeakPolarHBondContact O-CG2 3.48Å; T79-T83 PolarHBondContact O-N 3.28Å; T79-T83 PolarHBondContact O-OG1 3.41Å
80	R	79.1	Confident	82.5	Confident	92 Å²	92	60.2 Å²	60.2	35%	0.347	32%	0.321	S	S	.	.	H	α-helix	trans	-63.5	-37.1	178.8	-158.9	176.9	-159.9	177.6	3.5	111.5	Y76 A77 V78 T83 M84 E107	Y76-R80 VanDerWaalsContact O-CB 3.25Å; Y76-R80 WeakPolarHBondContact O-CB 3.49Å; Y76-R80 PolarHBondContact O-N 2.83Å; A77-R80 PolarHBondContact O-N 2.97Å; V78-R80 VanDerWaalsContact C-N 3.32Å; V78-R80 PolarHBondContact O-N 3.45Å; R80-T83 WeakPolarHBondContact CA-OG1 3.28Å; R80-T83 PolarHBondContact O-OG1 3.47Å; R80-M84 WeakPolarHBondContact O-CG 3.38Å; R80-M84 PolarHBondContact O-N 3Å; R80-M84 VanDerWaalsContact O-N 3.11Å; R80-E107 PolarHBondContact NH1-O 3.39Å
81	W	83.1	Confident	81.9	Confident	168 Å²	168	59.1 Å²	59.1	64%	0.636	31%	0.308	S	S	*	.	H	α-helix	trans	-69.8	-43.5	176.7	-175	19.5	0	0	0	112.1	A77 V78 T79 M84 K85	A77-W81 WeakPolarHBondContact O-CB 3.47Å; A77-W81 PolarHBondContact O-N 3.4Å; V78-W81 PolarHBondContact O-N 3.43Å; T79-W81 VanDerWaalsContact C-N 3.31Å; T79-W81 PolarHBondContact O-N 3.49Å; W81-M84 WeakPolarHBondContact O-CB 3.46Å; W81-M84 PolarHBondContact O-N 3.01Å; W81-K85 PolarHBondContact O-N 3.48Å; W81-K85 VanDerWaalsContact O-N 3.16Å
82	E	82.1	Confident	81.4	Confident	25 Å²	25	62.6 Å²	62.6	12%	0.117	33%	0.326	C	S	.	.	H	α-helix	trans	-68	-38.2	178.6	-68.1	-67.4	158.4	0	0	111.9	A30 K33 V78 T79 M84 K85 C86	A30-E82 HydrophobicContact CB-CB 3.64Å; K33-E82 HydrophobicContact CD-CG 3.99Å; K33-E82 VanDerWaalsContact NZ-CD 3.34Å; K33-E82 IonicContact NZ-OE1 3.91Å; K33-E82 PolarHBondContact NZ-OE1 2.98Å; K33-E82 IonicContact NZ-OE2 2.71Å; V78-E82 HydrophobicContact CG1-CG 4.38Å; V78-E82 WeakPolarHBondContact O-CG 3.45Å; V78-E82 PolarHBondContact O-N 3.33Å; T79-E82 PolarHBondContact O-N 3.4Å; E82-M84 VanDerWaalsContact C-N 3.32Å; E82-M84 PolarHBondContact O-N 3.46Å; E82-K85 WeakPolarHBondContact O-CB 2.99Å; E82-K85 PolarHBondContact O-N 2.94Å; E82-K85 IonicContact OE1-NZ 2.97Å; E82-K85 PolarHBondContact OE1-NZ 3.05Å; E82-K85 IonicContact OE2-NZ 3.86Å; E82-C86 PolarHBondContact O-N 3.17Å; E82-C86 VanDerWaalsContact O-N 3.12Å; E82-C86 PolarHBondContact O-SG 3.31Å
83	T	80.3	Confident	80.8	Confident	36 Å²	36	63.1 Å²	63.1	22%	0.221	32%	0.323	C	S	.	.	H	α-helix	trans	-64.3	-37.4	172.7	47.5	0	0	0	0	112.1	A30 T79 R80 K85 C86 T87	A30-T83 HydrophobicContact CB-CG2 3.92Å; T79-T83 WeakPolarHBondContact O-CG2 3.48Å; T79-T83 PolarHBondContact O-N 3.28Å; T79-T83 PolarHBondContact O-OG1 3.41Å; R80-T83 WeakPolarHBondContact CA-OG1 3.28Å; R80-T83 PolarHBondContact O-OG1 3.47Å; T83-K85 VanDerWaalsContact C-N 3.31Å; T83-K85 PolarHBondContact O-N 3.38Å; T83-C86 WeakPolarHBondContact O-CB 3.43Å; T83-C86 PolarHBondContact O-N 3.19Å; T83-C86 VanDerWaalsContact O-N 3.15Å; T83-T87 PolarHBondContact O-N 3.47Å; T83-T87 PolarHBondContact O-OG1 3.17Å; T83-T87 VanDerWaalsContact O-OG1 3.11Å
84	M	80.7	Confident	79.8	Confident	83 Å²	83	61.6 Å²	61.6	41%	0.409	31%	0.308	S	S	.	.	H	α-helix	trans	-61	-39	174.5	-71	-72.8	-177.3	0	0	112.2	R80 W81 E82 C86 T87 D88 R101	R80-M84 WeakPolarHBondContact O-CG 3.38Å; R80-M84 PolarHBondContact O-N 3Å; R80-M84 VanDerWaalsContact O-N 3.11Å; W81-M84 WeakPolarHBondContact O-CB 3.46Å; W81-M84 PolarHBondContact O-N 3.01Å; E82-M84 VanDerWaalsContact C-N 3.32Å; E82-M84 PolarHBondContact O-N 3.46Å; M84-C86 VanDerWaalsContact C-N 3.34Å; M84-T87 PolarHBondContact O-N 2.9Å; M84-D88 WeakPolarHBondContact O-CB 3.38Å; M84-D88 PolarHBondContact O-N 3.28Å; M84-R101 PolarHBondContact SD-NH1 2.69Å
85	K	81	Confident	79.2	Confident	85 Å²	85	63.6 Å²	63.6	37%	0.37	31%	0.314	S	S	.	.	H	α-helix	trans	-63.7	-40	174.4	-65.4	175	-170.7	169	0	111.9	W81 E82 T83 T87 D88 L89	W81-K85 PolarHBondContact O-N 3.48Å; W81-K85 VanDerWaalsContact O-N 3.16Å; E82-K85 WeakPolarHBondContact O-CB 2.99Å; E82-K85 PolarHBondContact O-N 2.94Å; E82-K85 IonicContact OE1-NZ 2.97Å; E82-K85 PolarHBondContact OE1-NZ 3.05Å; E82-K85 IonicContact OE2-NZ 3.86Å; T83-K85 VanDerWaalsContact C-N 3.31Å; T83-K85 PolarHBondContact O-N 3.38Å; K85-T87 VanDerWaalsContact C-N 3.35Å; K85-D88 PolarHBondContact O-N 2.95Å; K85-L89 PolarHBondContact O-N 3.49Å; K85-L89 VanDerWaalsContact O-N 3.09Å
86	C	80	Confident	78.6	Confident	4 Å²	4	66 Å²	66	3%	0.027	34%	0.341	C	S	.	.	H	α-helix	trans	-62.8	-42.3	176	-61.2	0	0	0	0	111.9	Y23 C26 E82 T83 M84 W90	Y23-C86 HydrophobicContact CD2-CB 4.19Å; Y23-C86 HydrophobicContact CE2-CB 4.28Å; C26-C86 HydrophobicContact CB-CB 3.59Å; C26-C86 WeakPolarHBondContact CB-SG 3.28Å; C26-C86 PolarHBondContact O-SG 3.35Å; C26-C86 VanDerWaalsContact O-SG 3.37Å; C26-C86 WeakPolarHBondContact SG-CA 3.25Å; C26-C86 WeakPolarHBondContact SG-CB 3.02Å; C26-C86 CovalentContact SG-SG 2.02Å; C26-C86 PolarHBondContact SG-SG 3.07Å; E82-C86 PolarHBondContact O-N 3.17Å; E82-C86 VanDerWaalsContact O-N 3.12Å; E82-C86 PolarHBondContact O-SG 3.31Å; T83-C86 WeakPolarHBondContact O-CB 3.43Å; T83-C86 PolarHBondContact O-N 3.19Å; T83-C86 VanDerWaalsContact O-N 3.15Å; M84-C86 VanDerWaalsContact C-N 3.34Å; C86-W90 PolarHBondContact O-N 3.45Å
87	T	79.2	Confident	77.6	Confident	37 Å²	37	67.3 Å²	67.3	23%	0.227	35%	0.349	C	S	.	.	H	α-helix	trans	-65.4	-41.2	177	-53.7	0	0	0	0	111.5	T83 M84 K85 W90 M91	T83-T87 PolarHBondContact O-N 3.47Å; T83-T87 PolarHBondContact O-OG1 3.17Å; T83-T87 VanDerWaalsContact O-OG1 3.11Å; M84-T87 PolarHBondContact O-N 2.9Å; K85-T87 VanDerWaalsContact C-N 3.35Å; T87-W90 WeakPolarHBondContact O-CB 3.45Å; T87-W90 PolarHBondContact O-N 2.79Å; T87-M91 HydrophobicContact CG2-CG 4.46Å; T87-M91 VanDerWaalsContact O-CG 3.28Å; T87-M91 WeakPolarHBondContact O-CG 3.5Å; T87-M91 PolarHBondContact O-N 2.98Å
88	D	79.3	Confident	76.5	Confident	55 Å²	55	68.3 Å²	68.3	29%	0.294	35%	0.349	S	S	.	.	H	α-helix	trans	-63.4	-43.6	179.7	-172.1	35.3	0	0	0	112.6	M84 K85 W90 M91 L92 V98 P99	M84-D88 WeakPolarHBondContact O-CB 3.38Å; M84-D88 PolarHBondContact O-N 3.28Å; K85-D88 PolarHBondContact O-N 2.95Å; D88-W90 VanDerWaalsContact C-N 3.31Å; D88-W90 PolarHBondContact O-N 2.76Å; D88-M91 WeakPolarHBondContact O-CB 3.34Å; D88-M91 PolarHBondContact O-N 3.42Å; D88-L92 WeakPolarHBondContact O-CB 3.47Å; D88-L92 PolarHBondContact O-N 2.89Å; D88-V98 WeakPolarHBondContact OD1-CG1 3.5Å; D88-P99 VanDerWaalsContact OD1-CD 3.3Å; D88-P99 WeakPolarHBondContact OD1-CD 3.19Å
89	L	78.6	Confident	75.4	Confident	93 Å²	93	68.6 Å²	68.6	49%	0.487	35%	0.352	S	S	.	.	H	α-helix	trans	-60.8	-42.1	174.9	-162.3	86.4	0	0	0	111.7	K85 L92 I93	K85-L89 PolarHBondContact O-N 3.49Å; K85-L89 VanDerWaalsContact O-N 3.09Å; L89-L92 PolarHBondContact O-N 3.35Å; L89-I93 HydrophobicContact CD2-CD1 4.38Å; L89-I93 HydrophobicContact CG-CD1 4.26Å; L89-I93 WeakPolarHBondContact O-CD1 3.29Å; L89-I93 VanDerWaalsContact O-CG1 3.28Å; L89-I93 WeakPolarHBondContact O-CG1 3.49Å; L89-I93 PolarHBondContact O-N 3.39Å
90	W	76.8	Confident	74.1	Confident	49 Å²	49	74.7 Å²	74.7	19%	0.186	38%	0.383	C	S	.	.	H	α-helix	trans	-62.4	-45.9	176.4	177.6	60.9	0	0	0	111.6	Y23 C86 T87 D88 L92 I93 E94 Y121	Y23-W90 HydrophobicContact CD2-CB 4.38Å; C86-W90 PolarHBondContact O-N 3.45Å; T87-W90 WeakPolarHBondContact O-CB 3.45Å; T87-W90 PolarHBondContact O-N 2.79Å; D88-W90 VanDerWaalsContact C-N 3.31Å; D88-W90 PolarHBondContact O-N 2.76Å; W90-L92 VanDerWaalsContact C-N 3.31Å; W90-L92 PolarHBondContact O-N 3.05Å; W90-I93 PolarHBondContact O-N 3.44Å; W90-E94 WeakPolarHBondContact O-CB 3.42Å; W90-E94 PolarHBondContact O-N 2.74Å; W90-Y121 HydrophobicContact CH2-CD1 4.45Å; W90-Y121 HydrophobicContact CH2-CE1 4.13Å; W90-Y121 HydrophobicContact CZ3-CE1 4.01Å; W90-Y121 AromaticContact CZ3-CZ 3.92Å
91	M	73.9	Confident	73.2	Confident	27 Å²	27	78.6 Å²	78.6	13%	0.133	40%	0.398	C	S	.	.	H	α-helix	trans	-59.1	-40.7	175.8	-72.4	-59.3	-73.1	0	0	112.8	T87 D88 E94 T95 P99 Y121	T87-M91 HydrophobicContact CG2-CG 4.46Å; T87-M91 VanDerWaalsContact O-CG 3.28Å; T87-M91 WeakPolarHBondContact O-CG 3.5Å; T87-M91 PolarHBondContact O-N 2.98Å; D88-M91 WeakPolarHBondContact O-CB 3.34Å; D88-M91 PolarHBondContact O-N 3.42Å; M91-E94 PolarHBondContact O-N 3.4Å; M91-T95 HydrophobicContact CE-CG2 4.24Å; M91-T95 WeakPolarHBondContact O-CB 3.37Å; M91-T95 PolarHBondContact O-N 2.98Å; M91-T95 PolarHBondContact O-OG1 3.03Å; M91-P99 HydrophobicContact CG-CG 4.45Å; M91-Y121 HydrophobicContact CE-CE1 3.64Å; M91-Y121 HydrophobicContact SD-CE1 3.34Å; M91-Y121 WeakPolarHBondContact SD-CE1 3.4Å; M91-Y121 VanDerWaalsContact SD-CZ 3.59Å; M91-Y121 PolarHBondContact SD-OH 3.47Å
92	L	76.9	Confident	71.4	Confident	79 Å²	79	76.1 Å²	76.1	41%	0.414	40%	0.402	S	S	.	.	H	α-helix	trans	-65.8	-40	177.7	-179.7	135.4	0	0	0	111.9	D88 L89 W90 E94 G96 V98	D88-L92 WeakPolarHBondContact O-CB 3.47Å; D88-L92 PolarHBondContact O-N 2.89Å; L89-L92 PolarHBondContact O-N 3.35Å; W90-L92 VanDerWaalsContact C-N 3.31Å; W90-L92 PolarHBondContact O-N 3.05Å; L92-E94 VanDerWaalsContact C-N 3.35Å; L92-G96 WeakPolarHBondContact O-CA 3.48Å; L92-G96 PolarHBondContact O-N 3.44Å; L92-V98 HydrophobicContact CD1-CG2 3.52Å
93	I	72.4	Confident	70	Confident	75 Å²	75	80.7 Å²	80.7	39%	0.385	43%	0.434	S	S	.	.	H	α-helix	trans	-67.4	-38.8	177.7	-67	163.2	0	0	0	110.8	L89 W90	L89-I93 HydrophobicContact CD2-CD1 4.38Å; L89-I93 HydrophobicContact CG-CD1 4.26Å; L89-I93 WeakPolarHBondContact O-CD1 3.29Å; L89-I93 VanDerWaalsContact O-CG1 3.28Å; L89-I93 WeakPolarHBondContact O-CG1 3.49Å; L89-I93 PolarHBondContact O-N 3.39Å; W90-I93 PolarHBondContact O-N 3.44Å
94	E	71.6	Confident	68.2	Low	73 Å²	73	85.8 Å²	85.8	34%	0.341	46%	0.459	S	S	.	.	H	α-helix	trans	-82.6	-39.9	-175	-159.9	67.5	-151.3	0	0	113	H17 W90 M91 L92	H17-E94 IonicContact CE1-OE1 2.74Å; H17-E94 PolarHBondContact CE1-OE1 3.49Å; H17-E94 IonicContact CG-OE1 3.44Å; H17-E94 IonicContact ND1-OE1 3.67Å; H17-E94 PolarHBondContact ND1-OE1 3.14Å; H17-E94 IonicContact ND1-OE2 3.78Å; W90-E94 WeakPolarHBondContact O-CB 3.42Å; W90-E94 PolarHBondContact O-N 2.74Å; M91-E94 PolarHBondContact O-N 3.4Å; L92-E94 VanDerWaalsContact C-N 3.35Å
95	T	73.7	Confident	66.3	Low	76 Å²	76	88.6 Å²	88.6	47%	0.466	47%	0.474	S	S	.	.	H	α-helix	trans	-115	-11.8	-171.2	69.4	0	0	0	0	114.3	M91 K97	M91-T95 HydrophobicContact CE-CG2 4.24Å; M91-T95 WeakPolarHBondContact O-CB 3.37Å; M91-T95 PolarHBondContact O-N 2.98Å; M91-T95 PolarHBondContact O-OG1 3.03Å; T95-K97 PolarHBondContact O-N 3.39Å; T95-K97 PolarHBondContact OG1-N 3.44Å; T95-K97 PolarHBondContact OG1-O 2.87Å
96	G	67.8	Low	65	Low	62 Å²	62	89.1 Å²	89.1	64%	0.639	49%	0.494	S	S	*	.	S	Bend	trans	69.2	7.5	-173.6	0	0	0	0	0	114.6	L92	L92-G96 WeakPolarHBondContact O-CA 3.48Å; L92-G96 PolarHBondContact O-N 3.44Å
97	K	64.4	Low	62.8	Low	163 Å²	163	96.5 Å²	96.5	71%	0.709	53%	0.528	S	S	*	.			trans	-127	136.4	179.4	-87.9	179.3	175	169	0	111.7	T95	T95-K97 PolarHBondContact O-N 3.39Å; T95-K97 PolarHBondContact OG1-N 3.44Å; T95-K97 PolarHBondContact OG1-O 2.87Å
98	V	62.7	Low	60.8	Low	76 Å²	76	100 Å²	100	46%	0.461	55%	0.551	S	S	.	*			trans	-83.9	122.8	170.3	178.9	0	0	0	0	108.1	D88 L92 D100	D88-V98 WeakPolarHBondContact OD1-CG1 3.5Å; L92-V98 HydrophobicContact CD1-CG2 3.52Å; V98-D100 PolarHBondContact O-N 3.41Å
99	P	59.6	Low	59	Low	49 Å²	49	101.5 Å²	101.5	32%	0.318	57%	0.571	S	S	.	*			trans	-64.1	114.4	166.5	23.2	-32.9	0	0	0	110.9	D88 M91 R101	D88-P99 VanDerWaalsContact OD1-CD 3.3Å; D88-P99 WeakPolarHBondContact OD1-CD 3.19Å; M91-P99 HydrophobicContact CG-CG 4.45Å; P99-R101 PolarHBondContact O-N 3.01Å
100	D	53.2	Low	57	Low	161 Å²	161	102.8 Å²	102.8	86%	0.861	59%	0.586	S	S	*	*			trans	-61.1	106.4	172.4	-101	-40.3	0	0	0	110.2	V98	V98-D100 PolarHBondContact O-N 3.41Å
101	R	60.2	Low	55.1	Low	174 Å²	174	109.1 Å²	109.1	66%	0.657	62%	0.617	S	S	*	*			trans	-122.4	85.4	174.4	-70.3	-175.9	170.8	177.3	-0.4	109.3	M84 P99	M84-R101 PolarHBondContact SD-NH1 2.69Å; P99-R101 PolarHBondContact O-N 3.01Å
102	T	46	Very low	53.6	Low	117 Å²	117	117.1 Å²	117.1	72%	0.718	65%	0.654	S	S	*	*			trans	-54.2	129	168.4	-45.7	0	0	0	0	109.2	L104	T102-L104 PolarHBondContact O-N 3.41Å
103	P	52.1	Low	51.8	Low	121 Å²	121	117.3 Å²	117.3	79%	0.786	66%	0.66	S	S	*	*			trans	-78.2	93.9	-167.1	31.1	-33.6	0	0	0	110.3
104	L	43	Very low	50.3	Low	142 Å²	142	119 Å²	119	74%	0.743	69%	0.685	S	S	*	*			trans	-105.1	108.3	168	-71.1	167.9	0	0	0	108.6	T102	T102-L104 PolarHBondContact O-N 3.41Å
105	I	39.3	Very low	48.8	Very low	143 Å²	143	118 Å²	118	73%	0.733	69%	0.694	S	S	*	*				48.3	121.6	129.1	-55.5	167.9	0	0	0	115.6	E107	I105-E107 PolarHBondContact O-N 2.97Å; I105-E107 VanDerWaalsContact O-N 3.17Å
106	A	53.7	Low	47.5	Very low	96 Å²	96	119.7 Å²	119.7	79%	0.793	71%	0.706	S	S	*	*			trans	-32	115.1	170.4	0	0	0	0	0	114.1
107	E	34.2	Very low	46.6	Very low	159 Å²	159	122.4 Å²	122.4	74%	0.743	70%	0.701	S	S	*	*			trans	-129.4	144	159.7	-89.6	-171.9	130.3	0	0	111.4	R80 I105	R80-E107 PolarHBondContact NH1-O 3.39Å; I105-E107 PolarHBondContact O-N 2.97Å; I105-E107 VanDerWaalsContact O-N 3.17Å
108	P	38.2	Very low	45.7	Very low	109 Å²	109	122.5 Å²	122.5	71%	0.708	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-70	166.5	-172.9	33.3	-36.5	0	0	0	110.8	P110	P108-P110 WeakPolarHBondContact O-CD 3.11Å
109	A	41.8	Very low	45.8	Very low	87 Å²	87	120.7 Å²	120.7	72%	0.719	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-47.4	130	178.9	0	0	0	0	0	112.3
110	P	36.5	Very low	45.5	Very low	121 Å²	121	124.3 Å²	124.3	79%	0.786	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-86.2	128.1	162.2	-3.6	22.6	0	0	0	109.5	P108	P108-P110 WeakPolarHBondContact O-CD 3.11Å
111	E	35.6	Very low	45.5	Very low	181 Å²	181	121.7 Å²	121.7	85%	0.846	69%	0.693	S	S	*	*	P	Polyproline II helix	trans	-51.4	151.8	174.7	-64.1	167.5	141.5	0	0	113.3	P113	E111-P113 VanDerWaalsContact O-CD 3.29Å; E111-P113 WeakPolarHBondContact O-CD 3.45Å
112	E	42.7	Very low	45	Very low	196 Å²	196	116.2 Å²	116.2	92%	0.916	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-54.6	138.1	166.4	-76.6	-178.8	111.1	0	0	111.5
113	P	39.3	Very low	45.4	Very low	83 Å²	83	115.6 Å²	115.6	54%	0.539	68%	0.683	S	S	.	*			trans	-113.4	129.7	143.3	31.2	-30.5	0	0	0	111.9	E111 K117	E111-P113 VanDerWaalsContact O-CD 3.29Å; E111-P113 WeakPolarHBondContact O-CD 3.45Å; P113-K117 VanDerWaalsContact CD-NZ 3.29Å; P113-K117 VanDerWaalsContact CG-NZ 3.32Å; P113-K117 WeakPolarHBondContact O-CE 2.95Å; P113-K117 PolarHBondContact O-NZ 3.49Å
114	A	40.1	Very low	45.2	Very low	110 Å²	110	114.3 Å²	114.3	91%	0.909	67%	0.672	S	S	*	*			trans	-62	129.4	172.5	0	0	0	0	0	112
115	G	40.8	Very low	45.5	Very low	51 Å²	51	113.1 Å²	113.1	53%	0.526	67%	0.665	S	S	.	*	S	Bend	trans	148.2	147.7	174.7	0	0	0	0	0	111.3	K117	G115-K117 PolarHBondContact O-N 3.22Å
116	P	46.3	Very low	45.6	Very low	112 Å²	112	118.8 Å²	118.8	73%	0.727	69%	0.688	S	S	*	*			trans	-69.2	105	-174	27.5	-32.4	0	0	0	109.7
117	K	49.5	Very low	45.2	Very low	119 Å²	119	119.9 Å²	119.9	52%	0.517	68%	0.682	S	S	.	*	P	Polyproline II helix	trans	-92.3	119.4	-179.9	-72	174.1	-173.6	171.3	0	108.8	P113 G115 T119	P113-K117 VanDerWaalsContact CD-NZ 3.29Å; P113-K117 VanDerWaalsContact CG-NZ 3.32Å; P113-K117 WeakPolarHBondContact O-CE 2.95Å; P113-K117 PolarHBondContact O-NZ 3.49Å; G115-K117 PolarHBondContact O-N 3.22Å; K117-T119 PolarHBondContact O-N 3.3Å
118	K	44.5	Very low	45.8	Very low	165 Å²	165	117.8 Å²	117.8	72%	0.717	68%	0.679	S	S	*	*	B	Isolated β-bridge	trans	-66.8	122.6	160.4	-64.5	-168.9	176.9	-175	0	107.5	V124	K118-V124 HydrophobicContact CG-CG2 4.4Å
119	T	65.5	Low	46.2	Very low	39 Å²	39	118.3 Å²	118.3	24%	0.239	68%	0.678	C	S	.	*	P	Polyproline II helix	trans	-69.8	155.9	177.8	68.3	0	0	0	0	108.9	K117 Y121 G122 D123 M125	K117-T119 PolarHBondContact O-N 3.3Å; T119-Y121 PolarHBondContact O-N 2.96Å; T119-Y121 PolarHBondContact OG1-N 3Å; T119-G122 PolarHBondContact O-N 3.42Å; T119-D123 PolarHBondContact N-O 2.77Å; T119-D123 PolarHBondContact OG1-N 2.98Å; T119-D123 PolarHBondContact OG1-O 2.96Å; T119-M125 HydrophobicContact CG2-CG 3.89Å; T119-M125 HydrophobicContact CG2-SD 4.43Å
120	P	53.8	Low	46.5	Very low	124 Å²	124	120.2 Å²	120.2	81%	0.805	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.6	-2.7	171.4	22.8	-32	0	0	0	113.7
121	Y	52.8	Low	47.1	Very low	106 Å²	106	120.1 Å²	120.1	42%	0.416	67%	0.668	S	S	.	*	T	Hydrogen-bonded Turn	trans	-100.1	2.3	177.1	-54.5	-75.6	0	0	0	113.4	W90 M91 T119 D123	W90-Y121 HydrophobicContact CH2-CD1 4.45Å; W90-Y121 HydrophobicContact CH2-CE1 4.13Å; W90-Y121 HydrophobicContact CZ3-CE1 4.01Å; W90-Y121 AromaticContact CZ3-CZ 3.92Å; M91-Y121 HydrophobicContact CE-CE1 3.64Å; M91-Y121 HydrophobicContact SD-CE1 3.34Å; M91-Y121 WeakPolarHBondContact SD-CE1 3.4Å; M91-Y121 VanDerWaalsContact SD-CZ 3.59Å; M91-Y121 PolarHBondContact SD-OH 3.47Å; T119-Y121 PolarHBondContact O-N 2.96Å; T119-Y121 PolarHBondContact OG1-N 3Å; Y121-D123 VanDerWaalsContact C-N 3.28Å; Y121-D123 PolarHBondContact O-N 3.3Å
122	G	50	Low	47.8	Very low	59 Å²	59	116.1 Å²	116.1	61%	0.608	66%	0.656	S	S	*	*	S	Bend	trans	83.6	-3	176.4	0	0	0	0	0	114.9	T119	T119-G122 PolarHBondContact O-N 3.42Å
123	D	54.6	Low	48.2	Very low	105 Å²	105	110.4 Å²	110.4	56%	0.561	64%	0.638	S	S	*	*			trans	-77.9	132.5	175.2	-65	-44.1	0	0	0	111.1	T119 Y121	T119-D123 PolarHBondContact N-O 2.77Å; T119-D123 PolarHBondContact OG1-N 2.98Å; T119-D123 PolarHBondContact OG1-O 2.96Å; Y121-D123 VanDerWaalsContact C-N 3.28Å; Y121-D123 PolarHBondContact O-N 3.3Å
124	V	47	Very low	48.9	Very low	93 Å²	93	112.5 Å²	112.5	56%	0.564	65%	0.645	S	S	*	*	B	Isolated β-bridge	trans	-88.5	113.4	172	-173.4	0	0	0	0	107.1	K118	K118-V124 HydrophobicContact CG-CG2 4.4Å
125	M	49.7	Very low	49.6	Very low	118 Å²	118	112.7 Å²	112.7	58%	0.581	62%	0.624	S	S	*	*			trans	-80.9	118.8	170	-57.5	-68.4	-78.3	0	0	107.7	T119	T119-M125 HydrophobicContact CG2-CG 3.89Å; T119-M125 HydrophobicContact CG2-SD 4.43Å
126	E	41	Very low	50.4	Low	261 Å²	261	118.3 Å²	118.3	100%	1.22	63%	0.632	S	S	*	*			trans	-76.7	0	167.5	-92.4	170.9	102.7	0	0	111.8

Retrieved 126 of 126 residues in 34.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).