A0A060WIA7_ONCMY Loading...

Si:ch73-238c9.1

AlphaFold DB , UniProt , Accession A0A060WIA7, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene c5h19orf25, Length 110 aa.

						>A0A060WIA7_ONCMY|A0A060WIA7|c5h19orf25
MNISMGAKNKKRVVLPSRPDPPTVEQILEDINRAFSNDPVFNVLEDGNQDTKRGSSDNEAETKYLQSRRYLEMNERLQEVRGELVQQREELWVAKEQLEKSVAEVKGRAL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.1	Very low	53.1	Low	235 Å²	235	159.6 Å²	159.6	100%	1.158	86%	0.855	S	S	*	*				0	130.3	0	-71.8	173	179.4	0	0	107.7
2	N	39.3	Very low	54.5	Low	167 Å²	167	165.3 Å²	165.3	89%	0.893	86%	0.855	S	S	*	*			trans	-176.7	97.4	146.7	-86.8	-14.1	0	0	0	107.3
3	I	49.2	Very low	55.8	Low	161 Å²	161	162.8 Å²	162.8	83%	0.826	85%	0.851	S	S	*	*			trans	-85.9	117.8	173.1	-62	158.9	0	0	0	105.8	M5	I3-M5 HydrophobicContact CG2-CG 4.12Å
4	S	44.2	Very low	57.3	Low	118 Å²	118	160.4 Å²	160.4	83%	0.825	85%	0.846	S	S	*	*			trans	-113.9	101.2	167.3	176.4	0	0	0	0	107.9	G6	S4-G6 PolarHBondContact O-N 3.36Å
5	M	49.6	Very low	58.9	Low	168 Å²	168	159 Å²	159	83%	0.828	84%	0.839	S	S	*	*	P	Polyproline II helix	trans	-67.4	121.8	176.1	-74.7	-131	-71.4	0	0	110.2	I3 A7	I3-M5 HydrophobicContact CG2-CG 4.12Å; M5-A7 PolarHBondContact O-N 3.13Å
6	G	48	Very low	60.3	Low	72 Å²	72	156.6 Å²	156.6	74%	0.742	84%	0.835	S	S	*	*	P	Polyproline II helix	trans	-58.8	118.2	172.9	0	0	0	0	0	111.6	S4 K8	S4-G6 PolarHBondContact O-N 3.36Å; G6-K8 PolarHBondContact O-N 3.27Å
7	A	58.3	Low	61.6	Low	89 Å²	89	154.1 Å²	154.1	74%	0.736	83%	0.833	S	S	*	*	P	Polyproline II helix	trans	-67.9	120.7	178.8	0	0	0	0	0	110.7	M5 N9	M5-A7 PolarHBondContact O-N 3.13Å; A7-N9 PolarHBondContact O-N 3.31Å; A7-N9 PolarHBondContact O-OD1 2.99Å
8	K	57	Low	63	Low	197 Å²	197	158.3 Å²	158.3	86%	0.857	84%	0.835	S	S	*	*	P	Polyproline II helix	trans	-70.6	123.5	179.4	-55.9	174	-173.4	179.5	0	110	G6 K10	G6-K8 PolarHBondContact O-N 3.27Å; K8-K10 PolarHBondContact O-N 2.99Å
9	N	61.3	Low	64.4	Low	152 Å²	152	155.8 Å²	155.8	81%	0.813	83%	0.829	S	S	*	*			trans	-68.2	96.9	-174.9	-36.3	3.7	0	0	0	109.6	A7 K11	A7-N9 PolarHBondContact O-N 3.31Å; A7-N9 PolarHBondContact O-OD1 2.99Å; N9-K11 PolarHBondContact O-N 3.49Å; N9-K11 VanDerWaalsContact O-N 3.12Å
10	K	64.1	Low	65.7	Low	195 Å²	195	155.6 Å²	155.6	85%	0.848	83%	0.828	S	S	*	*			trans	-72.6	101.7	169.1	-67.5	179.2	-179.1	176.9	0	108	K8 R12	K8-K10 PolarHBondContact O-N 2.99Å; K10-R12 PolarHBondContact O-N 3.4Å
11	K	66.2	Low	67	Low	202 Å²	202	153.2 Å²	153.2	88%	0.878	82%	0.821	S	S	*	*			trans	-60.3	105.8	170.5	-66.4	-168.9	-179.2	-177.2	0	107.5	N9 V13	N9-K11 PolarHBondContact O-N 3.49Å; N9-K11 VanDerWaalsContact O-N 3.12Å; K11-V13 PolarHBondContact O-N 3.43Å; K11-V13 VanDerWaalsContact O-N 3.14Å
12	R	69.1	Low	69.3	Low	227 Å²	227	146.1 Å²	146.1	86%	0.857	79%	0.793	S	S	*	*			trans	-60	116.2	173.5	-68.4	174	66	179.3	-0.1	106.4	K10 V14	K10-R12 PolarHBondContact O-N 3.4Å; R12-V14 PolarHBondContact O-N 2.88Å
13	V	71.9	Confident	72	Confident	133 Å²	133	141.3 Å²	141.3	81%	0.806	77%	0.77	S	S	*	*			trans	-66.3	102.7	171.3	177.2	0	0	0	0	106	K11 L15	K11-V13 PolarHBondContact O-N 3.43Å; K11-V13 VanDerWaalsContact O-N 3.14Å; V13-L15 PolarHBondContact O-N 3.39Å
14	V	77.1	Confident	74.2	Confident	129 Å²	129	138.2 Å²	138.2	78%	0.782	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-79.3	117	176.6	-178.7	0	0	0	0	106.4	R12	R12-V14 PolarHBondContact O-N 2.88Å
15	L	81.3	Confident	76.7	Confident	140 Å²	140	138.8 Å²	138.8	73%	0.733	75%	0.747	S	S	*	*	P	Polyproline II helix	trans	-62.9	150.1	174.8	-68.3	174.6	0	0	0	109.8	V13	V13-L15 PolarHBondContact O-N 3.39Å
16	P	81.3	Confident	78.9	Confident	120 Å²	120	135.4 Å²	135.4	78%	0.779	73%	0.73	S	S	*	*	P	Polyproline II helix	trans	-53.4	145.7	171.1	-21	31.5	0	0	0	110.7
17	S	81.9	Confident	81.1	Confident	114 Å²	114	135.7 Å²	135.7	80%	0.797	71%	0.713	S	S	*	*	P	Polyproline II helix	trans	-61	144.8	172.6	48.3	0	0	0	0	110.3
18	R	87.6	Confident	82.8	Confident	230 Å²	230	135.8 Å²	135.8	87%	0.868	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-59.4	136.6	173.3	-169.9	-177.1	-178.7	-167.4	-0.4	108.9
19	P	88.5	Confident	84.7	Confident	112 Å²	112	130.4 Å²	130.4	73%	0.727	68%	0.679	S	S	*	*	P	Polyproline II helix	trans	-58	153.1	170	-21.5	32.2	0	0	0	111.2
20	D	91.4	Very high	86.2	Confident	150 Å²	150	128.5 Å²	128.5	80%	0.802	67%	0.669	S	S	*	*	P	Polyproline II helix	trans	-63.8	148.7	171.3	-66.8	-43.5	0	0	0	110.5
21	P	93.5	Very high	87.5	Confident	107 Å²	107	122.1 Å²	122.1	70%	0.695	64%	0.643	S	S	*	*	P	Polyproline II helix	trans	-62.2	153.1	173.1	28	-34.3	0	0	0	110.7
22	P	94.3	Very high	88.8	Confident	86 Å²	86	119 Å²	119	56%	0.558	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-63	151.4	179.3	27.6	-35.2	0	0	0	111.5	I27	P22-I27 HydrophobicContact CB-CG1 4.27Å; P22-I27 HydrophobicContact CG-CD1 4.28Å; P22-I27 HydrophobicContact CG-CG1 4.25Å
23	T	95.8	Very high	89.9	Confident	66 Å²	66	116.4 Å²	116.4	41%	0.405	63%	0.626	S	S	.	*	P	Polyproline II helix	trans	-80.1	164.3	172.8	77.8	0	0	0	0	111.3	E25 Q26 I27	T23-E25 VanDerWaalsContact CB-OE2 3.32Å; T23-E25 WeakPolarHBondContact CB-OE2 3.38Å; T23-E25 PolarHBondContact O-N 3.25Å; T23-E25 PolarHBondContact OG1-OE2 3Å; T23-Q26 PolarHBondContact O-N 2.95Å; T23-Q26 PolarHBondContact OG1-N 3.45Å; T23-I27 WeakPolarHBondContact O-CG1 3.3Å; T23-I27 PolarHBondContact O-N 2.9Å; T23-I27 VanDerWaalsContact O-N 3.16Å
24	V	95.5	Very high	90.9	Very high	96 Å²	96	111.4 Å²	111.4	58%	0.582	60%	0.599	S	S	*	*	H	α-helix	trans	-60	-39.2	178.1	176.8	0	0	0	0	110.8	Q26 I27 L28	V24-Q26 VanDerWaalsContact C-N 3.34Å; V24-Q26 PolarHBondContact O-N 3.15Å; V24-I27 PolarHBondContact O-N 3.29Å; V24-L28 HydrophobicContact CG1-CD1 4.03Å; V24-L28 HydrophobicContact CG1-CG 4.38Å; V24-L28 WeakPolarHBondContact O-CG 3.37Å; V24-L28 PolarHBondContact O-N 3.18Å
25	E	97	Very high	91.6	Very high	129 Å²	129	112.6 Å²	112.6	60%	0.603	59%	0.594	S	S	*	*	H	α-helix	trans	-63.6	-41	-179.5	-62.3	69.2	-149.7	0	0	111.6	T23 L28 E29	T23-E25 VanDerWaalsContact CB-OE2 3.32Å; T23-E25 WeakPolarHBondContact CB-OE2 3.38Å; T23-E25 PolarHBondContact O-N 3.25Å; T23-E25 PolarHBondContact OG1-OE2 3Å; E25-L28 PolarHBondContact O-N 3.03Å; E25-E29 WeakPolarHBondContact O-CB 3.33Å; E25-E29 PolarHBondContact O-N 3.37Å
26	Q	95.6	Very high	91.7	Very high	97 Å²	97	111.4 Å²	111.4	45%	0.453	60%	0.597	S	S	.	*	H	α-helix	trans	-66	-40.9	177.6	-68.1	174.1	-37.7	0	0	111.3	T23 V24 L28 E29 D30	T23-Q26 PolarHBondContact O-N 2.95Å; T23-Q26 PolarHBondContact OG1-N 3.45Å; V24-Q26 VanDerWaalsContact C-N 3.34Å; V24-Q26 PolarHBondContact O-N 3.15Å; Q26-L28 VanDerWaalsContact C-N 3.34Å; Q26-L28 PolarHBondContact O-N 2.98Å; Q26-E29 PolarHBondContact O-N 2.9Å; Q26-D30 PolarHBondContact O-N 3.46Å; Q26-D30 VanDerWaalsContact O-N 3.08Å
27	I	93.8	Very high	92	Very high	79 Å²	79	111.4 Å²	111.4	41%	0.405	59%	0.591	S	S	.	*	H	α-helix	trans	-62.3	-44.4	175.4	-65.1	166.1	0	0	0	110.5	P22 T23 V24 D30 I31	P22-I27 HydrophobicContact CB-CG1 4.27Å; P22-I27 HydrophobicContact CG-CD1 4.28Å; P22-I27 HydrophobicContact CG-CG1 4.25Å; T23-I27 WeakPolarHBondContact O-CG1 3.3Å; T23-I27 PolarHBondContact O-N 2.9Å; T23-I27 VanDerWaalsContact O-N 3.16Å; V24-I27 PolarHBondContact O-N 3.29Å; I27-D30 PolarHBondContact O-N 2.95Å; I27-I31 HydrophobicContact CG2-CD1 3.85Å; I27-I31 VanDerWaalsContact O-CG1 3.3Å; I27-I31 WeakPolarHBondContact O-CG1 3.36Å; I27-I31 PolarHBondContact O-N 3.43Å
28	L	94.6	Very high	92.2	Very high	90 Å²	90	108.5 Å²	108.5	47%	0.471	57%	0.566	S	S	.	*	H	α-helix	trans	-67.3	-36.5	179	-70.4	174.9	0	0	0	112.3	V24 E25 Q26 I31 N32	V24-L28 HydrophobicContact CG1-CD1 4.03Å; V24-L28 HydrophobicContact CG1-CG 4.38Å; V24-L28 WeakPolarHBondContact O-CG 3.37Å; V24-L28 PolarHBondContact O-N 3.18Å; E25-L28 PolarHBondContact O-N 3.03Å; Q26-L28 VanDerWaalsContact C-N 3.34Å; Q26-L28 PolarHBondContact O-N 2.98Å; L28-I31 PolarHBondContact O-N 3.03Å; L28-N32 WeakPolarHBondContact O-CB 3.46Å; L28-N32 VanDerWaalsContact O-CG 3.25Å; L28-N32 PolarHBondContact O-N 3.48Å; L28-N32 PolarHBondContact O-ND2 2.89Å
29	E	96	Very high	92.1	Very high	84 Å²	84	101.6 Å²	101.6	39%	0.393	55%	0.551	S	S	.	*	H	α-helix	trans	-59.5	-46.8	173.5	-176.6	179.1	174.1	0	0	111.2	E25 Q26 N32 R33	E25-E29 WeakPolarHBondContact O-CB 3.33Å; E25-E29 PolarHBondContact O-N 3.37Å; Q26-E29 PolarHBondContact O-N 2.9Å; E29-N32 PolarHBondContact O-N 2.99Å; E29-R33 WeakPolarHBondContact O-CG 3.48Å; E29-R33 PolarHBondContact O-N 3.39Å; E29-R33 VanDerWaalsContact O-N 3.07Å; E29-R33 IonicContact OE1-CZ 3.81Å; E29-R33 IonicContact OE1-NE 2.63Å; E29-R33 IonicContact OE1-NH1 2.9Å; E29-R33 PolarHBondContact OE1-NH1 3.4Å; E29-R33 IonicContact OE1-NH2 2.68Å; E29-R33 PolarHBondContact OE1-NH2 3.34Å
30	D	93.4	Very high	91.8	Very high	112 Å²	112	99.7 Å²	99.7	60%	0.599	54%	0.537	S	S	*	.	H	α-helix	trans	-63.6	-43.6	178.4	-74.7	-10.9	0	0	0	111.7	Q26 I27 N32 R33 A34	Q26-D30 PolarHBondContact O-N 3.46Å; Q26-D30 VanDerWaalsContact O-N 3.08Å; I27-D30 PolarHBondContact O-N 2.95Å; D30-N32 PolarHBondContact O-N 3.46Å; D30-R33 PolarHBondContact O-N 3.32Å; D30-A34 PolarHBondContact O-N 3.45Å
31	I	91.4	Very high	91.5	Very high	61 Å²	61	96.7 Å²	96.7	31%	0.313	52%	0.517	S	S	.	.	H	α-helix	trans	-61.6	-43.8	176.4	-68.3	166.8	0	0	0	111	I27 L28 R33 A34 F41	I27-I31 HydrophobicContact CG2-CD1 3.85Å; I27-I31 VanDerWaalsContact O-CG1 3.3Å; I27-I31 WeakPolarHBondContact O-CG1 3.36Å; I27-I31 PolarHBondContact O-N 3.43Å; L28-I31 PolarHBondContact O-N 3.03Å; I31-R33 PolarHBondContact O-N 3.49Å; I31-A34 WeakPolarHBondContact O-CB 3.5Å; I31-A34 PolarHBondContact O-N 3.01Å; I31-F41 HydrophobicContact CG2-CE1 4.03Å; I31-F41 HydrophobicContact CG2-CZ 4.13Å
32	N	93.1	Very high	90.7	Very high	136 Å²	136	94.4 Å²	94.4	73%	0.727	50%	0.499	S	S	*	.	H	α-helix	trans	-69.3	-23.6	-179.4	-74.4	-42.9	0	0	0	113.1	L28 E29 D30	L28-N32 WeakPolarHBondContact O-CB 3.46Å; L28-N32 VanDerWaalsContact O-CG 3.25Å; L28-N32 PolarHBondContact O-N 3.48Å; L28-N32 PolarHBondContact O-ND2 2.89Å; E29-N32 PolarHBondContact O-N 2.99Å; D30-N32 PolarHBondContact O-N 3.46Å
33	R	93.8	Very high	89.4	Confident	174 Å²	174	94.8 Å²	94.8	66%	0.657	50%	0.5	S	S	*	.	H	α-helix	trans	-90.5	-13	176	-73.6	-177.1	174.7	157.2	12.5	113.7	E29 D30 I31	E29-R33 WeakPolarHBondContact O-CG 3.48Å; E29-R33 PolarHBondContact O-N 3.39Å; E29-R33 VanDerWaalsContact O-N 3.07Å; E29-R33 IonicContact OE1-CZ 3.81Å; E29-R33 IonicContact OE1-NE 2.63Å; E29-R33 IonicContact OE1-NH1 2.9Å; E29-R33 PolarHBondContact OE1-NH1 3.4Å; E29-R33 IonicContact OE1-NH2 2.68Å; E29-R33 PolarHBondContact OE1-NH2 3.34Å; D30-R33 PolarHBondContact O-N 3.32Å; I31-R33 PolarHBondContact O-N 3.49Å
34	A	92.7	Very high	87.6	Confident	27 Å²	27	96.4 Å²	96.4	22%	0.223	51%	0.505	C	S	.	.	S	Bend	trans	-62.9	145.3	178.9	0	0	0	0	0	111.3	D30 I31 D38 V40 F41	D30-A34 PolarHBondContact O-N 3.45Å; I31-A34 WeakPolarHBondContact O-CB 3.5Å; I31-A34 PolarHBondContact O-N 3.01Å; A34-D38 HydrophobicContact CB-CB 3.99Å; A34-V40 HydrophobicContact CB-CG1 4.01Å; A34-F41 HydrophobicContact CB-CE2 3.63Å; A34-F41 HydrophobicContact CB-CZ 4.01Å
35	F	91	Very high	85.8	Confident	154 Å²	154	97.5 Å²	97.5	68%	0.675	50%	0.504	S	S	*	.			trans	-73	157.4	176.9	-67.6	-78.4	0	0	0	111	N37 D38 F41	F35-N37 WeakPolarHBondContact CB-OD1 3.36Å; F35-N37 PolarHBondContact O-N 3.5Å; F35-N37 VanDerWaalsContact O-N 3.15Å; F35-D38 WeakPolarHBondContact O-CB 3.45Å; F35-D38 PolarHBondContact O-N 2.92Å; F35-F41 WeakPolarHBondContact O-CD2 3.19Å; F35-F41 WeakPolarHBondContact O-CE2 3.36Å
36	S	84.5	Confident	83.8	Confident	115 Å²	115	99 Å²	99	80%	0.804	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.6	-21.1	179.6	53.1	0	0	0	0	114.1
37	N	86.2	Confident	81.8	Confident	121 Å²	121	96.8 Å²	96.8	65%	0.647	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.4	7.7	174.3	66.3	-23	0	0	0	113.3	F35	F35-N37 WeakPolarHBondContact CB-OD1 3.36Å; F35-N37 PolarHBondContact O-N 3.5Å; F35-N37 VanDerWaalsContact O-N 3.15Å
38	D	87.6	Confident	79.6	Confident	53 Å²	53	95.2 Å²	95.2	28%	0.283	51%	0.512	S	S	.	.			trans	-66.6	134.9	-178.8	-167.6	-59.2	0	0	0	110.8	A34 F35 V40 F41 N42	A34-D38 HydrophobicContact CB-CB 3.99Å; F35-D38 WeakPolarHBondContact O-CB 3.45Å; F35-D38 PolarHBondContact O-N 2.92Å; D38-V40 HydrophobicContact CB-CG1 4.03Å; D38-V40 PolarHBondContact O-N 3Å; D38-V40 WeakPolarHBondContact OD1-CB 3.49Å; D38-V40 WeakPolarHBondContact OD1-CG1 3.44Å; D38-V40 PolarHBondContact OD1-N 2.68Å; D38-F41 HydrophobicContact CB-CD2 4.03Å; D38-F41 HydrophobicContact CB-CE2 4.25Å; D38-F41 PolarHBondContact O-N 2.91Å; D38-N42 PolarHBondContact O-ND2 3.41Å
39	P	83.9	Confident	77.5	Confident	85 Å²	85	99.3 Å²	99.3	55%	0.552	53%	0.529	S	S	*	.	H	α-helix	trans	-51.2	-28.6	175.1	-27.9	35.1	0	0	0	114.3	F41 N42 V43	P39-F41 PolarHBondContact O-N 2.91Å; P39-N42 CarbonylContact O-C 3.56Å; P39-N42 PolarHBondContact O-N 3.25Å; P39-V43 HydrophobicContact CB-CG2 4.34Å; P39-V43 WeakPolarHBondContact O-CB 3.48Å; P39-V43 WeakPolarHBondContact O-CG2 3.36Å; P39-V43 PolarHBondContact O-N 2.97Å
40	V	83.6	Confident	75.4	Confident	71 Å²	71	102.7 Å²	102.7	43%	0.43	55%	0.55	S	S	.	.	H	α-helix	trans	-53.8	-29.4	177.4	76.4	0	0	0	0	112.7	A34 D38	A34-V40 HydrophobicContact CB-CG1 4.01Å; D38-V40 HydrophobicContact CB-CG1 4.03Å; D38-V40 PolarHBondContact O-N 3Å; D38-V40 WeakPolarHBondContact OD1-CB 3.49Å; D38-V40 WeakPolarHBondContact OD1-CG1 3.44Å; D38-V40 PolarHBondContact OD1-N 2.68Å
41	F	84.7	Confident	73.2	Confident	88 Å²	88	101.8 Å²	101.8	39%	0.386	55%	0.548	S	S	.	.	H	α-helix	trans	-92	-22.8	177.2	-56.3	-62.5	0	0	0	113.4	I31 A34 F35 D38 P39	I31-F41 HydrophobicContact CG2-CE1 4.03Å; I31-F41 HydrophobicContact CG2-CZ 4.13Å; A34-F41 HydrophobicContact CB-CE2 3.63Å; A34-F41 HydrophobicContact CB-CZ 4.01Å; F35-F41 WeakPolarHBondContact O-CD2 3.19Å; F35-F41 WeakPolarHBondContact O-CE2 3.36Å; D38-F41 HydrophobicContact CB-CD2 4.03Å; D38-F41 HydrophobicContact CB-CE2 4.25Å; D38-F41 PolarHBondContact O-N 2.91Å; P39-F41 PolarHBondContact O-N 2.91Å
42	N	76.1	Confident	71.3	Confident	58 Å²	58	106.4 Å²	106.4	31%	0.31	57%	0.566	S	S	.	*	H	α-helix	trans	-102.4	-14.2	-174.6	-59.8	-38.6	0	0	0	114	D38 P39 L44 E45 D46	D38-N42 PolarHBondContact O-ND2 3.41Å; P39-N42 CarbonylContact O-C 3.56Å; P39-N42 PolarHBondContact O-N 3.25Å; N42-L44 PolarHBondContact O-N 3.42Å; N42-L44 VanDerWaalsContact O-N 3.07Å; N42-E45 PolarHBondContact O-N 3.41Å; N42-D46 PolarHBondContact O-N 3.21Å
43	V	67.6	Low	69.1	Low	95 Å²	95	108.7 Å²	108.7	58%	0.576	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.6	-27.4	177.1	159.4	0	0	0	0	111.8	P39	P39-V43 HydrophobicContact CB-CG2 4.34Å; P39-V43 WeakPolarHBondContact O-CB 3.48Å; P39-V43 WeakPolarHBondContact O-CG2 3.36Å; P39-V43 PolarHBondContact O-N 2.97Å
44	L	57.8	Low	66.7	Low	99 Å²	99	104.8 Å²	104.8	52%	0.518	58%	0.579	S	S	.	*	T	Hydrogen-bonded Turn	trans	-86.9	-15.9	176.1	-60.9	174.2	0	0	0	113.3	N42 N48	N42-L44 PolarHBondContact O-N 3.42Å; N42-L44 VanDerWaalsContact O-N 3.07Å; L44-N48 WeakPolarHBondContact CA-ND2 3.29Å; L44-N48 WeakPolarHBondContact CB-ND2 3.45Å; L44-N48 WeakPolarHBondContact CD2-ND2 3.41Å; L44-N48 VanDerWaalsContact O-CA 3.31Å; L44-N48 WeakPolarHBondContact O-CA 2.94Å; L44-N48 WeakPolarHBondContact O-CB 3.45Å; L44-N48 PolarHBondContact O-N 3.04Å; L44-N48 PolarHBondContact O-ND2 2.98Å; L44-N48 VanDerWaalsContact O-ND2 3.14Å
45	E	58.3	Low	64.7	Low	119 Å²	119	106.4 Å²	106.4	56%	0.556	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.7	-36	175.9	-64.4	-155.2	152.8	0	0	111.7	N42 G47	N42-E45 PolarHBondContact O-N 3.41Å; E45-G47 VanDerWaalsContact C-N 3.32Å
46	D	54.9	Low	63	Low	160 Å²	160	104.6 Å²	104.6	86%	0.856	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.7	-18.6	175.4	-69.1	-33.8	0	0	0	113	N42	N42-D46 PolarHBondContact O-N 3.21Å
47	G	53	Low	61.6	Low	52 Å²	52	104.8 Å²	104.8	54%	0.536	59%	0.587	S	S	.	*	T	Hydrogen-bonded Turn	trans	-114.1	-10	-178.5	0	0	0	0	0	116.4	E45	E45-G47 VanDerWaalsContact C-N 3.32Å
48	N	48.3	Very low	60.9	Low	45 Å²	45	101.9 Å²	101.9	24%	0.241	57%	0.571	C	S	.	*			trans	-135.5	53.7	-175.7	-56.1	-82.8	0	0	0	113.7	L44 D50 T51	L44-N48 WeakPolarHBondContact CA-ND2 3.29Å; L44-N48 WeakPolarHBondContact CB-ND2 3.45Å; L44-N48 WeakPolarHBondContact CD2-ND2 3.41Å; L44-N48 VanDerWaalsContact O-CA 3.31Å; L44-N48 WeakPolarHBondContact O-CA 2.94Å; L44-N48 WeakPolarHBondContact O-CB 3.45Å; L44-N48 PolarHBondContact O-N 3.04Å; L44-N48 PolarHBondContact O-ND2 2.98Å; L44-N48 VanDerWaalsContact O-ND2 3.14Å; N48-D50 PolarHBondContact O-N 3.47Å; N48-T51 WeakPolarHBondContact CB-OG1 3.49Å; N48-T51 VanDerWaalsContact CG-OG1 3.26Å; N48-T51 PolarHBondContact OD1-OG1 3.04Å
49	Q	49.5	Very low	60.8	Low	177 Å²	177	105 Å²	105	83%	0.827	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.8	-11.6	146.4	-71.2	-75.3	-30.8	0	0	111.6
50	D	51.3	Low	61	Low	154 Å²	154	104 Å²	104	82%	0.824	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.4	-6.1	-173.6	-71.2	-29.4	0	0	0	116.6	N48	N48-D50 PolarHBondContact O-N 3.47Å
51	T	48.7	Very low	61.3	Low	93 Å²	93	105.2 Å²	105.2	57%	0.571	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-134.6	-4.3	-173.3	71.5	0	0	0	0	117.7	N48 R53	N48-T51 WeakPolarHBondContact CB-OG1 3.49Å; N48-T51 VanDerWaalsContact CG-OG1 3.26Å; N48-T51 PolarHBondContact OD1-OG1 3.04Å; T51-R53 PolarHBondContact O-N 3.12Å
52	K	51	Low	61.6	Low	158 Å²	158	104.3 Å²	104.3	69%	0.687	59%	0.586	S	S	*	*	S	Bend	trans	-79.2	98.1	166.6	-82.5	-176.3	-176.4	171.7	0	109.7
53	R	45.8	Very low	62.5	Low	185 Å²	185	107.2 Å²	107.2	70%	0.698	60%	0.596	S	S	*	*			trans	113.1	79	156.3	-147.2	166.4	-165.4	-128.5	2.9	114.1	T51 S55 N58	T51-R53 PolarHBondContact O-N 3.12Å; R53-S55 PolarHBondContact O-N 3.04Å; R53-N58 WeakPolarHBondContact O-CB 3.5Å; R53-N58 PolarHBondContact O-ND2 3.04Å
54	G	43.7	Very low	63.8	Low	92 Å²	92	109 Å²	109	95%	0.948	59%	0.593	S	S	*	*			trans	-59.8	91.6	149.3	0	0	0	0	0	109.7
55	S	52	Low	65.6	Low	60 Å²	60	107 Å²	107	42%	0.42	58%	0.583	S	S	.	*			trans	-139.4	137.3	156	-177.7	0	0	0	0	104.7	R53 D57 N58	R53-S55 PolarHBondContact O-N 3.04Å; S55-D57 PolarHBondContact O-N 3.3Å; S55-N58 WeakPolarHBondContact O-CB 3.41Å; S55-N58 PolarHBondContact O-N 3.44Å
56	S	54.5	Low	67.4	Low	117 Å²	117	107.6 Å²	107.6	82%	0.818	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.4	-18.9	176.1	176.1	0	0	0	0	113.6	N58	S56-N58 VanDerWaalsContact C-N 3.29Å; S56-N58 PolarHBondContact O-N 3Å
57	D	55.9	Low	69.5	Low	119 Å²	119	103.1 Å²	103.1	64%	0.636	57%	0.566	S	S	*	*	H	α-helix	trans	-67.9	-20.5	174.7	-138.7	23.4	0	0	0	114.2	S55	S55-D57 PolarHBondContact O-N 3.3Å
58	N	71.3	Confident	71.6	Confident	60 Å²	60	107.3 Å²	107.3	32%	0.321	57%	0.566	S	S	.	*	H	α-helix	trans	-86.9	-24.9	-172.6	-153.4	16.6	0	0	0	113.2	R53 S55 S56 T62	R53-N58 WeakPolarHBondContact O-CB 3.5Å; R53-N58 PolarHBondContact O-ND2 3.04Å; S55-N58 WeakPolarHBondContact O-CB 3.41Å; S55-N58 PolarHBondContact O-N 3.44Å; S56-N58 VanDerWaalsContact C-N 3.29Å; S56-N58 PolarHBondContact O-N 3Å; N58-T62 WeakPolarHBondContact O-CB 3.44Å; N58-T62 WeakPolarHBondContact O-CG2 3.36Å; N58-T62 PolarHBondContact O-N 3.09Å; N58-T62 PolarHBondContact O-OG1 3.41Å
59	E	84.9	Confident	74	Confident	117 Å²	117	112.3 Å²	112.3	55%	0.547	58%	0.581	S	S	.	*	H	α-helix	trans	-73.6	-38.3	178.7	-166.6	-172.4	158.2	0	0	111.9	T62 K63	E59-T62 VanDerWaalsContact CA-OG1 3.28Å; E59-T62 WeakPolarHBondContact CA-OG1 3.38Å; E59-T62 PolarHBondContact O-OG1 3.5Å; E59-K63 HydrophobicContact CG-CD 4.36Å; E59-K63 WeakPolarHBondContact O-CB 3.46Å; E59-K63 WeakPolarHBondContact O-CG 3.34Å; E59-K63 PolarHBondContact O-N 2.97Å; E59-K63 WeakPolarHBondContact OE1-CE 3.32Å; E59-K63 IonicContact OE1-NZ 2.69Å; E59-K63 PolarHBondContact OE1-NZ 3.4Å
60	A	88.6	Confident	76.3	Confident	66 Å²	66	111 Å²	111	55%	0.545	57%	0.57	S	S	.	*	H	α-helix	trans	-66.9	-43.9	175.4	0	0	0	0	0	111	K63 Y64	A60-K63 PolarHBondContact O-N 3.4Å; A60-Y64 WeakPolarHBondContact O-CB 3.49Å; A60-Y64 PolarHBondContact O-N 3.48Å
61	E	89.8	Confident	78.5	Confident	96 Å²	96	108.2 Å²	108.2	45%	0.449	56%	0.555	S	S	.	*	H	α-helix	trans	-62.1	-45.9	176.7	-171.8	63.3	-148.8	0	0	111.7	K63 Y64 L65	E61-K63 PolarHBondContact O-N 3.26Å; E61-Y64 WeakPolarHBondContact O-CB 3.38Å; E61-Y64 PolarHBondContact O-N 3.08Å; E61-L65 HydrophobicContact CG-CD1 4.35Å; E61-L65 WeakPolarHBondContact O-CG 3.16Å; E61-L65 PolarHBondContact O-N 3.19Å
62	T	89.9	Confident	80.9	Confident	68 Å²	68	109.1 Å²	109.1	42%	0.417	55%	0.552	S	S	.	*	H	α-helix	trans	-62.5	-43.9	177.7	46.5	0	0	0	0	112.3	N58 E59 L65 Q66	N58-T62 WeakPolarHBondContact O-CB 3.44Å; N58-T62 WeakPolarHBondContact O-CG2 3.36Å; N58-T62 PolarHBondContact O-N 3.09Å; N58-T62 PolarHBondContact O-OG1 3.41Å; E59-T62 VanDerWaalsContact CA-OG1 3.28Å; E59-T62 WeakPolarHBondContact CA-OG1 3.38Å; E59-T62 PolarHBondContact O-OG1 3.5Å; T62-L65 PolarHBondContact O-N 2.95Å; T62-Q66 WeakPolarHBondContact O-CB 3.48Å; T62-Q66 PolarHBondContact O-N 2.94Å
63	K	94.9	Very high	83.1	Confident	119 Å²	119	106.9 Å²	106.9	52%	0.517	55%	0.546	S	S	.	.	H	α-helix	trans	-63.5	-40.5	174.6	-76.4	173.4	173	168.3	0	112.3	E59 A60 E61 Q66 S67	E59-K63 HydrophobicContact CG-CD 4.36Å; E59-K63 WeakPolarHBondContact O-CB 3.46Å; E59-K63 WeakPolarHBondContact O-CG 3.34Å; E59-K63 PolarHBondContact O-N 2.97Å; E59-K63 WeakPolarHBondContact OE1-CE 3.32Å; E59-K63 IonicContact OE1-NZ 2.69Å; E59-K63 PolarHBondContact OE1-NZ 3.4Å; A60-K63 PolarHBondContact O-N 3.4Å; E61-K63 PolarHBondContact O-N 3.26Å; K63-Q66 PolarHBondContact O-N 2.93Å; K63-S67 WeakPolarHBondContact O-CB 3.49Å; K63-S67 PolarHBondContact O-N 3.18Å
64	Y	95.4	Very high	85.7	Confident	133 Å²	133	100.2 Å²	100.2	52%	0.522	52%	0.524	S	S	.	.	H	α-helix	trans	-60.9	-50.2	175.6	169.9	-104	0	0	0	111.3	A60 E61 Q66 S67 R68	A60-Y64 WeakPolarHBondContact O-CB 3.49Å; A60-Y64 PolarHBondContact O-N 3.48Å; E61-Y64 WeakPolarHBondContact O-CB 3.38Å; E61-Y64 PolarHBondContact O-N 3.08Å; Y64-Q66 VanDerWaalsContact C-N 3.31Å; Y64-Q66 PolarHBondContact O-N 3.15Å; Y64-S67 PolarHBondContact O-N 3.33Å; Y64-R68 WeakPolarHBondContact O-CB 3.5Å; Y64-R68 PolarHBondContact O-N 3.45Å
65	L	96.2	Very high	88.3	Confident	58 Å²	58	101.7 Å²	101.7	30%	0.304	51%	0.506	S	S	.	.	H	α-helix	trans	-62.5	-38.6	178.3	-68.4	175.2	0	0	0	112.1	E61 T62 R68 R69	E61-L65 HydrophobicContact CG-CD1 4.35Å; E61-L65 WeakPolarHBondContact O-CG 3.16Å; E61-L65 PolarHBondContact O-N 3.19Å; T62-L65 PolarHBondContact O-N 2.95Å; L65-R68 PolarHBondContact O-N 2.96Å; L65-R69 WeakPolarHBondContact O-CG 3.22Å; L65-R69 PolarHBondContact O-N 2.93Å
66	Q	96.7	Very high	90.5	Very high	131 Å²	131	107 Å²	107	61%	0.612	52%	0.517	S	S	*	.	H	α-helix	trans	-64	-46.4	174.5	-176.4	-179.8	-4.5	0	0	111.8	T62 K63 Y64 R68 R69 Y70	T62-Q66 WeakPolarHBondContact O-CB 3.48Å; T62-Q66 PolarHBondContact O-N 2.94Å; K63-Q66 PolarHBondContact O-N 2.93Å; Y64-Q66 VanDerWaalsContact C-N 3.31Å; Y64-Q66 PolarHBondContact O-N 3.15Å; Q66-R68 VanDerWaalsContact C-N 3.34Å; Q66-R68 PolarHBondContact O-N 2.91Å; Q66-R69 PolarHBondContact O-N 3.03Å; Q66-Y70 WeakPolarHBondContact O-CB 3.31Å; Q66-Y70 PolarHBondContact O-N 2.94Å
67	S	97.4	Very high	92.6	Very high	65 Å²	65	106.6 Å²	106.6	46%	0.455	51%	0.505	S	S	.	.	H	α-helix	trans	-61.1	-43.7	177	179.9	0	0	0	0	111.3	K63 Y64 Y70 L71	K63-S67 WeakPolarHBondContact O-CB 3.49Å; K63-S67 PolarHBondContact O-N 3.18Å; Y64-S67 PolarHBondContact O-N 3.33Å; S67-Y70 WeakPolarHBondContact O-CB 3.42Å; S67-Y70 PolarHBondContact O-N 3.12Å; S67-L71 WeakPolarHBondContact O-CG 3.4Å; S67-L71 PolarHBondContact O-N 3.43Å
68	R	97.8	Very high	94.6	Very high	141 Å²	141	105.6 Å²	105.6	53%	0.532	50%	0.497	S	S	.	.	H	α-helix	trans	-60.6	-48	177.4	-167.3	-175.8	117.2	173.9	2.7	111.9	Y64 L65 Q66 Y70 L71 E72	Y64-R68 WeakPolarHBondContact O-CB 3.5Å; Y64-R68 PolarHBondContact O-N 3.45Å; L65-R68 PolarHBondContact O-N 2.96Å; Q66-R68 VanDerWaalsContact C-N 3.34Å; Q66-R68 PolarHBondContact O-N 2.91Å; R68-Y70 VanDerWaalsContact C-N 3.3Å; R68-Y70 PolarHBondContact O-N 2.98Å; R68-L71 PolarHBondContact O-N 3.42Å; R68-E72 PolarHBondContact O-N 3.49Å
69	R	98.1	Very high	95.9	Very high	149 Å²	149	108.7 Å²	108.7	56%	0.562	51%	0.509	S	S	*	.	H	α-helix	trans	-60.9	-39.3	176	-75.7	-171.9	-69.4	-101.7	3	112.2	L65 Q66 M73	L65-R69 WeakPolarHBondContact O-CG 3.22Å; L65-R69 PolarHBondContact O-N 2.93Å; Q66-R69 PolarHBondContact O-N 3.03Å; R69-M73 WeakPolarHBondContact O-CB 3.09Å; R69-M73 PolarHBondContact O-N 3.26Å
70	Y	98.1	Very high	96.6	Very high	150 Å²	150	106.5 Å²	106.5	59%	0.588	50%	0.504	S	S	*	.	H	α-helix	trans	-63.2	-44.7	176.4	172.6	-94.3	0	0	0	111.6	Q66 S67 R68 M73 N74	Q66-Y70 WeakPolarHBondContact O-CB 3.31Å; Q66-Y70 PolarHBondContact O-N 2.94Å; S67-Y70 WeakPolarHBondContact O-CB 3.42Å; S67-Y70 PolarHBondContact O-N 3.12Å; R68-Y70 VanDerWaalsContact C-N 3.3Å; R68-Y70 PolarHBondContact O-N 2.98Å; Y70-M73 PolarHBondContact O-N 3.23Å; Y70-N74 VanDerWaalsContact O-CB 3.31Å; Y70-N74 WeakPolarHBondContact O-CB 3.4Å; Y70-N74 PolarHBondContact O-N 3.46Å; Y70-N74 PolarHBondContact OH-ND2 2.84Å
71	L	98.6	Very high	97	Very high	95 Å²	95	110.7 Å²	110.7	50%	0.497	51%	0.505	S	S	.	.	H	α-helix	trans	-63.3	-46.9	178.3	-71	174.3	0	0	0	111.6	S67 R68 M73 N74 E75	S67-L71 WeakPolarHBondContact O-CG 3.4Å; S67-L71 PolarHBondContact O-N 3.43Å; R68-L71 PolarHBondContact O-N 3.42Å; L71-M73 VanDerWaalsContact C-N 3.33Å; L71-M73 PolarHBondContact O-N 3.35Å; L71-N74 WeakPolarHBondContact O-CB 3.37Å; L71-N74 PolarHBondContact O-N 3.03Å; L71-N74 VanDerWaalsContact O-N 3.08Å; L71-E75 WeakPolarHBondContact O-CG 3.05Å; L71-E75 PolarHBondContact O-N 2.69Å
72	E	98.3	Very high	97.4	Very high	112 Å²	112	108 Å²	108	52%	0.523	50%	0.504	S	S	.	.	H	α-helix	trans	-58	-45.3	176.6	-177.1	-179.1	174.7	0	0	111.6	R68 N74 E75 R76	R68-E72 PolarHBondContact O-N 3.49Å; E72-N74 VanDerWaalsContact C-N 3.33Å; E72-N74 PolarHBondContact O-N 3.04Å; E72-E75 PolarHBondContact O-N 2.72Å; E72-R76 PolarHBondContact O-N 3Å; E72-R76 VanDerWaalsContact O-N 3.12Å
73	M	98.3	Very high	97.9	Very high	111 Å²	111	110.3 Å²	110.3	55%	0.547	51%	0.509	S	S	.	.	H	α-helix	trans	-64.8	-38.4	175.8	-175.4	62.5	77.2	0	0	111.9	R69 Y70 L71 R76 L77	R69-M73 WeakPolarHBondContact O-CB 3.09Å; R69-M73 PolarHBondContact O-N 3.26Å; Y70-M73 PolarHBondContact O-N 3.23Å; L71-M73 VanDerWaalsContact C-N 3.33Å; L71-M73 PolarHBondContact O-N 3.35Å; M73-R76 PolarHBondContact O-N 3.07Å; M73-L77 HydrophobicContact CG-CD1 4.25Å; M73-L77 WeakPolarHBondContact O-CB 3.36Å; M73-L77 VanDerWaalsContact O-CG 3.31Å; M73-L77 WeakPolarHBondContact O-CG 3.39Å; M73-L77 PolarHBondContact O-N 3.43Å
74	N	98.6	Very high	98	Very high	46 Å²	46	109.6 Å²	109.6	25%	0.246	51%	0.511	C	S	.	.	H	α-helix	trans	-65.9	-44.8	179.2	-162.8	-47.9	0	0	0	111.2	Y70 L71 E72 R76 L77 Q78	Y70-N74 VanDerWaalsContact O-CB 3.31Å; Y70-N74 WeakPolarHBondContact O-CB 3.4Å; Y70-N74 PolarHBondContact O-N 3.46Å; Y70-N74 PolarHBondContact OH-ND2 2.84Å; L71-N74 WeakPolarHBondContact O-CB 3.37Å; L71-N74 PolarHBondContact O-N 3.03Å; L71-N74 VanDerWaalsContact O-N 3.08Å; E72-N74 VanDerWaalsContact C-N 3.33Å; E72-N74 PolarHBondContact O-N 3.04Å; N74-R76 VanDerWaalsContact C-N 3.32Å; N74-R76 PolarHBondContact O-N 2.92Å; N74-L77 WeakPolarHBondContact O-CB 3.42Å; N74-L77 PolarHBondContact O-N 2.85Å; N74-Q78 WeakPolarHBondContact O-CG 3.4Å; N74-Q78 PolarHBondContact O-N 2.88Å; N74-Q78 PolarHBondContact OD1-NE2 3.06Å
75	E	98.5	Very high	98.2	Very high	123 Å²	123	106.5 Å²	106.5	58%	0.575	51%	0.506	S	S	*	.	H	α-helix	trans	-55.4	-49.5	174.2	-74.4	175.5	175.3	0	0	110.7	L71 E72 L77 Q78 E79	L71-E75 WeakPolarHBondContact O-CG 3.05Å; L71-E75 PolarHBondContact O-N 2.69Å; E72-E75 PolarHBondContact O-N 2.72Å; E75-L77 VanDerWaalsContact C-N 3.32Å; E75-L77 PolarHBondContact O-N 3.5Å; E75-Q78 WeakPolarHBondContact O-CB 3.41Å; E75-Q78 PolarHBondContact O-N 3.08Å; E75-E79 WeakPolarHBondContact O-CG 3.39Å; E75-E79 PolarHBondContact O-N 3.47Å
76	R	98.5	Very high	98.3	Very high	170 Å²	170	109.4 Å²	109.4	64%	0.642	52%	0.518	S	S	*	.	H	α-helix	trans	-60.2	-39.8	177.3	-134.9	177.5	-176.6	-177.4	0.9	113.2	E72 M73 N74 Q78 E79 V80	E72-R76 PolarHBondContact O-N 3Å; E72-R76 VanDerWaalsContact O-N 3.12Å; M73-R76 PolarHBondContact O-N 3.07Å; N74-R76 VanDerWaalsContact C-N 3.32Å; N74-R76 PolarHBondContact O-N 2.92Å; R76-Q78 VanDerWaalsContact C-N 3.31Å; R76-E79 PolarHBondContact O-N 2.76Å; R76-V80 WeakPolarHBondContact O-CG2 3.47Å; R76-V80 PolarHBondContact O-N 3.42Å; R76-V80 VanDerWaalsContact O-N 3.09Å
77	L	98.7	Very high	98.4	Very high	110 Å²	110	108.4 Å²	108.4	58%	0.576	51%	0.513	S	S	*	.	H	α-helix	trans	-65.9	-35.2	175.2	-76.1	171.3	0	0	0	112.1	M73 N74 E75 R81	M73-L77 HydrophobicContact CG-CD1 4.25Å; M73-L77 WeakPolarHBondContact O-CB 3.36Å; M73-L77 VanDerWaalsContact O-CG 3.31Å; M73-L77 WeakPolarHBondContact O-CG 3.39Å; M73-L77 PolarHBondContact O-N 3.43Å; N74-L77 WeakPolarHBondContact O-CB 3.42Å; N74-L77 PolarHBondContact O-N 2.85Å; E75-L77 VanDerWaalsContact C-N 3.32Å; E75-L77 PolarHBondContact O-N 3.5Å; L77-R81 VanDerWaalsContact O-CB 3.22Å; L77-R81 WeakPolarHBondContact O-CB 3.45Å; L77-R81 PolarHBondContact O-N 3.25Å
78	Q	98.6	Very high	98.4	Very high	98 Å²	98	111.7 Å²	111.7	46%	0.458	52%	0.516	S	S	.	.	H	α-helix	trans	-69.1	-40.7	176.9	-70	-176.6	14.7	0	0	111.8	N74 E75 R76 R81 G82	N74-Q78 WeakPolarHBondContact O-CG 3.4Å; N74-Q78 PolarHBondContact O-N 2.88Å; N74-Q78 PolarHBondContact OD1-NE2 3.06Å; E75-Q78 WeakPolarHBondContact O-CB 3.41Å; E75-Q78 PolarHBondContact O-N 3.08Å; R76-Q78 VanDerWaalsContact C-N 3.31Å; Q78-R81 PolarHBondContact O-N 3Å; Q78-G82 PolarHBondContact O-N 2.93Å
79	E	98.5	Very high	98.5	Very high	125 Å²	125	109.9 Å²	109.9	58%	0.584	51%	0.513	S	S	*	.	H	α-helix	trans	-58.4	-55.7	174	-69.9	173.2	171.9	0	0	110.9	E75 R76 R81 G82 E83	E75-E79 WeakPolarHBondContact O-CG 3.39Å; E75-E79 PolarHBondContact O-N 3.47Å; R76-E79 PolarHBondContact O-N 2.76Å; E79-R81 VanDerWaalsContact C-N 3.26Å; E79-R81 PolarHBondContact O-N 2.87Å; E79-G82 WeakPolarHBondContact O-CA 3.33Å; E79-G82 PolarHBondContact O-N 3.12Å; E79-E83 PolarHBondContact O-N 3.14Å
80	V	98.5	Very high	98.5	Very high	70 Å²	70	107.9 Å²	107.9	42%	0.424	51%	0.51	S	S	.	.	H	α-helix	trans	-60.7	-37	179.9	175.7	0	0	0	0	111.5	R76 G82 E83 L84	R76-V80 WeakPolarHBondContact O-CG2 3.47Å; R76-V80 PolarHBondContact O-N 3.42Å; R76-V80 VanDerWaalsContact O-N 3.09Å; V80-G82 VanDerWaalsContact C-N 3.32Å; V80-G82 PolarHBondContact O-N 3.01Å; V80-E83 PolarHBondContact O-N 3.4Å; V80-L84 HydrophobicContact CG1-CD1 4.19Å; V80-L84 WeakPolarHBondContact O-CB 3.31Å; V80-L84 WeakPolarHBondContact O-CG 3.3Å; V80-L84 PolarHBondContact O-N 3.08Å
81	R	98.6	Very high	98.5	Very high	154 Å²	154	106.8 Å²	106.8	58%	0.581	51%	0.514	S	S	*	.	H	α-helix	trans	-63.5	-39.2	174	-175.5	179.8	66.5	-159.8	-0.5	111.7	L77 Q78 E79 L84 V85	L77-R81 VanDerWaalsContact O-CB 3.22Å; L77-R81 WeakPolarHBondContact O-CB 3.45Å; L77-R81 PolarHBondContact O-N 3.25Å; Q78-R81 PolarHBondContact O-N 3Å; E79-R81 VanDerWaalsContact C-N 3.26Å; E79-R81 PolarHBondContact O-N 2.87Å; R81-L84 PolarHBondContact O-N 3.02Å; R81-V85 VanDerWaalsContact O-CG2 3.32Å; R81-V85 WeakPolarHBondContact O-CG2 3.38Å; R81-V85 PolarHBondContact O-N 3.35Å; R81-V85 VanDerWaalsContact O-N 3.08Å
82	G	98.5	Very high	98.5	Very high	40 Å²	40	109 Å²	109	41%	0.412	52%	0.516	S	S	.	.	H	α-helix	trans	-61.6	-48.8	174.8	0	0	0	0	0	111.8	Q78 E79 V80 L84 V85 Q86	Q78-G82 PolarHBondContact O-N 2.93Å; E79-G82 WeakPolarHBondContact O-CA 3.33Å; E79-G82 PolarHBondContact O-N 3.12Å; V80-G82 VanDerWaalsContact C-N 3.32Å; V80-G82 PolarHBondContact O-N 3.01Å; G82-L84 VanDerWaalsContact C-N 3.34Å; G82-L84 PolarHBondContact O-N 3.49Å; G82-V85 PolarHBondContact O-N 2.9Å; G82-Q86 PolarHBondContact O-N 3.34Å
83	E	98.6	Very high	98.5	Very high	116 Å²	116	107.7 Å²	107.7	54%	0.542	52%	0.515	S	S	.	.	H	α-helix	trans	-57.8	-45.1	176.2	-67	178.3	175.7	0	0	111.9	E79 V80 V85 Q86 Q87	E79-E83 PolarHBondContact O-N 3.14Å; V80-E83 PolarHBondContact O-N 3.4Å; E83-V85 VanDerWaalsContact C-N 3.33Å; E83-V85 PolarHBondContact O-N 3.46Å; E83-Q86 WeakPolarHBondContact O-CB 3.46Å; E83-Q86 PolarHBondContact O-N 3.36Å; E83-Q87 WeakPolarHBondContact O-CG 3.12Å; E83-Q87 PolarHBondContact O-N 2.96Å
84	L	98.6	Very high	98.4	Very high	104 Å²	104	105.1 Å²	105.1	55%	0.545	51%	0.511	S	S	.	.	H	α-helix	trans	-62.2	-39.3	177.6	-78.9	170.7	0	0	0	112.6	V80 R81 G82 Q86 R88	V80-L84 HydrophobicContact CG1-CD1 4.19Å; V80-L84 WeakPolarHBondContact O-CB 3.31Å; V80-L84 WeakPolarHBondContact O-CG 3.3Å; V80-L84 PolarHBondContact O-N 3.08Å; R81-L84 PolarHBondContact O-N 3.02Å; G82-L84 VanDerWaalsContact C-N 3.34Å; G82-L84 PolarHBondContact O-N 3.49Å; L84-Q86 VanDerWaalsContact C-N 3.34Å; L84-R88 WeakPolarHBondContact O-CB 3.31Å; L84-R88 PolarHBondContact O-N 3.45Å
85	V	98.6	Very high	98.4	Very high	69 Å²	69	107.3 Å²	107.3	42%	0.418	52%	0.519	S	S	.	.	H	α-helix	trans	-64.4	-42.2	176.2	167.4	0	0	0	0	110.6	R81 G82 E83 R88 E89	R81-V85 VanDerWaalsContact O-CG2 3.32Å; R81-V85 WeakPolarHBondContact O-CG2 3.38Å; R81-V85 PolarHBondContact O-N 3.35Å; R81-V85 VanDerWaalsContact O-N 3.08Å; G82-V85 PolarHBondContact O-N 2.9Å; E83-V85 VanDerWaalsContact C-N 3.33Å; E83-V85 PolarHBondContact O-N 3.46Å; V85-R88 PolarHBondContact O-N 3.07Å; V85-E89 PolarHBondContact O-N 3.14Å; V85-E89 VanDerWaalsContact O-N 3.12Å
86	Q	98.4	Very high	98.4	Very high	119 Å²	119	106.1 Å²	106.1	56%	0.556	51%	0.513	S	S	*	.	H	α-helix	trans	-62.8	-50	176.7	-175.3	-176.1	-30.7	0	0	111.4	G82 E83 L84 R88 E89 E90	G82-Q86 PolarHBondContact O-N 3.34Å; E83-Q86 WeakPolarHBondContact O-CB 3.46Å; E83-Q86 PolarHBondContact O-N 3.36Å; L84-Q86 VanDerWaalsContact C-N 3.34Å; Q86-R88 VanDerWaalsContact C-N 3.27Å; Q86-R88 PolarHBondContact O-N 3.4Å; Q86-E89 WeakPolarHBondContact O-CB 3.39Å; Q86-E89 PolarHBondContact O-N 2.87Å; Q86-E90 PolarHBondContact NE2-OE1 3.01Å; Q86-E90 WeakPolarHBondContact O-CG 3.42Å; Q86-E90 PolarHBondContact O-N 3.49Å
87	Q	98.4	Very high	98.3	Very high	109 Å²	109	103.7 Å²	103.7	51%	0.509	51%	0.509	S	S	.	.	H	α-helix	trans	-58.7	-39.6	178.4	-73.1	179	-9.7	0	0	112.2	E83 E89 E90 L91	E83-Q87 WeakPolarHBondContact O-CG 3.12Å; E83-Q87 PolarHBondContact O-N 2.96Å; Q87-E89 VanDerWaalsContact C-N 3.32Å; Q87-E89 PolarHBondContact O-N 3.22Å; Q87-E90 PolarHBondContact O-N 2.95Å; Q87-L91 WeakPolarHBondContact O-CG 3.34Å; Q87-L91 PolarHBondContact O-N 3.49Å
88	R	98.4	Very high	98.3	Very high	135 Å²	135	103.8 Å²	103.8	51%	0.509	51%	0.509	S	S	.	.	H	α-helix	trans	-61.6	-41.3	175.5	-176.5	-162.1	68	-163.9	-2	111.6	L84 V85 Q86 L91 W92	L84-R88 WeakPolarHBondContact O-CB 3.31Å; L84-R88 PolarHBondContact O-N 3.45Å; V85-R88 PolarHBondContact O-N 3.07Å; Q86-R88 VanDerWaalsContact C-N 3.27Å; Q86-R88 PolarHBondContact O-N 3.4Å; R88-L91 PolarHBondContact O-N 3.23Å; R88-W92 PolarHBondContact O-N 2.81Å
89	E	98.4	Very high	98.2	Very high	103 Å²	103	104.4 Å²	104.4	48%	0.481	51%	0.512	S	S	.	.	H	α-helix	trans	-66.9	-44.2	178.6	-167.2	60.1	-151.9	0	0	111.4	V85 Q86 Q87 L91 W92 V93	V85-E89 PolarHBondContact O-N 3.14Å; V85-E89 VanDerWaalsContact O-N 3.12Å; Q86-E89 WeakPolarHBondContact O-CB 3.39Å; Q86-E89 PolarHBondContact O-N 2.87Å; Q87-E89 VanDerWaalsContact C-N 3.32Å; Q87-E89 PolarHBondContact O-N 3.22Å; E89-L91 VanDerWaalsContact C-N 3.28Å; E89-L91 PolarHBondContact O-N 3.42Å; E89-W92 WeakPolarHBondContact O-CB 3.45Å; E89-W92 PolarHBondContact O-N 3.4Å; E89-V93 WeakPolarHBondContact O-CG2 3.46Å; E89-V93 PolarHBondContact O-N 2.86Å
90	E	98.4	Very high	98.1	Very high	106 Å²	106	103.1 Å²	103.1	50%	0.495	51%	0.505	S	S	.	.	H	α-helix	trans	-57	-42.8	174.8	-70	171.8	-171.5	0	0	111.6	Q86 Q87 W92 V93 A94	Q86-E90 PolarHBondContact NE2-OE1 3.01Å; Q86-E90 WeakPolarHBondContact O-CG 3.42Å; Q86-E90 PolarHBondContact O-N 3.49Å; Q87-E90 PolarHBondContact O-N 2.95Å; E90-W92 PolarHBondContact O-N 3.41Å; E90-V93 PolarHBondContact O-N 3.39Å; E90-A94 WeakPolarHBondContact O-CB 3.43Å; E90-A94 PolarHBondContact O-N 2.94Å
91	L	98.4	Very high	98	Very high	127 Å²	127	102.4 Å²	102.4	67%	0.665	50%	0.503	S	S	*	.	H	α-helix	trans	-64.8	-36.9	174.9	-73.9	174.5	0	0	0	112.8	Q87 R88 E89 A94 K95	Q87-L91 WeakPolarHBondContact O-CG 3.34Å; Q87-L91 PolarHBondContact O-N 3.49Å; R88-L91 PolarHBondContact O-N 3.23Å; E89-L91 VanDerWaalsContact C-N 3.28Å; E89-L91 PolarHBondContact O-N 3.42Å; L91-A94 PolarHBondContact O-N 3.37Å; L91-K95 VanDerWaalsContact O-CB 3.29Å; L91-K95 WeakPolarHBondContact O-CB 3.4Å; L91-K95 PolarHBondContact O-N 3.37Å
92	W	98.1	Very high	97.9	Very high	142 Å²	142	98 Å²	98	54%	0.538	49%	0.493	S	S	.	.	H	α-helix	trans	-64.4	-45.2	175.5	-99.2	108.5	0	0	0	112	R88 E89 E90 K95 E96	R88-W92 PolarHBondContact O-N 2.81Å; E89-W92 WeakPolarHBondContact O-CB 3.45Å; E89-W92 PolarHBondContact O-N 3.4Å; E90-W92 PolarHBondContact O-N 3.41Å; W92-K95 HydrophobicContact CE3-CD 4.16Å; W92-K95 HydrophobicContact CZ3-CD 4.12Å; W92-K95 WeakPolarHBondContact O-CB 3.38Å; W92-K95 PolarHBondContact O-N 3.47Å; W92-E96 PolarHBondContact O-N 2.91Å
93	V	98.2	Very high	97.8	Very high	85 Å²	85	99 Å²	99	52%	0.515	50%	0.498	S	S	.	.	H	α-helix	trans	-62.7	-45.9	175.6	174.7	0	0	0	0	110.8	E89 E90 K95 E96 Q97	E89-V93 WeakPolarHBondContact O-CG2 3.46Å; E89-V93 PolarHBondContact O-N 2.86Å; E90-V93 PolarHBondContact O-N 3.39Å; V93-K95 VanDerWaalsContact C-N 3.29Å; V93-K95 PolarHBondContact O-N 3.22Å; V93-E96 PolarHBondContact O-N 2.93Å; V93-Q97 PolarHBondContact O-N 2.95Å
94	A	98	Very high	97.6	Very high	56 Å²	56	98.9 Å²	98.9	46%	0.463	50%	0.497	S	S	.	.	H	α-helix	trans	-60.5	-40.1	177.5	0	0	0	0	0	111.9	E90 L91 Q97 L98	E90-A94 WeakPolarHBondContact O-CB 3.43Å; E90-A94 PolarHBondContact O-N 2.94Å; L91-A94 PolarHBondContact O-N 3.37Å; A94-Q97 PolarHBondContact O-N 3.45Å; A94-L98 WeakPolarHBondContact O-CB 3.14Å; A94-L98 PolarHBondContact O-N 2.98Å
95	K	98	Very high	97.4	Very high	93 Å²	93	98.5 Å²	98.5	40%	0.404	50%	0.499	S	S	.	.	H	α-helix	trans	-60.9	-49.8	174.4	176.9	-168.6	164.7	-168.9	0	111.4	L91 W92 V93 Q97 L98 E99	L91-K95 VanDerWaalsContact O-CB 3.29Å; L91-K95 WeakPolarHBondContact O-CB 3.4Å; L91-K95 PolarHBondContact O-N 3.37Å; W92-K95 HydrophobicContact CE3-CD 4.16Å; W92-K95 HydrophobicContact CZ3-CD 4.12Å; W92-K95 WeakPolarHBondContact O-CB 3.38Å; W92-K95 PolarHBondContact O-N 3.47Å; V93-K95 VanDerWaalsContact C-N 3.29Å; V93-K95 PolarHBondContact O-N 3.22Å; K95-Q97 VanDerWaalsContact C-N 3.3Å; K95-Q97 PolarHBondContact O-N 3.23Å; K95-L98 WeakPolarHBondContact O-CB 3.43Å; K95-L98 PolarHBondContact O-N 2.96Å; K95-E99 WeakPolarHBondContact CE-OE1 3.37Å; K95-E99 IonicContact NZ-OE1 2.72Å; K95-E99 WeakPolarHBondContact O-CG 3.28Å; K95-E99 PolarHBondContact O-N 3.28Å
96	E	97.9	Very high	97.1	Very high	98 Å²	98	101.9 Å²	101.9	46%	0.458	51%	0.508	S	S	.	.	H	α-helix	trans	-61.2	-41.9	-179.4	-168	-168.1	161.5	0	0	111.2	W92 V93 L98 E99 K100	W92-E96 PolarHBondContact O-N 2.91Å; V93-E96 PolarHBondContact O-N 2.93Å; E96-L98 VanDerWaalsContact C-N 3.32Å; E96-L98 PolarHBondContact O-N 3.48Å; E96-E99 PolarHBondContact O-N 2.9Å; E96-K100 WeakPolarHBondContact O-CG 3.35Å; E96-K100 PolarHBondContact O-N 3.33Å; E96-K100 WeakPolarHBondContact OE1-CE 3.4Å; E96-K100 IonicContact OE1-NZ 3.89Å; E96-K100 PolarHBondContact OE1-NZ 3.02Å
97	Q	97.5	Very high	96.6	Very high	118 Å²	118	98.4 Å²	98.4	55%	0.551	50%	0.504	S	S	*	.	H	α-helix	trans	-63.8	-39.7	176.8	-173.4	59.4	23.7	0	0	111.9	V93 A94 K95 K100 S101	V93-Q97 PolarHBondContact O-N 2.95Å; A94-Q97 PolarHBondContact O-N 3.45Å; K95-Q97 VanDerWaalsContact C-N 3.3Å; K95-Q97 PolarHBondContact O-N 3.23Å; Q97-K100 PolarHBondContact O-N 2.96Å; Q97-S101 WeakPolarHBondContact O-CB 3.49Å; Q97-S101 PolarHBondContact O-N 3.29Å
98	L	97.3	Very high	95.6	Very high	112 Å²	112	102.8 Å²	102.8	59%	0.586	52%	0.516	S	S	*	.	H	α-helix	trans	-64.3	-44	175.1	-178.4	62.9	0	0	0	111.4	A94 K95 E96 K100 S101 V102	A94-L98 WeakPolarHBondContact O-CB 3.14Å; A94-L98 PolarHBondContact O-N 2.98Å; K95-L98 WeakPolarHBondContact O-CB 3.43Å; K95-L98 PolarHBondContact O-N 2.96Å; E96-L98 VanDerWaalsContact C-N 3.32Å; E96-L98 PolarHBondContact O-N 3.48Å; L98-K100 VanDerWaalsContact C-N 3.33Å; L98-K100 PolarHBondContact O-N 3.46Å; L98-S101 PolarHBondContact O-N 3.16Å; L98-V102 HydrophobicContact CD1-CG2 4.31Å; L98-V102 HydrophobicContact CG-CG2 4.46Å; L98-V102 WeakPolarHBondContact O-CB 3.2Å; L98-V102 VanDerWaalsContact O-CG2 3.3Å; L98-V102 WeakPolarHBondContact O-CG2 3.32Å; L98-V102 PolarHBondContact O-N 3.35Å
99	E	97.3	Very high	94.3	Very high	111 Å²	111	100.4 Å²	100.4	52%	0.519	53%	0.525	S	S	.	.	H	α-helix	trans	-59.3	-43.3	177.1	-74.8	176.8	172.7	0	0	111.7	K95 E96 V102 A103	K95-E99 WeakPolarHBondContact CE-OE1 3.37Å; K95-E99 IonicContact NZ-OE1 2.72Å; K95-E99 WeakPolarHBondContact O-CG 3.28Å; K95-E99 PolarHBondContact O-N 3.28Å; E96-E99 PolarHBondContact O-N 2.9Å; E99-V102 PolarHBondContact O-N 2.67Å; E99-A103 WeakPolarHBondContact O-CB 3.36Å; E99-A103 PolarHBondContact O-N 3.07Å
100	K	96.6	Very high	92.2	Very high	99 Å²	99	105.3 Å²	105.3	43%	0.43	55%	0.554	S	S	.	*	H	α-helix	trans	-61.1	-48.8	173.9	-71.2	171.5	-174.5	164.1	0	111.8	E96 Q97 L98 V102 A103 E104	E96-K100 WeakPolarHBondContact O-CG 3.35Å; E96-K100 PolarHBondContact O-N 3.33Å; E96-K100 WeakPolarHBondContact OE1-CE 3.4Å; E96-K100 IonicContact OE1-NZ 3.89Å; E96-K100 PolarHBondContact OE1-NZ 3.02Å; Q97-K100 PolarHBondContact O-N 2.96Å; L98-K100 VanDerWaalsContact C-N 3.33Å; L98-K100 PolarHBondContact O-N 3.46Å; K100-V102 VanDerWaalsContact C-N 3.32Å; K100-V102 PolarHBondContact O-N 2.94Å; K100-A103 WeakPolarHBondContact O-CB 3.38Å; K100-A103 PolarHBondContact O-N 3.48Å; K100-A103 VanDerWaalsContact O-N 3.15Å; K100-E104 PolarHBondContact O-N 3.44Å
101	S	96.6	Very high	91.9	Very high	55 Å²	55	105.3 Å²	105.3	39%	0.385	56%	0.557	S	S	.	*	H	α-helix	trans	-59.7	-42.4	178.7	-177.7	0	0	0	0	112	Q97 L98 E104 V105	Q97-S101 WeakPolarHBondContact O-CB 3.49Å; Q97-S101 PolarHBondContact O-N 3.29Å; L98-S101 PolarHBondContact O-N 3.16Å; S101-E104 PolarHBondContact O-N 2.92Å; S101-V105 WeakPolarHBondContact O-CG2 3.42Å; S101-V105 PolarHBondContact O-N 3.42Å
102	V	96.5	Very high	91.6	Very high	61 Å²	61	104.2 Å²	104.2	37%	0.37	55%	0.551	S	S	.	*	H	α-helix	trans	-63.7	-41.6	175.9	169.4	0	0	0	0	111.4	L98 E99 K100 V105 K106	L98-V102 HydrophobicContact CD1-CG2 4.31Å; L98-V102 HydrophobicContact CG-CG2 4.46Å; L98-V102 WeakPolarHBondContact O-CB 3.2Å; L98-V102 VanDerWaalsContact O-CG2 3.3Å; L98-V102 WeakPolarHBondContact O-CG2 3.32Å; L98-V102 PolarHBondContact O-N 3.35Å; E99-V102 PolarHBondContact O-N 2.67Å; K100-V102 VanDerWaalsContact C-N 3.32Å; K100-V102 PolarHBondContact O-N 2.94Å; V102-V105 PolarHBondContact O-N 2.97Å; V102-K106 HydrophobicContact CG1-CD 4.1Å; V102-K106 WeakPolarHBondContact O-CB 3.39Å; V102-K106 WeakPolarHBondContact O-CG 3.32Å; V102-K106 PolarHBondContact O-N 3.04Å
103	A	95.2	Very high	91.2	Very high	62 Å²	62	102.1 Å²	102.1	51%	0.512	55%	0.552	S	S	.	*	H	α-helix	trans	-63.6	-42.4	177	0	0	0	0	0	112.1	E99 K100 K106 G107	E99-A103 WeakPolarHBondContact O-CB 3.36Å; E99-A103 PolarHBondContact O-N 3.07Å; K100-A103 WeakPolarHBondContact O-CB 3.38Å; K100-A103 PolarHBondContact O-N 3.48Å; K100-A103 VanDerWaalsContact O-N 3.15Å; A103-K106 PolarHBondContact O-N 2.94Å; A103-G107 PolarHBondContact O-N 2.84Å
104	E	94.6	Very high	90.8	Very high	113 Å²	113	103.1 Å²	103.1	53%	0.528	55%	0.554	S	S	.	*	H	α-helix	trans	-61.5	-46.1	175.4	-73.2	-177.6	-168.2	0	0	112.3	K100 S101 K106 G107 R108	K100-E104 PolarHBondContact O-N 3.44Å; S101-E104 PolarHBondContact O-N 2.92Å; E104-K106 VanDerWaalsContact C-N 3.34Å; E104-K106 PolarHBondContact O-N 2.85Å; E104-G107 PolarHBondContact O-N 2.78Å; E104-R108 WeakPolarHBondContact O-CG 3.36Å; E104-R108 PolarHBondContact O-N 2.63Å; E104-R108 IonicContact OE2-NH2 3.97Å
105	V	94.1	Very high	90.3	Very high	95 Å²	95	106 Å²	106	58%	0.576	56%	0.559	S	S	*	*	H	α-helix	trans	-62.8	-43.1	178.4	172.2	0	0	0	0	110.8	S101 V102 R108 A109	S101-V105 WeakPolarHBondContact O-CG2 3.42Å; S101-V105 PolarHBondContact O-N 3.42Å; V102-V105 PolarHBondContact O-N 2.97Å; V105-R108 PolarHBondContact O-N 3.26Å; V105-A109 WeakPolarHBondContact O-CB 3.32Å; V105-A109 PolarHBondContact O-N 2.88Å; V105-A109 VanDerWaalsContact O-N 3.13Å
106	K	92.9	Very high	89.8	Confident	140 Å²	140	106.9 Å²	106.9	61%	0.609	57%	0.57	S	S	*	*	H	α-helix	trans	-62.7	-41.2	175.6	-75	177.7	179.9	179.4	0	112.2	V102 A103 E104 R108 A109	V102-K106 HydrophobicContact CG1-CD 4.1Å; V102-K106 WeakPolarHBondContact O-CB 3.39Å; V102-K106 WeakPolarHBondContact O-CG 3.32Å; V102-K106 PolarHBondContact O-N 3.04Å; A103-K106 PolarHBondContact O-N 2.94Å; E104-K106 VanDerWaalsContact C-N 3.34Å; E104-K106 PolarHBondContact O-N 2.85Å; K106-R108 VanDerWaalsContact C-N 3.34Å; K106-A109 PolarHBondContact O-N 3.48Å
107	G	87.4	Confident	89.3	Confident	47 Å²	47	107.5 Å²	107.5	49%	0.485	58%	0.578	S	S	.	*	H	α-helix	trans	-67.9	-30.7	178.3	0	0	0	0	0	113.8	A103 E104	A103-G107 PolarHBondContact O-N 2.84Å; E104-G107 PolarHBondContact O-N 2.78Å
108	R	77.9	Confident	88.6	Confident	201 Å²	201	106.7 Å²	106.7	76%	0.758	58%	0.58	S	S	*	*	H	α-helix	trans	-80.3	-18.1	174.6	-68.5	178.1	-170.5	-169.6	7.2	113.8	E104 V105 K106	E104-R108 WeakPolarHBondContact O-CG 3.36Å; E104-R108 PolarHBondContact O-N 2.63Å; E104-R108 IonicContact OE2-NH2 3.97Å; V105-R108 PolarHBondContact O-N 3.26Å; K106-R108 VanDerWaalsContact C-N 3.34Å
109	A	70.9	Confident	87.9	Confident	84 Å²	84	106.3 Å²	106.3	69%	0.694	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.5	-1.3	-179.6	0	0	0	0	0	113.4	V105 K106	V105-A109 WeakPolarHBondContact O-CB 3.32Å; V105-A109 PolarHBondContact O-N 2.88Å; V105-A109 VanDerWaalsContact O-N 3.13Å; K106-A109 PolarHBondContact O-N 3.48Å
110	L	54.9	Low	87.1	Confident	207 Å²	207	105.8 Å²	105.8	100%	1.084	59%	0.585	S	S	*	*			trans	-103.7	0	170.8	-69	170.6	0	0	0	109.6

Retrieved 110 of 110 residues in 28.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).