A0A060WII1_ONCMY Loading...

Small nuclear ribonucleoprotein Sm D3

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs. As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing.

AlphaFold DB , UniProt , Accession A0A060WII1, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110525517, Length 127 aa.

						>A0A060WII1_ONCMY|A0A060WII1|LOC110525517
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMANITVTHRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGAGAGRGKAAILKAQVAARGRGRGGMGRGNIFPKRR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.8	Low	87.9	Confident	248 Å²	248	71.4 Å²	71.4	100%	1.222	41%	0.408	S	S	*	.				0	126.4	0	-99.1	174.9	-94	0	0	108.3
2	S	77.6	Confident	88.5	Confident	123 Å²	123	70.6 Å²	70.6	86%	0.86	40%	0.398	S	S	*	.			trans	-90.2	110.4	174.8	61.9	0	0	0	0	109.6
3	I	84.6	Confident	89.2	Confident	60 Å²	60	65.2 Å²	65.2	31%	0.308	37%	0.367	S	S	.	.			trans	-62.2	133.3	174.2	-168.8	174.4	0	0	0	110.6	I7 K8 D37	I3-I7 HydrophobicContact CD1-CB 4.12Å; I3-I7 HydrophobicContact CD1-CG2 3.59Å; I3-I7 HydrophobicContact CG1-CB 3.79Å; I3-I7 HydrophobicContact CG1-CG2 3.76Å; I3-K8 HydrophobicContact CG2-CD 4.13Å; I3-K8 HydrophobicContact CG2-CG 3.76Å; I3-K8 WeakPolarHBondContact O-CE 3.4Å; I3-D37 WeakPolarHBondContact CD1-OD1 3.46Å
4	G	90.8	Very high	89.8	Confident	38 Å²	38	65.4 Å²	65.4	39%	0.392	36%	0.364	S	S	.	.			trans	-64.9	147.2	-178.1	0	0	0	0	0	112	P6 I7 K8	G4-P6 VanDerWaalsContact C-CD 3.44Å; G4-P6 VanDerWaalsContact C-N 3.31Å; G4-I7 PolarHBondContact O-N 3.4Å; G4-I7 VanDerWaalsContact O-N 3.09Å; G4-K8 PolarHBondContact O-N 3.4Å
5	V	91.5	Very high	90.4	Very high	33 Å²	33	63.8 Å²	63.8	20%	0.2	37%	0.368	C	S	.	.	H	α-helix	trans	-51.9	-42.4	178	172.1	0	0	0	0	112.8	I7 K8 V9 M82 M86	V5-I7 VanDerWaalsContact C-N 3.33Å; V5-I7 PolarHBondContact O-N 2.91Å; V5-K8 WeakPolarHBondContact O-CB 3.31Å; V5-K8 PolarHBondContact O-N 2.84Å; V5-V9 HydrophobicContact CG1-CG2 4.49Å; V5-V9 WeakPolarHBondContact O-CG2 3.33Å; V5-V9 PolarHBondContact O-N 3.01Å; V5-V9 VanDerWaalsContact O-N 3.12Å; V5-M82 HydrophobicContact CG1-CB 4.12Å; V5-M82 WeakPolarHBondContact CG1-O 3.23Å; V5-M86 HydrophobicContact CB-CE 3.65Å; V5-M86 HydrophobicContact CG1-CE 3.74Å; V5-M86 HydrophobicContact CG2-CE 4.17Å
6	P	93.8	Very high	90.9	Very high	91 Å²	91	64.1 Å²	64.1	59%	0.591	37%	0.365	S	S	*	.	H	α-helix	trans	-59.8	-39.1	177.5	-26.3	36.5	0	0	0	114	G4 V9 L10	G4-P6 VanDerWaalsContact C-CD 3.44Å; G4-P6 VanDerWaalsContact C-N 3.31Å; P6-V9 PolarHBondContact O-N 3.2Å; P6-L10 PolarHBondContact O-N 2.84Å
7	I	95.3	Very high	91.3	Very high	31 Å²	31	65.5 Å²	65.5	16%	0.159	37%	0.37	C	S	.	.	H	α-helix	trans	-69	-37.4	179.4	-52.8	-58.7	0	0	0	110.4	I3 G4 V5 V9 L10 H11 M39	I3-I7 HydrophobicContact CD1-CB 4.12Å; I3-I7 HydrophobicContact CD1-CG2 3.59Å; I3-I7 HydrophobicContact CG1-CB 3.79Å; I3-I7 HydrophobicContact CG1-CG2 3.76Å; G4-I7 PolarHBondContact O-N 3.4Å; G4-I7 VanDerWaalsContact O-N 3.09Å; V5-I7 VanDerWaalsContact C-N 3.33Å; V5-I7 PolarHBondContact O-N 2.91Å; I7-V9 VanDerWaalsContact C-N 3.31Å; I7-V9 PolarHBondContact O-N 2.71Å; I7-L10 WeakPolarHBondContact O-CB 3.46Å; I7-L10 PolarHBondContact O-N 3.08Å; I7-L10 VanDerWaalsContact O-N 3.13Å; I7-H11 PolarHBondContact O-CD2 3.22Å; I7-H11 PolarHBondContact O-N 3.46Å; I7-M39 HydrophobicContact CD1-CG 3.66Å; I7-M39 HydrophobicContact CD1-SD 4.08Å
8	K	93.9	Very high	91.7	Very high	78 Å²	78	61.9 Å²	61.9	34%	0.339	35%	0.35	S	S	.	.	H	α-helix	trans	-59.2	-43.1	172.6	-61.2	-175	-180	-173.4	0	112.2	I3 G4 V5 L10 H11 E12 M82	I3-K8 HydrophobicContact CG2-CD 4.13Å; I3-K8 HydrophobicContact CG2-CG 3.76Å; I3-K8 WeakPolarHBondContact O-CE 3.4Å; G4-K8 PolarHBondContact O-N 3.4Å; V5-K8 WeakPolarHBondContact O-CB 3.31Å; V5-K8 PolarHBondContact O-N 2.84Å; K8-L10 VanDerWaalsContact C-N 3.28Å; K8-L10 PolarHBondContact O-N 2.95Å; K8-H11 PolarHBondContact O-N 2.83Å; K8-E12 PolarHBondContact O-N 2.97Å; K8-E12 VanDerWaalsContact O-N 3.08Å; K8-M82 HydrophobicContact CB-CG 4.26Å; K8-M82 HydrophobicContact CD-CE 4.3Å; K8-M82 HydrophobicContact CD-SD 3.8Å
9	V	94.6	Very high	92.1	Very high	17 Å²	17	59.4 Å²	59.4	10%	0.103	34%	0.336	C	S	.	.	H	α-helix	trans	-66.6	-34.1	177.6	176.3	0	0	0	0	111	V5 P6 I7 E12 A13 L73 L77 M82 L83	V5-V9 HydrophobicContact CG1-CG2 4.49Å; V5-V9 WeakPolarHBondContact O-CG2 3.33Å; V5-V9 PolarHBondContact O-N 3.01Å; V5-V9 VanDerWaalsContact O-N 3.12Å; P6-V9 PolarHBondContact O-N 3.2Å; I7-V9 VanDerWaalsContact C-N 3.31Å; I7-V9 PolarHBondContact O-N 2.71Å; V9-E12 PolarHBondContact O-N 2.87Å; V9-A13 PolarHBondContact O-N 2.95Å; V9-L73 HydrophobicContact CG1-CD1 3.95Å; V9-L77 HydrophobicContact CG1-CB 4.5Å; V9-L77 HydrophobicContact CG1-CD1 4.33Å; V9-M82 HydrophobicContact CG2-CB 4.05Å; V9-L83 HydrophobicContact CG1-CD1 4.32Å; V9-L83 HydrophobicContact CG2-CD1 3.73Å
10	L	96.3	Very high	92.4	Very high	10 Å²	10	56.5 Å²	56.5	5%	0.052	32%	0.319	C	S	.	.	H	α-helix	trans	-62.9	-44.1	173.8	-179.3	59.8	0	0	0	111.7	P6 I7 K8 E12 A13 L32 A35 M39 L71 L73	P6-L10 PolarHBondContact O-N 2.84Å; I7-L10 WeakPolarHBondContact O-CB 3.46Å; I7-L10 PolarHBondContact O-N 3.08Å; I7-L10 VanDerWaalsContact O-N 3.13Å; K8-L10 VanDerWaalsContact C-N 3.28Å; K8-L10 PolarHBondContact O-N 2.95Å; L10-E12 VanDerWaalsContact C-N 3.33Å; L10-E12 PolarHBondContact O-N 3Å; L10-A13 VanDerWaalsContact O-CB 3.3Å; L10-A13 WeakPolarHBondContact O-CB 3.49Å; L10-A13 PolarHBondContact O-N 3.42Å; L10-L32 HydrophobicContact CD1-CD2 4.08Å; L10-A35 HydrophobicContact CD1-CB 4.36Å; L10-A35 HydrophobicContact CD2-CB 3.98Å; L10-A35 HydrophobicContact CG-CB 3.71Å; L10-M39 HydrophobicContact CD2-CB 4.45Å; L10-M39 HydrophobicContact CD2-CG 4.16Å; L10-L71 HydrophobicContact CD1-CD1 3.96Å; L10-L71 HydrophobicContact CD2-CD1 4.44Å; L10-L73 HydrophobicContact CD1-CD2 4.22Å
11	H	96.1	Very high	92.7	Very high	56 Å²	56	55.5 Å²	55.5	26%	0.259	31%	0.312	S	S	.	.	H	α-helix	trans	-62.4	-38.1	173.5	-69.7	-67.3	0	0	0	112.7	I7 K8 A13 E14 A35 D37	I7-H11 PolarHBondContact O-CD2 3.22Å; I7-H11 PolarHBondContact O-N 3.46Å; K8-H11 PolarHBondContact O-N 2.83Å; H11-A13 PolarHBondContact O-N 2.9Å; H11-A13 VanDerWaalsContact O-N 3.15Å; H11-E14 IonicContact CG-OE1 3.26Å; H11-E14 IonicContact ND1-OE1 3.87Å; H11-E14 PolarHBondContact ND1-OE1 2.92Å; H11-E14 WeakPolarHBondContact O-CB 3.15Å; H11-E14 WeakPolarHBondContact O-CG 3.48Å; H11-E14 PolarHBondContact O-N 2.81Å; H11-E14 VanDerWaalsContact O-N 3.08Å; H11-A35 PolarHBondContact CE1-O 3.34Å; H11-A35 PolarHBondContact ND1-O 3.12Å; H11-A35 VanDerWaalsContact ND1-O 3.11Å; H11-D37 IonicContact NE2-OD1 3.77Å; H11-D37 PolarHBondContact NE2-OD1 3Å
12	E	95.3	Very high	94.9	Very high	62 Å²	62	44.1 Å²	44.1	29%	0.29	26%	0.257	S	S	.	.	H	α-helix	trans	-62.9	-19.4	174.4	-71.3	-178.4	-172.6	0	0	113	K8 V9 L10 L77 A80 M82	K8-E12 PolarHBondContact O-N 2.97Å; K8-E12 VanDerWaalsContact O-N 3.08Å; V9-E12 PolarHBondContact O-N 2.87Å; L10-E12 VanDerWaalsContact C-N 3.33Å; L10-E12 PolarHBondContact O-N 3Å; E12-L77 HydrophobicContact CB-CD2 3.97Å; E12-A80 WeakPolarHBondContact OE2-CB 3.44Å; E12-M82 WeakPolarHBondContact OE1-CG 3.26Å
13	A	97	Very high	95.9	Very high	0 Å²	0	42 Å²	42	0%	0	24%	0.236	C	C	.	.	T	Hydrogen-bonded Turn	trans	-83.6	-7.9	176.3	0	0	0	0	0	114	V9 L10 H11 H16 V18 L32 L73 L77	V9-A13 PolarHBondContact O-N 2.95Å; L10-A13 VanDerWaalsContact O-CB 3.3Å; L10-A13 WeakPolarHBondContact O-CB 3.49Å; L10-A13 PolarHBondContact O-N 3.42Å; H11-A13 PolarHBondContact O-N 2.9Å; H11-A13 VanDerWaalsContact O-N 3.15Å; A13-H16 WeakPolarHBondContact O-CB 3.27Å; A13-H16 PolarHBondContact O-N 2.83Å; A13-H16 VanDerWaalsContact O-N 3.12Å; A13-H16 PolarHBondContact O-ND1 3.12Å; A13-V18 HydrophobicContact CB-CG1 4.29Å; A13-L32 HydrophobicContact CB-CD2 4.13Å; A13-L73 HydrophobicContact CB-CB 4.45Å; A13-L73 HydrophobicContact CB-CD1 4.12Å; A13-L73 HydrophobicContact CB-CD2 3.76Å; A13-L73 HydrophobicContact CB-CG 4.33Å; A13-L77 HydrophobicContact CB-CD1 3.63Å
14	E	98.1	Very high	96.5	Very high	68 Å²	68	42.3 Å²	42.3	32%	0.318	24%	0.24	S	C	.	.	T	Hydrogen-bonded Turn	trans	-55.1	143.4	174.7	-70.1	172.3	-169.2	0	0	110.7	H11 H16 L32 A35	H11-E14 IonicContact CG-OE1 3.26Å; H11-E14 IonicContact ND1-OE1 3.87Å; H11-E14 PolarHBondContact ND1-OE1 2.92Å; H11-E14 WeakPolarHBondContact O-CB 3.15Å; H11-E14 WeakPolarHBondContact O-CG 3.48Å; H11-E14 PolarHBondContact O-N 2.81Å; H11-E14 VanDerWaalsContact O-N 3.08Å; E14-H16 PolarHBondContact O-N 2.92Å; E14-H16 PolarHBondContact O-ND1 2.91Å; E14-L32 HydrophobicContact CG-CD2 4.28Å; E14-L32 HydrophobicContact CG-CG 4.37Å; E14-A35 HydrophobicContact CG-CB 4.44Å; E14-A35 PolarHBondContact OE1-N 2.87Å
15	G	97.9	Very high	96.8	Very high	42 Å²	42	41.2 Å²	41.2	43%	0.433	23%	0.23	S	C	.	.	T	Hydrogen-bonded Turn	trans	80.2	-7.9	-174.2	0	0	0	0	0	115.4	K31 L32	G15-K31 WeakPolarHBondContact O-CE 3.2Å; G15-L32 WeakPolarHBondContact CA-O 3.07Å; G15-L32 PolarHBondContact N-O 3.38Å
16	H	98.4	Very high	97.1	Very high	68 Å²	68	41.3 Å²	41.3	32%	0.315	23%	0.228	S	C	.	.	S	Bend	trans	-104.8	164.3	-177.6	-59.4	84.5	0	0	0	113.4	A13 E14 V18 K31 L32 P74	A13-H16 WeakPolarHBondContact O-CB 3.27Å; A13-H16 PolarHBondContact O-N 2.83Å; A13-H16 VanDerWaalsContact O-N 3.12Å; A13-H16 PolarHBondContact O-ND1 3.12Å; E14-H16 PolarHBondContact O-N 2.92Å; E14-H16 PolarHBondContact O-ND1 2.91Å; H16-V18 PolarHBondContact O-N 2.82Å; H16-K31 CarbonylContact O-C 3.55Å; H16-K31 WeakPolarHBondContact O-CA 3.16Å; H16-L32 PolarHBondContact O-N 2.79Å; H16-P74 HydrophobicContact CB-CG 3.49Å; H16-P74 VanDerWaalsContact CB-CG 3.49Å
17	I	98.4	Very high	97.3	Very high	89 Å²	89	38.9 Å²	38.9	46%	0.456	21%	0.211	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-74.7	120.7	171.4	-55	-56.9	0	0	0	109.3	R29 G30 K31	I17-R29 HydrophobicContact CG2-CG 4.21Å; I17-G30 WeakPolarHBondContact CA-O 3.38Å; I17-K31 HydrophobicContact CD1-CB 4.06Å
18	V	98.6	Very high	97.5	Very high	1 Å²	1	39.5 Å²	39.5	1%	0.006	21%	0.212	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	162.3	176.3	-56.5	0	0	0	0	109.9	A13 H16 R29 G30 L32 M43 L71 I72 L73	A13-V18 HydrophobicContact CB-CG1 4.29Å; H16-V18 PolarHBondContact O-N 2.82Å; V18-R29 WeakPolarHBondContact O-CA 3.4Å; V18-G30 PolarHBondContact N-O 2.87Å; V18-G30 PolarHBondContact O-N 2.65Å; V18-G30 VanDerWaalsContact O-N 3.12Å; V18-L32 HydrophobicContact CG1-CB 3.99Å; V18-L32 HydrophobicContact CG1-CD2 4.29Å; V18-L32 HydrophobicContact CG2-CB 3.81Å; V18-M43 HydrophobicContact CG2-CE 3.63Å; V18-M43 HydrophobicContact CG2-SD 4.42Å; V18-L71 HydrophobicContact CG2-CD2 4.42Å; V18-I72 WeakPolarHBondContact CA-O 3.37Å; V18-L73 HydrophobicContact CB-CD2 4.33Å; V18-L73 HydrophobicContact CG1-CD2 3.78Å
19	T	98.8	Very high	97.7	Very high	14 Å²	14	42.3 Å²	42.3	9%	0.086	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	122.5	169.8	-53.9	0	0	0	0	108.9	V27 Y28 R29 L71 I72	T19-V27 HydrophobicContact CG2-CG1 3.39Å; T19-Y28 CarbonylContact C-O 3.52Å; T19-Y28 WeakPolarHBondContact CA-O 3.39Å; T19-R29 HydrophobicContact CG2-CB 4.39Å; T19-R29 PolarHBondContact OG1-NH1 3.13Å; T19-L71 CarbonylContact O-C 3.59Å; T19-L71 VanDerWaalsContact O-CA 3.29Å; T19-L71 WeakPolarHBondContact O-CA 3.47Å; T19-I72 HydrophobicContact CG2-CD1 4.43Å; T19-I72 PolarHBondContact N-O 3.19Å; T19-I72 PolarHBondContact O-N 2.81Å
20	C	98.6	Very high	97.9	Very high	0 Å²	0	41.6 Å²	41.6	0%	0	22%	0.216	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	122.9	179.7	175.5	0	0	0	0	109.1	Y28 M43 I63 L71	C20-Y28 PolarHBondContact N-O 2.98Å; C20-Y28 PolarHBondContact O-N 2.93Å; C20-M43 HydrophobicContact CB-SD 4.2Å; C20-I63 HydrophobicContact CB-CD1 4.32Å; C20-L71 HydrophobicContact CB-CD2 3.85Å; C20-L71 HydrophobicContact CB-CG 4.49Å
21	E	98.8	Very high	98.1	Very high	37 Å²	37	45.4 Å²	45.4	17%	0.173	23%	0.232	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-100.4	130.5	169	-172.1	175.6	121.6	0	0	109.4	V27 R69 F70	E21-V27 HydrophobicContact CG-CG2 4.17Å; E21-R69 WeakPolarHBondContact O-CB 3.48Å; E21-R69 PolarHBondContact O-N 3.39Å; E21-R69 WeakPolarHBondContact OE1-CD 3.28Å; E21-R69 IonicContact OE1-CZ 3.01Å; E21-R69 IonicContact OE1-NE 3.93Å; E21-R69 IonicContact OE1-NH1 3.82Å; E21-R69 PolarHBondContact OE1-NH1 2.85Å; E21-F70 HydrophobicContact CB-CD1 4.15Å; E21-F70 HydrophobicContact CB-CD2 4.41Å; E21-F70 HydrophobicContact CB-CE1 3.7Å; E21-F70 HydrophobicContact CB-CE2 3.98Å; E21-F70 HydrophobicContact CB-CG 4.47Å; E21-F70 HydrophobicContact CB-CZ 3.6Å; E21-F70 HydrophobicContact CG-CE1 4.05Å; E21-F70 HydrophobicContact CG-CZ 4.2Å; E21-F70 PolarHBondContact N-O 2.84Å; E21-F70 PolarHBondContact O-N 3.49Å; E21-F70 WeakPolarHBondContact OE1-CE1 3.33Å; E21-F70 VanDerWaalsContact OE2-CE1 3.29Å; E21-F70 WeakPolarHBondContact OE2-CE1 3.38Å; E21-F70 WeakPolarHBondContact OE2-CZ 3.45Å
22	T	98.6	Very high	98.2	Very high	8 Å²	8	42.7 Å²	42.7	5%	0.049	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	164.6	176.5	60	0	0	0	0	111.7	T24 G25 E26 Y28 I63 K67	T22-T24 PolarHBondContact O-N 3Å; T22-T24 PolarHBondContact OG1-OG1 2.77Å; T22-G25 WeakPolarHBondContact O-CA 3.43Å; T22-G25 PolarHBondContact O-N 2.79Å; T22-G25 PolarHBondContact OG1-N 3.03Å; T22-G25 VanDerWaalsContact OG1-N 3.08Å; T22-E26 PolarHBondContact N-O 3.22Å; T22-E26 PolarHBondContact OG1-N 3.01Å; T22-E26 VanDerWaalsContact OG1-N 3.11Å; T22-E26 PolarHBondContact OG1-O 2.8Å; T22-E26 PolarHBondContact OG1-OE2 2.49Å; T22-Y28 HydrophobicContact CG2-CD2 3.96Å; T22-Y28 HydrophobicContact CG2-CE2 3.54Å; T22-I63 HydrophobicContact CG2-CG2 4.44Å; T22-K67 CarbonylContact C-O 3.44Å; T22-K67 VanDerWaalsContact CA-O 3.23Å; T22-K67 WeakPolarHBondContact CA-O 3.45Å
23	N	98.4	Very high	98.3	Very high	78 Å²	78	43 Å²	43	42%	0.417	22%	0.223	S	C	.	.	S	Bend	trans	-60.3	-26.8	173.3	-74.8	-23.2	0	0	0	112.9	S66 K67 R69	N23-S66 PolarHBondContact ND2-O 3.08Å; N23-S66 VanDerWaalsContact ND2-O 3.15Å; N23-K67 PolarHBondContact N-O 3.26Å; N23-R69 PolarHBondContact O-NH2 3.43Å
24	T	97.1	Very high	98.4	Very high	67 Å²	67	47.6 Å²	47.6	41%	0.411	24%	0.244	S	C	.	.	S	Bend	trans	-76	-36	173	32.9	0	0	0	0	110	T22 E26 R51	T22-T24 PolarHBondContact O-N 3Å; T22-T24 PolarHBondContact OG1-OG1 2.77Å; T24-E26 WeakPolarHBondContact CB-OE1 3.44Å; T24-E26 WeakPolarHBondContact CB-OE2 3.31Å; T24-E26 PolarHBondContact OG1-OE2 2.72Å; T24-R51 VanDerWaalsContact C-CZ 3.43Å; T24-R51 VanDerWaalsContact CG2-NH2 3.35Å; T24-R51 WeakPolarHBondContact O-CD 3.18Å; T24-R51 PolarHBondContact O-NE 2.92Å; T24-R51 PolarHBondContact O-NH1 3.05Å; T24-R51 PolarHBondContact O-NH2 3.18Å
25	G	97.5	Very high	98.4	Very high	16 Å²	16	44.5 Å²	44.5	17%	0.165	23%	0.231	C	C	.	.			trans	107.7	15.3	173.5	0	0	0	0	0	113	T22	T22-G25 WeakPolarHBondContact O-CA 3.43Å; T22-G25 PolarHBondContact O-N 2.79Å; T22-G25 PolarHBondContact OG1-N 3.03Å; T22-G25 VanDerWaalsContact OG1-N 3.08Å
26	E	98	Very high	98.4	Very high	35 Å²	35	45.4 Å²	45.4	16%	0.164	22%	0.223	C	C	.	.			trans	-73.6	141.2	161.1	-54.2	77.6	-151.6	0	0	108.9	T22 T24 Y28 V48 T49 R51	T22-E26 PolarHBondContact N-O 3.22Å; T22-E26 PolarHBondContact OG1-N 3.01Å; T22-E26 VanDerWaalsContact OG1-N 3.11Å; T22-E26 PolarHBondContact OG1-O 2.8Å; T22-E26 PolarHBondContact OG1-OE2 2.49Å; T24-E26 WeakPolarHBondContact CB-OE1 3.44Å; T24-E26 WeakPolarHBondContact CB-OE2 3.31Å; T24-E26 PolarHBondContact OG1-OE2 2.72Å; E26-Y28 HydrophobicContact CB-CE2 3.73Å; E26-V48 HydrophobicContact CB-CG2 4.49Å; E26-T49 WeakPolarHBondContact CA-O 3.35Å; E26-R51 IonicContact OE1-CZ 2.71Å; E26-R51 IonicContact OE1-NE 3.51Å; E26-R51 PolarHBondContact OE1-NE 3.15Å; E26-R51 IonicContact OE1-NH2 2.65Å
27	V	98.7	Very high	98.4	Very high	40 Å²	40	47.4 Å²	47.4	24%	0.242	24%	0.236	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-113	120.1	-175.3	-179	0	0	0	0	109.1	T19 E21 V48 T49	T19-V27 HydrophobicContact CG2-CG1 3.39Å; E21-V27 HydrophobicContact CG-CG2 4.17Å; V27-V48 CarbonylContact O-C 3.56Å; V27-V48 VanDerWaalsContact O-CA 3.28Å; V27-V48 WeakPolarHBondContact O-CA 3.38Å; V27-T49 PolarHBondContact N-O 3.11Å; V27-T49 PolarHBondContact O-N 3.45Å
28	Y	98.8	Very high	98.3	Very high	43 Å²	43	47.3 Å²	47.3	17%	0.169	24%	0.237	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	114.4	-179.6	-63.5	-98.4	0	0	0	109	T19 C20 T22 E26 I46 V48 L58 V61 I63	T19-Y28 CarbonylContact C-O 3.52Å; T19-Y28 WeakPolarHBondContact CA-O 3.39Å; C20-Y28 PolarHBondContact N-O 2.98Å; C20-Y28 PolarHBondContact O-N 2.93Å; T22-Y28 HydrophobicContact CG2-CD2 3.96Å; T22-Y28 HydrophobicContact CG2-CE2 3.54Å; E26-Y28 HydrophobicContact CB-CE2 3.73Å; Y28-I46 HydrophobicContact CD1-CG2 4Å; Y28-I46 HydrophobicContact CG-CG2 4.43Å; Y28-V48 HydrophobicContact CD1-CB 3.93Å; Y28-V48 HydrophobicContact CD1-CG2 3.73Å; Y28-V48 HydrophobicContact CD2-CG2 4.4Å; Y28-V48 HydrophobicContact CE1-CB 4.01Å; Y28-V48 HydrophobicContact CE1-CG2 3.52Å; Y28-V48 HydrophobicContact CE2-CG2 4.2Å; Y28-V48 HydrophobicContact CG-CG2 4.17Å; Y28-L58 HydrophobicContact CE1-CD1 4.24Å; Y28-V61 HydrophobicContact CD1-CG1 4.43Å; Y28-V61 HydrophobicContact CE1-CG1 4.37Å; Y28-I63 HydrophobicContact CD1-CD1 4.25Å; Y28-I63 HydrophobicContact CD2-CD1 3.84Å; Y28-I63 HydrophobicContact CE2-CD1 4.35Å; Y28-I63 HydrophobicContact CG-CD1 3.79Å
29	R	98.8	Very high	98.3	Very high	138 Å²	138	50 Å²	50	52%	0.521	25%	0.25	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	119.5	175.3	-179	175.5	178.3	82.9	0.2	110	I17 V18 T19 I46 T47	I17-R29 HydrophobicContact CG2-CG 4.21Å; V18-R29 WeakPolarHBondContact O-CA 3.4Å; T19-R29 HydrophobicContact CG2-CB 4.39Å; T19-R29 PolarHBondContact OG1-NH1 3.13Å; R29-I46 CarbonylContact O-C 3.51Å; R29-I46 VanDerWaalsContact O-CA 3.31Å; R29-I46 WeakPolarHBondContact O-CA 3.41Å; R29-T47 PolarHBondContact N-O 3.09Å; R29-T47 PolarHBondContact O-N 3.34Å
30	G	98.7	Very high	98.2	Very high	2 Å²	2	50.3 Å²	50.3	2%	0.021	25%	0.251	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-174.3	-175.1	-176.7	0	0	0	0	0	112.2	I17 V18	I17-G30 WeakPolarHBondContact CA-O 3.38Å; V18-G30 PolarHBondContact N-O 2.87Å; V18-G30 PolarHBondContact O-N 2.65Å; V18-G30 VanDerWaalsContact O-N 3.12Å
31	K	98.8	Very high	98.2	Very high	89 Å²	89	50.3 Å²	50.3	39%	0.387	25%	0.251	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.1	124	177.6	-171.8	179.1	179.5	-178	0	109.7	G15 H16 I17 I33 M43 A44	G15-K31 WeakPolarHBondContact O-CE 3.2Å; H16-K31 CarbonylContact O-C 3.55Å; H16-K31 WeakPolarHBondContact O-CA 3.16Å; I17-K31 HydrophobicContact CD1-CB 4.06Å; K31-I33 HydrophobicContact CB-CD1 4.38Å; K31-I33 HydrophobicContact CD-CD1 3.92Å; K31-I33 HydrophobicContact CG-CD1 4.01Å; K31-I33 PolarHBondContact O-N 3.07Å; K31-M43 CarbonylContact O-C 3.5Å; K31-M43 WeakPolarHBondContact O-CA 3.05Å; K31-A44 PolarHBondContact N-O 3.25Å; K31-A44 PolarHBondContact O-N 3.01Å
32	L	98.8	Very high	98.2	Very high	0 Å²	0	51 Å²	51	0%	0	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.1	118.7	167.8	-176.4	60.9	0	0	0	108.3	L10 A13 E14 G15 H16 V18 E34 A35 C41 M43	L10-L32 HydrophobicContact CD1-CD2 4.08Å; A13-L32 HydrophobicContact CB-CD2 4.13Å; E14-L32 HydrophobicContact CG-CD2 4.28Å; E14-L32 HydrophobicContact CG-CG 4.37Å; G15-L32 WeakPolarHBondContact CA-O 3.07Å; G15-L32 PolarHBondContact N-O 3.38Å; H16-L32 PolarHBondContact O-N 2.79Å; V18-L32 HydrophobicContact CG1-CB 3.99Å; V18-L32 HydrophobicContact CG1-CD2 4.29Å; V18-L32 HydrophobicContact CG2-CB 3.81Å; L32-E34 WeakPolarHBondContact CD1-O 3.29Å; L32-A35 HydrophobicContact CD1-CB 4.47Å; L32-A35 HydrophobicContact CD2-CB 4.29Å; L32-C41 HydrophobicContact CD1-CB 3.88Å; L32-M43 HydrophobicContact CD1-CG 4.38Å
33	I	98.6	Very high	98.3	Very high	67 Å²	67	50.6 Å²	50.6	34%	0.344	25%	0.252	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	-47	179.1	-58.3	-56.6	0	0	0	110	K31 Q42 A44	K31-I33 HydrophobicContact CB-CD1 4.38Å; K31-I33 HydrophobicContact CD-CD1 3.92Å; K31-I33 HydrophobicContact CG-CD1 4.01Å; K31-I33 PolarHBondContact O-N 3.07Å; I33-Q42 HydrophobicContact CB-CB 4.33Å; I33-Q42 HydrophobicContact CB-CG 4.14Å; I33-Q42 WeakPolarHBondContact CB-O 3.19Å; I33-Q42 HydrophobicContact CG2-CG 4.47Å; I33-Q42 PolarHBondContact N-O 3.49Å; I33-A44 HydrophobicContact CD1-CB 3.8Å; I33-A44 HydrophobicContact CG1-CB 3.76Å
34	E	98.6	Very high	98.3	Very high	98 Å²	98	47.7 Å²	47.7	46%	0.458	24%	0.239	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-149.9	141.1	-177.8	-173.9	172.8	-172.4	0	0	109.3	L32 C41 Q42	L32-E34 WeakPolarHBondContact CD1-O 3.29Å; E34-C41 WeakPolarHBondContact O-CA 3.42Å; E34-Q42 HydrophobicContact CB-CB 4.2Å; E34-Q42 PolarHBondContact N-O 3.24Å; E34-Q42 PolarHBondContact O-N 2.97Å
35	A	98.3	Very high	98.3	Very high	3 Å²	3	50.4 Å²	50.4	3%	0.025	25%	0.251	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	134.8	168.2	0	0	0	0	0	110	L10 H11 E14 L32 N40	L10-A35 HydrophobicContact CD1-CB 4.36Å; L10-A35 HydrophobicContact CD2-CB 3.98Å; L10-A35 HydrophobicContact CG-CB 3.71Å; H11-A35 PolarHBondContact CE1-O 3.34Å; H11-A35 PolarHBondContact ND1-O 3.12Å; H11-A35 VanDerWaalsContact ND1-O 3.11Å; E14-A35 HydrophobicContact CG-CB 4.44Å; E14-A35 PolarHBondContact OE1-N 2.87Å; L32-A35 HydrophobicContact CD1-CB 4.47Å; L32-A35 HydrophobicContact CD2-CB 4.29Å; A35-N40 WeakPolarHBondContact CA-O 3.11Å
36	E	98.2	Very high	98.4	Very high	60 Å²	60	49.6 Å²	49.6	28%	0.28	24%	0.243	S	C	.	.			trans	-95.1	162.4	174.9	-69.2	173.4	-143.8	0	0	111.8	N38 M39 N40 Y62	E36-N38 VanDerWaalsContact CB-OD1 3.26Å; E36-N38 WeakPolarHBondContact CB-OD1 3.47Å; E36-N38 PolarHBondContact O-N 2.92Å; E36-N38 VanDerWaalsContact O-N 3.1Å; E36-N38 PolarHBondContact OE2-ND2 3.39Å; E36-N38 PolarHBondContact OE2-OD1 2.84Å; E36-M39 WeakPolarHBondContact O-CA 3.42Å; E36-M39 PolarHBondContact O-N 3Å; E36-N40 HydrophobicContact CB-CB 4.15Å; E36-N40 HydrophobicContact CG-CB 4.24Å; E36-N40 PolarHBondContact N-O 2.82Å; E36-N40 PolarHBondContact OE2-ND2 3.01Å; E36-Y62 PolarHBondContact OE1-OH 2.93Å
37	D	96.6	Very high	98.4	Very high	110 Å²	110	50.2 Å²	50.2	59%	0.588	25%	0.249	S	C	*	.	T	Hydrogen-bonded Turn	trans	-56.7	-27.7	175.8	-79.5	0.9	0	0	0	113.5	I3 H11 M39	I3-D37 WeakPolarHBondContact CD1-OD1 3.46Å; H11-D37 IonicContact NE2-OD1 3.77Å; H11-D37 PolarHBondContact NE2-OD1 3Å; D37-M39 PolarHBondContact O-N 2.77Å
38	N	96.9	Very high	98.4	Very high	87 Å²	87	48.4 Å²	48.4	47%	0.465	24%	0.238	S	C	.	.	T	Hydrogen-bonded Turn	trans	-86.9	8.4	177.1	63.6	23.5	0	0	0	113	E36 N40	E36-N38 VanDerWaalsContact CB-OD1 3.26Å; E36-N38 WeakPolarHBondContact CB-OD1 3.47Å; E36-N38 PolarHBondContact O-N 2.92Å; E36-N38 VanDerWaalsContact O-N 3.1Å; E36-N38 PolarHBondContact OE2-ND2 3.39Å; E36-N38 PolarHBondContact OE2-OD1 2.84Å; N38-N40 VanDerWaalsContact C-N 3.27Å; N38-N40 PolarHBondContact ND2-ND2 3.12Å; N38-N40 PolarHBondContact O-N 2.78Å; N38-N40 VanDerWaalsContact OD1-CB 3.26Å; N38-N40 WeakPolarHBondContact OD1-CB 3.09Å; N38-N40 PolarHBondContact OD1-N 3.49Å; N38-N40 PolarHBondContact OD1-ND2 3.11Å; N38-N40 VanDerWaalsContact OD1-ND2 3.1Å; N38-N40 PolarHBondContact OD1-OD1 2.98Å
39	M	98.1	Very high	98.4	Very high	59 Å²	59	49 Å²	49	29%	0.291	25%	0.246	S	C	.	.			trans	64.8	15.6	-175.2	-57.8	176.7	43.6	0	0	115.8	I7 L10 E36 D37 C41 G65 I68 L71	I7-M39 HydrophobicContact CD1-CG 3.66Å; I7-M39 HydrophobicContact CD1-SD 4.08Å; L10-M39 HydrophobicContact CD2-CB 4.45Å; L10-M39 HydrophobicContact CD2-CG 4.16Å; E36-M39 WeakPolarHBondContact O-CA 3.42Å; E36-M39 PolarHBondContact O-N 3Å; D37-M39 PolarHBondContact O-N 2.77Å; M39-C41 PolarHBondContact O-N 2.79Å; M39-C41 PolarHBondContact O-SG 3.13Å; M39-C41 VanDerWaalsContact O-SG 3.37Å; M39-G65 WeakPolarHBondContact O-CA 3.39Å; M39-I68 HydrophobicContact CE-CB 4.49Å; M39-I68 HydrophobicContact CE-CG2 4.37Å; M39-I68 WeakPolarHBondContact O-CD1 3.47Å; M39-L71 HydrophobicContact CE-CD1 4.21Å
40	N	98.4	Very high	98.4	Very high	20 Å²	20	45.8 Å²	45.8	11%	0.107	24%	0.237	C	C	.	.			trans	-60.6	136.9	165	-63.6	-24.1	0	0	0	108.9	A35 E36 N38 Y62 I63 R64 G65	A35-N40 WeakPolarHBondContact CA-O 3.11Å; E36-N40 HydrophobicContact CB-CB 4.15Å; E36-N40 HydrophobicContact CG-CB 4.24Å; E36-N40 PolarHBondContact N-O 2.82Å; E36-N40 PolarHBondContact OE2-ND2 3.01Å; N38-N40 VanDerWaalsContact C-N 3.27Å; N38-N40 PolarHBondContact ND2-ND2 3.12Å; N38-N40 PolarHBondContact O-N 2.78Å; N38-N40 VanDerWaalsContact OD1-CB 3.26Å; N38-N40 WeakPolarHBondContact OD1-CB 3.09Å; N38-N40 PolarHBondContact OD1-N 3.49Å; N38-N40 PolarHBondContact OD1-ND2 3.11Å; N38-N40 VanDerWaalsContact OD1-ND2 3.1Å; N38-N40 PolarHBondContact OD1-OD1 2.98Å; N40-Y62 HydrophobicContact CB-CE1 4.21Å; N40-Y62 HydrophobicContact CB-CE2 4.23Å; N40-Y62 VanDerWaalsContact CB-OH 3.23Å; N40-Y62 WeakPolarHBondContact CB-OH 3.3Å; N40-Y62 PolarHBondContact ND2-OH 3.39Å; N40-I63 WeakPolarHBondContact CA-O 3.34Å; N40-R64 WeakPolarHBondContact OD1-CA 3.33Å; N40-G65 PolarHBondContact OD1-N 3.23Å
41	C	98.6	Very high	98.3	Very high	0 Å²	0	53.6 Å²	53.6	0%	0	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	124.4	-176.2	-65.5	0	0	0	0	110.5	L32 E34 M39 Y62 I63 I68	L32-C41 HydrophobicContact CD1-CB 3.88Å; E34-C41 WeakPolarHBondContact O-CA 3.42Å; M39-C41 PolarHBondContact O-N 2.79Å; M39-C41 PolarHBondContact O-SG 3.13Å; M39-C41 VanDerWaalsContact O-SG 3.37Å; C41-Y62 WeakPolarHBondContact O-CA 3.37Å; C41-I63 PolarHBondContact N-O 3.27Å; C41-I63 PolarHBondContact O-N 3.39Å; C41-I68 HydrophobicContact CB-CD1 4.38Å
42	Q	98.8	Very high	98.2	Very high	50 Å²	50	53.7 Å²	53.7	23%	0.234	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.9	129.2	164.7	-173.6	173.2	-24.4	0	0	109	I33 E34 Y62	I33-Q42 HydrophobicContact CB-CB 4.33Å; I33-Q42 HydrophobicContact CB-CG 4.14Å; I33-Q42 WeakPolarHBondContact CB-O 3.19Å; I33-Q42 HydrophobicContact CG2-CG 4.47Å; I33-Q42 PolarHBondContact N-O 3.49Å; E34-Q42 HydrophobicContact CB-CB 4.2Å; E34-Q42 PolarHBondContact N-O 3.24Å; E34-Q42 PolarHBondContact O-N 2.97Å; Q42-Y62 HydrophobicContact CB-CD2 4.12Å
43	M	98.8	Very high	98.1	Very high	0 Å²	0	56 Å²	56	0%	0	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	156	-179.8	-60.7	-179.3	67.4	0	0	110.8	V18 C20 K31 L32 I46 Q60 V61 I63	V18-M43 HydrophobicContact CG2-CE 3.63Å; V18-M43 HydrophobicContact CG2-SD 4.42Å; C20-M43 HydrophobicContact CB-SD 4.2Å; K31-M43 CarbonylContact O-C 3.5Å; K31-M43 WeakPolarHBondContact O-CA 3.05Å; L32-M43 HydrophobicContact CD1-CG 4.38Å; M43-I46 HydrophobicContact CB-CD1 4.16Å; M43-I46 HydrophobicContact CB-CG1 3.81Å; M43-Q60 WeakPolarHBondContact O-CA 3.33Å; M43-V61 PolarHBondContact N-O 3.18Å; M43-V61 PolarHBondContact O-N 2.86Å; M43-I63 HydrophobicContact SD-CD1 4.15Å
44	A	98.8	Very high	98	Very high	17 Å²	17	61.2 Å²	61.2	14%	0.14	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.5	159.2	173.6	0	0	0	0	0	112.4	K31 I33 I46 E59	K31-A44 PolarHBondContact N-O 3.25Å; K31-A44 PolarHBondContact O-N 3.01Å; I33-A44 HydrophobicContact CD1-CB 3.8Å; I33-A44 HydrophobicContact CG1-CB 3.76Å; A44-I46 VanDerWaalsContact C-CD1 3.48Å; A44-I46 VanDerWaalsContact CA-CD1 3.49Å; A44-E59 CarbonylContact C-O 3.54Å; A44-E59 WeakPolarHBondContact CA-O 3.21Å
45	N	98.5	Very high	98	Very high	124 Å²	124	61 Å²	61	66%	0.663	32%	0.315	S	S	*	.	E	Extended strand (participates in β ladder)	trans	49.7	60.6	-177.8	-59.4	-39	0	0	0	111.6	E59	N45-E59 PolarHBondContact N-O 3.01Å
46	I	98.7	Very high	98	Very high	0 Å²	0	62.6 Å²	62.6	0%	0	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.2	129.7	-169.2	-49.6	93.1	0	0	0	110.6	Y28 R29 M43 A44 Q57 L58 V61	Y28-I46 HydrophobicContact CD1-CG2 4Å; Y28-I46 HydrophobicContact CG-CG2 4.43Å; R29-I46 CarbonylContact O-C 3.51Å; R29-I46 VanDerWaalsContact O-CA 3.31Å; R29-I46 WeakPolarHBondContact O-CA 3.41Å; M43-I46 HydrophobicContact CB-CD1 4.16Å; M43-I46 HydrophobicContact CB-CG1 3.81Å; A44-I46 VanDerWaalsContact C-CD1 3.48Å; A44-I46 VanDerWaalsContact CA-CD1 3.49Å; I46-Q57 CarbonylContact O-C 3.59Å; I46-Q57 WeakPolarHBondContact O-CA 3.31Å; I46-Q57 PolarHBondContact O-OE1 3.26Å; I46-Q57 VanDerWaalsContact O-OE1 3.08Å; I46-L58 HydrophobicContact CB-CB 4.36Å; I46-L58 HydrophobicContact CD1-CB 4.39Å; I46-L58 WeakPolarHBondContact CD1-O 3.14Å; I46-L58 PolarHBondContact N-O 3.09Å; I46-L58 PolarHBondContact O-N 3.3Å; I46-V61 HydrophobicContact CD1-CB 4.06Å; I46-V61 HydrophobicContact CD1-CG2 3.94Å; I46-V61 HydrophobicContact CG1-CG2 4.49Å
47	T	98.7	Very high	98	Very high	47 Å²	47	66 Å²	66	29%	0.288	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	114.6	159	-56.5	0	0	0	0	108.4	R29 V55 A56 Q57	R29-T47 PolarHBondContact N-O 3.09Å; R29-T47 PolarHBondContact O-N 3.34Å; T47-V55 HydrophobicContact CG2-CG1 3.4Å; T47-A56 WeakPolarHBondContact CA-O 3.29Å; T47-Q57 VanDerWaalsContact OG1-CD 3.31Å; T47-Q57 PolarHBondContact OG1-NE2 3.46Å; T47-Q57 PolarHBondContact OG1-OE1 3.16Å
48	V	98.4	Very high	98.1	Very high	2 Å²	2	64.1 Å²	64.1	1%	0.012	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	134.6	175	62.6	0	0	0	0	110	E26 V27 Y28 V55 A56 L58	E26-V48 HydrophobicContact CB-CG2 4.49Å; V27-V48 CarbonylContact O-C 3.56Å; V27-V48 VanDerWaalsContact O-CA 3.28Å; V27-V48 WeakPolarHBondContact O-CA 3.38Å; Y28-V48 HydrophobicContact CD1-CB 3.93Å; Y28-V48 HydrophobicContact CD1-CG2 3.73Å; Y28-V48 HydrophobicContact CD2-CG2 4.4Å; Y28-V48 HydrophobicContact CE1-CB 4.01Å; Y28-V48 HydrophobicContact CE1-CG2 3.52Å; Y28-V48 HydrophobicContact CE2-CG2 4.2Å; Y28-V48 HydrophobicContact CG-CG2 4.17Å; V48-V55 CarbonylContact O-C 3.49Å; V48-V55 VanDerWaalsContact O-CA 3.27Å; V48-V55 WeakPolarHBondContact O-CA 3.41Å; V48-A56 HydrophobicContact CG1-CB 3.75Å; V48-A56 WeakPolarHBondContact CG1-O 3.34Å; V48-A56 PolarHBondContact N-O 3.37Å; V48-A56 PolarHBondContact O-N 3.15Å; V48-L58 HydrophobicContact CB-CD1 4.3Å; V48-L58 HydrophobicContact CG1-CD1 3.87Å; V48-L58 HydrophobicContact CG1-CG 4.19Å
49	T	98.6	Very high	98.2	Very high	55 Å²	55	68.2 Å²	68.2	34%	0.337	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	116.4	169.4	-52.8	0	0	0	0	108.5	E26 V27 R54 V55	E26-T49 WeakPolarHBondContact CA-O 3.35Å; V27-T49 PolarHBondContact N-O 3.11Å; V27-T49 PolarHBondContact O-N 3.45Å; T49-R54 WeakPolarHBondContact CA-O 3.37Å; T49-V55 HydrophobicContact CG2-CG2 4.36Å
50	H	97.8	Very high	98.1	Very high	72 Å²	72	71.6 Å²	71.6	33%	0.333	37%	0.365	S	S	.	.			trans	-77	164	175.7	-62.7	-74.8	0	0	0	110.6	D52 G53 R54	H50-D52 WeakPolarHBondContact CB-OD1 3.39Å; H50-D52 PolarHBondContact O-N 3.08Å; H50-G53 WeakPolarHBondContact O-CA 3.42Å; H50-G53 PolarHBondContact O-N 3.35Å; H50-R54 PolarHBondContact CD2-O 2.85Å; H50-R54 PolarHBondContact N-O 3.05Å
51	R	96.9	Very high	98.1	Very high	165 Å²	165	71.9 Å²	71.9	62%	0.623	37%	0.367	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.6	-24.6	-179.1	-72.4	-166.7	-103.2	-177.3	-9.5	114.6	T24 E26 G53	T24-R51 VanDerWaalsContact C-CZ 3.43Å; T24-R51 VanDerWaalsContact CG2-NH2 3.35Å; T24-R51 WeakPolarHBondContact O-CD 3.18Å; T24-R51 PolarHBondContact O-NE 2.92Å; T24-R51 PolarHBondContact O-NH1 3.05Å; T24-R51 PolarHBondContact O-NH2 3.18Å; E26-R51 IonicContact OE1-CZ 2.71Å; E26-R51 IonicContact OE1-NE 3.51Å; E26-R51 PolarHBondContact OE1-NE 3.15Å; E26-R51 IonicContact OE1-NH2 2.65Å; R51-G53 PolarHBondContact O-N 2.79Å
52	D	96.4	Very high	98.1	Very high	91 Å²	91	77.8 Å²	77.8	49%	0.487	39%	0.39	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.4	3.2	173.6	62.1	2.9	0	0	0	112.8	H50 R54	H50-D52 WeakPolarHBondContact CB-OD1 3.39Å; H50-D52 PolarHBondContact O-N 3.08Å; D52-R54 VanDerWaalsContact C-N 3.28Å; D52-R54 PolarHBondContact O-N 3.46Å; D52-R54 WeakPolarHBondContact OD1-CB 3.46Å; D52-R54 WeakPolarHBondContact OD1-CG 3.45Å; D52-R54 PolarHBondContact OD1-N 2.92Å; D52-R54 VanDerWaalsContact OD2-CD 3.31Å; D52-R54 WeakPolarHBondContact OD2-CD 3.23Å; D52-R54 IonicContact OD2-CZ 3.57Å; D52-R54 IonicContact OD2-NE 3.2Å; D52-R54 PolarHBondContact OD2-NE 3.34Å; D52-R54 IonicContact OD2-NH1 3.05Å; D52-R54 PolarHBondContact OD2-NH1 3.08Å; D52-R54 IonicContact OD2-NH2 3.33Å
53	G	96.8	Very high	98.1	Very high	49 Å²	49	76 Å²	76	51%	0.505	38%	0.382	S	S	.	.	S	Bend	trans	82.6	-2.2	-179.2	0	0	0	0	0	114.2	H50 R51	H50-G53 WeakPolarHBondContact O-CA 3.42Å; H50-G53 PolarHBondContact O-N 3.35Å; R51-G53 PolarHBondContact O-N 2.79Å
54	R	98.1	Very high	98.1	Very high	177 Å²	177	83.6 Å²	83.6	67%	0.668	41%	0.411	S	S	*	.			trans	-68.6	142.1	177	-64.5	-179.1	-164.7	139.6	-5.7	110.3	T49 H50 D52	T49-R54 WeakPolarHBondContact CA-O 3.37Å; H50-R54 PolarHBondContact CD2-O 2.85Å; H50-R54 PolarHBondContact N-O 3.05Å; D52-R54 VanDerWaalsContact C-N 3.28Å; D52-R54 PolarHBondContact O-N 3.46Å; D52-R54 WeakPolarHBondContact OD1-CB 3.46Å; D52-R54 WeakPolarHBondContact OD1-CG 3.45Å; D52-R54 PolarHBondContact OD1-N 2.92Å; D52-R54 VanDerWaalsContact OD2-CD 3.31Å; D52-R54 WeakPolarHBondContact OD2-CD 3.23Å; D52-R54 IonicContact OD2-CZ 3.57Å; D52-R54 IonicContact OD2-NE 3.2Å; D52-R54 PolarHBondContact OD2-NE 3.34Å; D52-R54 IonicContact OD2-NH1 3.05Å; D52-R54 PolarHBondContact OD2-NH1 3.08Å; D52-R54 IonicContact OD2-NH2 3.33Å
55	V	98.4	Very high	98.1	Very high	92 Å²	92	83.1 Å²	83.1	56%	0.558	41%	0.408	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.9	135.8	179.4	-179.5	0	0	0	0	109.5	T47 V48 T49	T47-V55 HydrophobicContact CG2-CG1 3.4Å; V48-V55 CarbonylContact O-C 3.49Å; V48-V55 VanDerWaalsContact O-CA 3.27Å; V48-V55 WeakPolarHBondContact O-CA 3.41Å; T49-V55 HydrophobicContact CG2-CG2 4.36Å
56	A	98	Very high	98.1	Very high	37 Å²	37	80.5 Å²	80.5	31%	0.306	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.6	158.6	172.7	0	0	0	0	0	110.8	T47 V48	T47-A56 WeakPolarHBondContact CA-O 3.29Å; V48-A56 HydrophobicContact CG1-CB 3.75Å; V48-A56 WeakPolarHBondContact CG1-O 3.34Å; V48-A56 PolarHBondContact N-O 3.37Å; V48-A56 PolarHBondContact O-N 3.15Å
57	Q	98.3	Very high	98.1	Very high	133 Å²	133	86.4 Å²	86.4	62%	0.621	43%	0.425	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.3	136.5	173.5	-62.4	-64.7	-10.8	0	0	109.3	I46 T47	I46-Q57 CarbonylContact O-C 3.59Å; I46-Q57 WeakPolarHBondContact O-CA 3.31Å; I46-Q57 PolarHBondContact O-OE1 3.26Å; I46-Q57 VanDerWaalsContact O-OE1 3.08Å; T47-Q57 VanDerWaalsContact OG1-CD 3.31Å; T47-Q57 PolarHBondContact OG1-NE2 3.46Å; T47-Q57 PolarHBondContact OG1-OE1 3.16Å
58	L	98	Very high	98.1	Very high	69 Å²	69	84.8 Å²	84.8	36%	0.361	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	133.7	177.9	-58	172.7	0	0	0	108.4	Y28 I46 V48 V61	Y28-L58 HydrophobicContact CE1-CD1 4.24Å; I46-L58 HydrophobicContact CB-CB 4.36Å; I46-L58 HydrophobicContact CD1-CB 4.39Å; I46-L58 WeakPolarHBondContact CD1-O 3.14Å; I46-L58 PolarHBondContact N-O 3.09Å; I46-L58 PolarHBondContact O-N 3.3Å; V48-L58 HydrophobicContact CB-CD1 4.3Å; V48-L58 HydrophobicContact CG1-CD1 3.87Å; V48-L58 HydrophobicContact CG1-CG 4.19Å; L58-V61 HydrophobicContact CB-CG2 3.94Å; L58-V61 HydrophobicContact CD1-CG2 3.5Å; L58-V61 HydrophobicContact CG-CG2 4.36Å
59	E	98.2	Very high	98.1	Very high	173 Å²	173	90.9 Å²	90.9	81%	0.808	44%	0.437	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.5	-43.2	179	-66.6	-175.2	169.4	0	0	111.5	A44 N45	A44-E59 CarbonylContact C-O 3.54Å; A44-E59 WeakPolarHBondContact CA-O 3.21Å; N45-E59 PolarHBondContact N-O 3.01Å
60	Q	98	Very high	98	Very high	130 Å²	130	92.3 Å²	92.3	61%	0.607	44%	0.439	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-147.4	141	-176.7	-170.8	168.7	-21.7	0	0	111	M43	M43-Q60 WeakPolarHBondContact O-CA 3.33Å
61	V	98.3	Very high	98.1	Very high	26 Å²	26	90.7 Å²	90.7	16%	0.158	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.6	145.8	177.1	171.7	0	0	0	0	109.4	Y28 M43 I46 L58 I63	Y28-V61 HydrophobicContact CD1-CG1 4.43Å; Y28-V61 HydrophobicContact CE1-CG1 4.37Å; M43-V61 PolarHBondContact N-O 3.18Å; M43-V61 PolarHBondContact O-N 2.86Å; I46-V61 HydrophobicContact CD1-CB 4.06Å; I46-V61 HydrophobicContact CD1-CG2 3.94Å; I46-V61 HydrophobicContact CG1-CG2 4.49Å; L58-V61 HydrophobicContact CB-CG2 3.94Å; L58-V61 HydrophobicContact CD1-CG2 3.5Å; L58-V61 HydrophobicContact CG-CG2 4.36Å; V61-I63 HydrophobicContact CG1-CD1 4.16Å; V61-I63 HydrophobicContact CG1-CG1 3.52Å
62	Y	98.5	Very high	98.1	Very high	124 Å²	124	87.3 Å²	87.3	49%	0.486	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	116.4	167.1	-175	-92	0	0	0	109.4	E36 N40 C41 Q42	E36-Y62 PolarHBondContact OE1-OH 2.93Å; N40-Y62 HydrophobicContact CB-CE1 4.21Å; N40-Y62 HydrophobicContact CB-CE2 4.23Å; N40-Y62 VanDerWaalsContact CB-OH 3.23Å; N40-Y62 WeakPolarHBondContact CB-OH 3.3Å; N40-Y62 PolarHBondContact ND2-OH 3.39Å; C41-Y62 WeakPolarHBondContact O-CA 3.37Å; Q42-Y62 HydrophobicContact CB-CD2 4.12Å
63	I	98.4	Very high	98.2	Very high	13 Å²	13	85.1 Å²	85.1	7%	0.067	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.9	125	-177.6	-50.7	-178	0	0	0	108.7	C20 T22 Y28 N40 C41 M43 V61 G65 I68	C20-I63 HydrophobicContact CB-CD1 4.32Å; T22-I63 HydrophobicContact CG2-CG2 4.44Å; Y28-I63 HydrophobicContact CD1-CD1 4.25Å; Y28-I63 HydrophobicContact CD2-CD1 3.84Å; Y28-I63 HydrophobicContact CE2-CD1 4.35Å; Y28-I63 HydrophobicContact CG-CD1 3.79Å; N40-I63 WeakPolarHBondContact CA-O 3.34Å; C41-I63 PolarHBondContact N-O 3.27Å; C41-I63 PolarHBondContact O-N 3.39Å; M43-I63 HydrophobicContact SD-CD1 4.15Å; V61-I63 HydrophobicContact CG1-CD1 4.16Å; V61-I63 HydrophobicContact CG1-CG1 3.52Å; I63-G65 PolarHBondContact O-N 3.12Å; I63-I68 HydrophobicContact CG2-CD1 4.29Å; I63-I68 HydrophobicContact CG2-CG1 3.8Å
64	R	98.6	Very high	98.2	Very high	160 Å²	160	84.1 Å²	84.1	60%	0.604	40%	0.398	S	S	*	.			trans	-67	129	173.6	-175.7	-177.3	175	102.4	1.2	110.5	N40 S66 K67	N40-R64 WeakPolarHBondContact OD1-CA 3.33Å; R64-S66 VanDerWaalsContact C-N 3.28Å; R64-S66 WeakPolarHBondContact CD-OG 3.48Å; R64-S66 PolarHBondContact NE-OG 3.04Å; R64-S66 PolarHBondContact O-N 3.2Å; R64-K67 HydrophobicContact CB-CG 4.35Å; R64-K67 WeakPolarHBondContact O-CA 3.45Å; R64-K67 WeakPolarHBondContact O-CB 3.47Å; R64-K67 PolarHBondContact O-N 3.14Å
65	G	98.2	Very high	97.9	Very high	7 Å²	7	81.7 Å²	81.7	7%	0.072	40%	0.399	C	S	.	.	G	3₁₀ helix	trans	-57.1	-37.4	-175.6	0	0	0	0	0	114.2	M39 N40 I63 K67 I68	M39-G65 WeakPolarHBondContact O-CA 3.39Å; N40-G65 PolarHBondContact OD1-N 3.23Å; I63-G65 PolarHBondContact O-N 3.12Å; G65-K67 PolarHBondContact O-N 3.37Å; G65-I68 WeakPolarHBondContact O-CB 3.48Å; G65-I68 PolarHBondContact O-N 3.09Å
66	S	98.3	Very high	97.5	Very high	69 Å²	69	83.7 Å²	83.7	48%	0.483	40%	0.404	S	S	.	.	G	3₁₀ helix	trans	-65.5	-7.8	175.9	71.9	0	0	0	0	114.5	N23 R64	N23-S66 PolarHBondContact ND2-O 3.08Å; N23-S66 VanDerWaalsContact ND2-O 3.15Å; R64-S66 VanDerWaalsContact C-N 3.28Å; R64-S66 WeakPolarHBondContact CD-OG 3.48Å; R64-S66 PolarHBondContact NE-OG 3.04Å; R64-S66 PolarHBondContact O-N 3.2Å
67	K	98.4	Very high	97.1	Very high	123 Å²	123	83.1 Å²	83.1	54%	0.535	40%	0.395	S	S	.	.	G	3₁₀ helix	trans	-105.6	-0.2	176.3	-59.3	-59.5	-176	-179.3	0	112.5	T22 N23 R64 G65	T22-K67 CarbonylContact C-O 3.44Å; T22-K67 VanDerWaalsContact CA-O 3.23Å; T22-K67 WeakPolarHBondContact CA-O 3.45Å; N23-K67 PolarHBondContact N-O 3.26Å; R64-K67 HydrophobicContact CB-CG 4.35Å; R64-K67 WeakPolarHBondContact O-CA 3.45Å; R64-K67 WeakPolarHBondContact O-CB 3.47Å; R64-K67 PolarHBondContact O-N 3.14Å; G65-K67 PolarHBondContact O-N 3.37Å
68	I	98.6	Very high	96.5	Very high	13 Å²	13	83.6 Å²	83.6	7%	0.067	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.6	132.7	175.6	-59.4	-178.5	0	0	0	109.1	M39 C41 I63 G65 L71	M39-I68 HydrophobicContact CE-CB 4.49Å; M39-I68 HydrophobicContact CE-CG2 4.37Å; M39-I68 WeakPolarHBondContact O-CD1 3.47Å; C41-I68 HydrophobicContact CB-CD1 4.38Å; I63-I68 HydrophobicContact CG2-CD1 4.29Å; I63-I68 HydrophobicContact CG2-CG1 3.8Å; G65-I68 WeakPolarHBondContact O-CB 3.48Å; G65-I68 PolarHBondContact O-N 3.09Å; I68-L71 HydrophobicContact CD1-CD1 4.35Å; I68-L71 HydrophobicContact CG2-CD1 3.94Å; I68-L71 HydrophobicContact CG2-CG 4.06Å
69	R	98.4	Very high	95.7	Very high	130 Å²	130	85.6 Å²	85.6	49%	0.491	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	-52.3	172.2	-174.4	-176.5	-70.7	169.3	-3.6	110.5	E21 N23	E21-R69 WeakPolarHBondContact O-CB 3.48Å; E21-R69 PolarHBondContact O-N 3.39Å; E21-R69 WeakPolarHBondContact OE1-CD 3.28Å; E21-R69 IonicContact OE1-CZ 3.01Å; E21-R69 IonicContact OE1-NE 3.93Å; E21-R69 IonicContact OE1-NH1 3.82Å; E21-R69 PolarHBondContact OE1-NH1 2.85Å; N23-R69 PolarHBondContact O-NH2 3.43Å
70	F	98.5	Very high	94.9	Very high	86 Å²	86	77.7 Å²	77.7	38%	0.377	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.9	163.9	173.6	65.2	-98.1	0	0	0	111.6	E21 I72	E21-F70 HydrophobicContact CB-CD1 4.15Å; E21-F70 HydrophobicContact CB-CD2 4.41Å; E21-F70 HydrophobicContact CB-CE1 3.7Å; E21-F70 HydrophobicContact CB-CE2 3.98Å; E21-F70 HydrophobicContact CB-CG 4.47Å; E21-F70 HydrophobicContact CB-CZ 3.6Å; E21-F70 HydrophobicContact CG-CE1 4.05Å; E21-F70 HydrophobicContact CG-CZ 4.2Å; E21-F70 PolarHBondContact N-O 2.84Å; E21-F70 PolarHBondContact O-N 3.49Å; E21-F70 WeakPolarHBondContact OE1-CE1 3.33Å; E21-F70 VanDerWaalsContact OE2-CE1 3.29Å; E21-F70 WeakPolarHBondContact OE2-CE1 3.38Å; E21-F70 WeakPolarHBondContact OE2-CZ 3.45Å; F70-I72 HydrophobicContact CD2-CG1 4.07Å; F70-I72 HydrophobicContact CE2-CD1 4.04Å; F70-I72 HydrophobicContact CE2-CG1 3.81Å
71	L	98.3	Very high	93.8	Very high	38 Å²	38	75.5 Å²	75.5	20%	0.199	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	139.6	170.9	-68.9	127.8	0	0	0	109.8	L10 V18 T19 C20 M39 I68 L73	L10-L71 HydrophobicContact CD1-CD1 3.96Å; L10-L71 HydrophobicContact CD2-CD1 4.44Å; V18-L71 HydrophobicContact CG2-CD2 4.42Å; T19-L71 CarbonylContact O-C 3.59Å; T19-L71 VanDerWaalsContact O-CA 3.29Å; T19-L71 WeakPolarHBondContact O-CA 3.47Å; C20-L71 HydrophobicContact CB-CD2 3.85Å; C20-L71 HydrophobicContact CB-CG 4.49Å; M39-L71 HydrophobicContact CE-CD1 4.21Å; I68-L71 HydrophobicContact CD1-CD1 4.35Å; I68-L71 HydrophobicContact CG2-CD1 3.94Å; I68-L71 HydrophobicContact CG2-CG 4.06Å; L71-L73 HydrophobicContact CB-CD2 4.04Å
72	I	98.3	Very high	92.9	Very high	94 Å²	94	77.3 Å²	77.3	48%	0.482	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.1	118.3	167	-51.3	176	0	0	0	106.9	V18 T19 F70	V18-I72 WeakPolarHBondContact CA-O 3.37Å; T19-I72 HydrophobicContact CG2-CD1 4.43Å; T19-I72 PolarHBondContact N-O 3.19Å; T19-I72 PolarHBondContact O-N 2.81Å; F70-I72 HydrophobicContact CD2-CG1 4.07Å; F70-I72 HydrophobicContact CE2-CD1 4.04Å; F70-I72 HydrophobicContact CE2-CG1 3.81Å
73	L	97.5	Very high	91.7	Very high	44 Å²	44	75.4 Å²	75.4	23%	0.23	37%	0.373	C	S	.	.	P	Polyproline II helix	trans	-102.8	162.3	-179.4	-50.8	-177.8	0	0	0	110.5	V9 L10 A13 V18 L71 L77	V9-L73 HydrophobicContact CG1-CD1 3.95Å; L10-L73 HydrophobicContact CD1-CD2 4.22Å; A13-L73 HydrophobicContact CB-CB 4.45Å; A13-L73 HydrophobicContact CB-CD1 4.12Å; A13-L73 HydrophobicContact CB-CD2 3.76Å; A13-L73 HydrophobicContact CB-CG 4.33Å; V18-L73 HydrophobicContact CB-CD2 4.33Å; V18-L73 HydrophobicContact CG1-CD2 3.78Å; L71-L73 HydrophobicContact CB-CD2 4.04Å; L73-L77 HydrophobicContact CB-CD1 4Å; L73-L77 HydrophobicContact CD1-CD1 4.12Å
74	P	96.6	Very high	90.3	Very high	28 Å²	28	81.2 Å²	81.2	18%	0.182	40%	0.398	C	S	.	.	P	Polyproline II helix	trans	-60.5	141.8	176.9	-20.5	29.7	0	0	0	113.3	H16 M76 L77	H16-P74 HydrophobicContact CB-CG 3.49Å; H16-P74 VanDerWaalsContact CB-CG 3.49Å; P74-M76 PolarHBondContact O-N 3.47Å; P74-L77 PolarHBondContact O-N 3.32Å
75	D	92.8	Very high	88.4	Confident	127 Å²	127	76.7 Å²	76.7	68%	0.679	39%	0.39	S	S	*	.	G	3₁₀ helix	trans	-59.5	-18.8	178.8	-71.6	-10.7	0	0	0	114.1	L77 K78	D75-L77 PolarHBondContact O-N 2.9Å; D75-K78 VanDerWaalsContact O-CB 3.31Å; D75-K78 WeakPolarHBondContact O-CB 3.02Å; D75-K78 WeakPolarHBondContact O-CD 3.34Å; D75-K78 WeakPolarHBondContact O-CG 3.35Å; D75-K78 PolarHBondContact O-N 3.11Å; D75-K78 VanDerWaalsContact O-N 3.13Å
76	M	90.2	Very high	86.4	Confident	134 Å²	134	81.7 Å²	81.7	66%	0.66	41%	0.413	S	S	*	.	G	3₁₀ helix	trans	-59.9	-29.4	176.2	-57.6	-168.5	-65.5	0	0	112	P74 K78	P74-M76 PolarHBondContact O-N 3.47Å; M76-K78 PolarHBondContact O-N 3.33Å
77	L	89.1	Confident	84.4	Confident	24 Å²	24	86.1 Å²	86.1	13%	0.126	42%	0.424	C	S	.	.	G	3₁₀ helix	trans	-75.9	-8.5	179.8	-59.6	-179.7	0	0	0	113.4	V9 E12 A13 L73 P74 D75 N79 A80	V9-L77 HydrophobicContact CG1-CB 4.5Å; V9-L77 HydrophobicContact CG1-CD1 4.33Å; E12-L77 HydrophobicContact CB-CD2 3.97Å; A13-L77 HydrophobicContact CB-CD1 3.63Å; L73-L77 HydrophobicContact CB-CD1 4Å; L73-L77 HydrophobicContact CD1-CD1 4.12Å; P74-L77 PolarHBondContact O-N 3.32Å; D75-L77 PolarHBondContact O-N 2.9Å; L77-N79 PolarHBondContact O-N 3.05Å; L77-N79 VanDerWaalsContact O-N 3.09Å; L77-A80 WeakPolarHBondContact O-CB 3.26Å; L77-A80 PolarHBondContact O-N 2.92Å
78	K	85.9	Confident	82.3	Confident	144 Å²	144	86.4 Å²	86.4	63%	0.626	43%	0.431	S	S	*	.	G	3₁₀ helix	trans	-58.7	-26.3	177.7	76.2	-166.9	169.3	-173.9	0	113.5	D75 M76	D75-K78 VanDerWaalsContact O-CB 3.31Å; D75-K78 WeakPolarHBondContact O-CB 3.02Å; D75-K78 WeakPolarHBondContact O-CD 3.34Å; D75-K78 WeakPolarHBondContact O-CG 3.35Å; D75-K78 PolarHBondContact O-N 3.11Å; D75-K78 VanDerWaalsContact O-N 3.13Å; M76-K78 PolarHBondContact O-N 3.33Å
79	N	81.3	Confident	80.2	Confident	110 Å²	110	94.4 Å²	94.4	59%	0.588	47%	0.466	S	S	*	.	G	3₁₀ helix	trans	-101.5	6	-179.4	-67.1	-37.7	0	0	0	113.1	L77 K84	L77-N79 PolarHBondContact O-N 3.05Å; L77-N79 VanDerWaalsContact O-N 3.09Å; N79-K84 WeakPolarHBondContact O-CE 3.17Å
80	A	80.8	Confident	78.1	Confident	7 Å²	7	95.7 Å²	95.7	6%	0.058	48%	0.482	C	S	.	.			trans	-52.9	138.5	-178.8	0	0	0	0	0	110.9	E12 L77 M82 L83	E12-A80 WeakPolarHBondContact OE2-CB 3.44Å; L77-A80 WeakPolarHBondContact O-CB 3.26Å; L77-A80 PolarHBondContact O-N 2.92Å; A80-M82 PolarHBondContact O-N 2.97Å; A80-M82 VanDerWaalsContact O-N 3.11Å; A80-L83 HydrophobicContact CB-CD1 4.02Å; A80-L83 PolarHBondContact O-N 2.59Å; A80-L83 VanDerWaalsContact O-N 3.12Å
81	P	75.8	Confident	75.9	Confident	85 Å²	85	99.9 Å²	99.9	55%	0.552	50%	0.503	S	S	*	.	H	α-helix	trans	-58.7	-29.2	-176.8	24.7	-33.5	0	0	0	112	L83 K84	P81-L83 VanDerWaalsContact C-N 3.33Å; P81-L83 PolarHBondContact O-N 2.95Å; P81-K84 WeakPolarHBondContact O-CB 3.49Å; P81-K84 PolarHBondContact O-N 3.1Å; P81-K84 VanDerWaalsContact O-N 3.16Å
82	M	78.2	Confident	73.6	Confident	63 Å²	63	100.8 Å²	100.8	31%	0.31	52%	0.522	S	S	.	.	H	α-helix	trans	-62.7	-35.8	180	-59.1	-59	173.4	0	0	112.8	V5 K8 V9 E12 A80 S85	V5-M82 HydrophobicContact CG1-CB 4.12Å; V5-M82 WeakPolarHBondContact CG1-O 3.23Å; K8-M82 HydrophobicContact CB-CG 4.26Å; K8-M82 HydrophobicContact CD-CE 4.3Å; K8-M82 HydrophobicContact CD-SD 3.8Å; V9-M82 HydrophobicContact CG2-CB 4.05Å; E12-M82 WeakPolarHBondContact OE1-CG 3.26Å; A80-M82 PolarHBondContact O-N 2.97Å; A80-M82 VanDerWaalsContact O-N 3.11Å; M82-S85 PolarHBondContact O-OG 3.09Å; M82-S85 VanDerWaalsContact O-OG 3.09Å
83	L	73	Confident	71.4	Confident	85 Å²	85	100.5 Å²	100.5	45%	0.445	53%	0.533	S	S	.	.	H	α-helix	trans	-73.7	-23.1	176.9	-84.4	109.7	0	0	0	113.4	V9 A80 P81 S85	V9-L83 HydrophobicContact CG1-CD1 4.32Å; V9-L83 HydrophobicContact CG2-CD1 3.73Å; A80-L83 HydrophobicContact CB-CD1 4.02Å; A80-L83 PolarHBondContact O-N 2.59Å; A80-L83 VanDerWaalsContact O-N 3.12Å; P81-L83 VanDerWaalsContact C-N 3.33Å; P81-L83 PolarHBondContact O-N 2.95Å; L83-S85 VanDerWaalsContact C-N 3.33Å; L83-S85 PolarHBondContact O-N 3.1Å
84	K	68.9	Low	69	Low	134 Å²	134	102.7 Å²	102.7	58%	0.583	57%	0.566	S	S	*	*	H	α-helix	trans	-70.1	-30	-179.3	-62.1	179.1	-175.4	172.5	0	112.5	N79 P81 M86 K87	N79-K84 WeakPolarHBondContact O-CE 3.17Å; P81-K84 WeakPolarHBondContact O-CB 3.49Å; P81-K84 PolarHBondContact O-N 3.1Å; P81-K84 VanDerWaalsContact O-N 3.16Å; K84-M86 VanDerWaalsContact C-N 3.25Å; K84-M86 PolarHBondContact O-N 3.43Å; K84-K87 PolarHBondContact O-N 3.24Å
85	S	58.6	Low	66.9	Low	65 Å²	65	105.5 Å²	105.5	46%	0.455	59%	0.592	S	S	.	*	H	α-helix	trans	-66.7	-22.1	-176.7	75.1	0	0	0	0	114.4	M82 L83	M82-S85 PolarHBondContact O-OG 3.09Å; M82-S85 VanDerWaalsContact O-OG 3.09Å; L83-S85 VanDerWaalsContact C-N 3.33Å; L83-S85 PolarHBondContact O-N 3.1Å
86	M	56.9	Low	65	Low	112 Å²	112	102 Å²	102	55%	0.552	59%	0.586	S	S	*	*	H	α-helix	trans	-74.4	-30.9	178.9	-69.5	-163.7	-175.8	0	0	113.1	V5 K84 N88	V5-M86 HydrophobicContact CB-CE 3.65Å; V5-M86 HydrophobicContact CG1-CE 3.74Å; V5-M86 HydrophobicContact CG2-CE 4.17Å; K84-M86 VanDerWaalsContact C-N 3.25Å; K84-M86 PolarHBondContact O-N 3.43Å; M86-N88 VanDerWaalsContact C-N 3.33Å; M86-N88 PolarHBondContact O-N 2.9Å
87	K	55.6	Low	63.3	Low	163 Å²	163	106.8 Å²	106.8	71%	0.709	60%	0.597	S	S	*	*	H	α-helix	trans	-67.6	-32.7	-179.3	-84.3	-175.1	175.4	180	0	112.8	K84	K84-K87 PolarHBondContact O-N 3.24Å
88	N	54.1	Low	61.6	Low	129 Å²	129	107.6 Å²	107.6	69%	0.69	61%	0.611	S	S	*	*	H	α-helix	trans	-87.9	-13.4	-172.4	-72.3	1.6	0	0	0	114.4	M86	M86-N88 VanDerWaalsContact C-N 3.33Å; M86-N88 PolarHBondContact O-N 2.9Å
89	K	55.6	Low	60.2	Low	181 Å²	181	108.6 Å²	108.6	79%	0.787	62%	0.616	S	S	*	*	H	α-helix	trans	-79.6	-21.8	176.4	-84.9	-174.3	176	179.7	0	113.9
90	N	54.8	Low	59	Low	156 Å²	156	106.6 Å²	106.6	83%	0.834	61%	0.614	S	S	*	*	S	Bend	trans	-94.7	-3.5	177.2	-80.1	6	0	0	0	114.2
91	Q	51.8	Low	57.9	Low	175 Å²	175	109.1 Å²	109.1	82%	0.818	64%	0.635	S	S	*	*	S	Bend	trans	-118.7	19	-179.5	-63.6	-171.8	17.8	0	0	113.2
92	G	48.9	Very low	57.2	Low	57 Å²	57	110.1 Å²	110.1	59%	0.588	64%	0.635	S	S	*	*	S	Bend	trans	-114.9	102.5	179.4	0	0	0	0	0	113.2
93	A	52.5	Low	56.3	Low	88 Å²	88	112.5 Å²	112.5	73%	0.727	65%	0.648	S	S	*	*			trans	87.4	33.3	143.7	0	0	0	0	0	121	A95	A93-A95 PolarHBondContact O-N 3.34Å
94	G	47.1	Very low	55.6	Low	90 Å²	90	116.5 Å²	116.5	93%	0.928	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.9	-2.6	143.8	0	0	0	0	0	113.7
95	A	53.5	Low	55.2	Low	86 Å²	86	112.9 Å²	112.9	71%	0.711	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.1	19.7	-172.9	0	0	0	0	0	114.8	A93	A93-A95 PolarHBondContact O-N 3.34Å
96	G	51.8	Low	55.2	Low	55 Å²	55	116.1 Å²	116.1	57%	0.567	67%	0.665	S	S	*	*	S	Bend	trans	-99.8	-23.1	-177.8	0	0	0	0	0	116
97	R	54.1	Low	55.2	Low	233 Å²	233	115.8 Å²	115.8	88%	0.879	67%	0.669	S	S	*	*	S	Bend	trans	-98.7	-22	-170.4	-75.3	-177.3	171	133.9	-2.6	115.1
98	G	53.7	Low	55.4	Low	42 Å²	42	111.5 Å²	111.5	43%	0.433	66%	0.664	S	S	.	*	H	α-helix	trans	-80.4	-42.3	-176.3	0	0	0	0	0	114.3	A100 A101 I102	G98-A100 PolarHBondContact O-N 3.01Å; G98-A101 PolarHBondContact O-N 3.43Å; G98-I102 VanDerWaalsContact O-CG1 3.27Å; G98-I102 WeakPolarHBondContact O-CG1 3.27Å; G98-I102 PolarHBondContact O-N 2.97Å
99	K	56.2	Low	55.3	Low	165 Å²	165	109.1 Å²	109.1	72%	0.717	66%	0.662	S	S	*	*	H	α-helix	trans	-68.6	-38.8	-174.3	-77.6	-175.8	175	179.9	0	112.9	A101 I102 L103	K99-A101 VanDerWaalsContact C-N 3.35Å; K99-I102 PolarHBondContact O-N 3.29Å; K99-L103 WeakPolarHBondContact O-CB 3.27Å; K99-L103 PolarHBondContact O-N 3.49Å
100	A	56.1	Low	55.2	Low	67 Å²	67	111.8 Å²	111.8	55%	0.554	67%	0.667	S	S	*	*	H	α-helix	trans	-66.3	-36.6	175.4	0	0	0	0	0	112.1	G98 K104	G98-A100 PolarHBondContact O-N 3.01Å; A100-K104 VanDerWaalsContact O-CB 3.29Å; A100-K104 WeakPolarHBondContact O-CB 3.48Å; A100-K104 PolarHBondContact O-N 3.05Å
101	A	59.7	Low	54.9	Low	60 Å²	60	107.4 Å²	107.4	50%	0.496	66%	0.66	S	S	.	*	H	α-helix	trans	-69.3	-39.8	176	0	0	0	0	0	112.4	G98 K99 K104 A105	G98-A101 PolarHBondContact O-N 3.43Å; K99-A101 VanDerWaalsContact C-N 3.35Å; A101-K104 PolarHBondContact O-N 3.3Å; A101-A105 VanDerWaalsContact O-CB 3.27Å; A101-A105 WeakPolarHBondContact O-CB 3.33Å; A101-A105 PolarHBondContact O-N 2.9Å
102	I	60.6	Low	54.9	Low	107 Å²	107	110.4 Å²	110.4	55%	0.549	66%	0.663	S	S	.	*	H	α-helix	trans	-67.3	-43	177.2	-66	165.7	0	0	0	111.2	G98 K99 A105 Q106	G98-I102 VanDerWaalsContact O-CG1 3.27Å; G98-I102 WeakPolarHBondContact O-CG1 3.27Å; G98-I102 PolarHBondContact O-N 2.97Å; K99-I102 PolarHBondContact O-N 3.29Å; I102-A105 PolarHBondContact O-N 3.38Å; I102-Q106 PolarHBondContact O-N 3.34Å
103	L	58.9	Low	54.7	Low	113 Å²	113	111.2 Å²	111.2	59%	0.592	67%	0.672	S	S	*	*	H	α-helix	trans	-64.3	-40.9	174.8	-97.9	137.8	0	0	0	111.9	K99 A105 Q106 V107	K99-L103 WeakPolarHBondContact O-CB 3.27Å; K99-L103 PolarHBondContact O-N 3.49Å; L103-A105 VanDerWaalsContact C-N 3.35Å; L103-Q106 PolarHBondContact O-N 2.87Å; L103-V107 WeakPolarHBondContact O-CG2 3.29Å; L103-V107 PolarHBondContact O-N 3Å
104	K	58.2	Low	54.2	Low	168 Å²	168	118.5 Å²	118.5	73%	0.73	68%	0.68	S	S	*	*	H	α-helix	trans	-67.8	-35.2	176.7	-151	173.6	-171	179.4	0	111.9	A100 A101 A108	A100-K104 VanDerWaalsContact O-CB 3.29Å; A100-K104 WeakPolarHBondContact O-CB 3.48Å; A100-K104 PolarHBondContact O-N 3.05Å; A101-K104 PolarHBondContact O-N 3.3Å; K104-A108 WeakPolarHBondContact O-CB 3.28Å; K104-A108 PolarHBondContact O-N 3.39Å
105	A	59.9	Low	53.7	Low	59 Å²	59	118.9 Å²	118.9	49%	0.488	68%	0.684	S	S	.	*	H	α-helix	trans	-68.9	-39.4	173.9	0	0	0	0	0	112.6	A101 I102 L103 A108 A109	A101-A105 VanDerWaalsContact O-CB 3.27Å; A101-A105 WeakPolarHBondContact O-CB 3.33Å; A101-A105 PolarHBondContact O-N 2.9Å; I102-A105 PolarHBondContact O-N 3.38Å; L103-A105 VanDerWaalsContact C-N 3.35Å; A105-A108 PolarHBondContact O-N 3.43Å; A105-A109 VanDerWaalsContact O-CB 3.28Å; A105-A109 WeakPolarHBondContact O-CB 3.33Å; A105-A109 PolarHBondContact O-N 2.92Å
106	Q	58.2	Low	53.1	Low	132 Å²	132	117.6 Å²	117.6	62%	0.617	68%	0.68	S	S	*	*	H	α-helix	trans	-66.8	-36.2	174.8	-96.9	-178.3	-25.1	0	0	112.9	I102 L103 R110	I102-Q106 PolarHBondContact O-N 3.34Å; L103-Q106 PolarHBondContact O-N 2.87Å; Q106-R110 PolarHBondContact O-N 3.42Å
107	V	58.8	Low	52.3	Low	106 Å²	106	123.8 Å²	123.8	64%	0.642	70%	0.696	S	S	*	*	H	α-helix	trans	-72	-39.7	175.6	175.4	0	0	0	0	111.1	L103 R110	L103-V107 WeakPolarHBondContact O-CG2 3.29Å; L103-V107 PolarHBondContact O-N 3Å; V107-R110 PolarHBondContact O-N 3.44Å
108	A	58.1	Low	51.6	Low	73 Å²	73	116.5 Å²	116.5	60%	0.603	69%	0.693	S	S	*	*	H	α-helix	trans	-67.1	-35.3	175.6	0	0	0	0	0	113.1	K104 A105 R110 G111	K104-A108 WeakPolarHBondContact O-CB 3.28Å; K104-A108 PolarHBondContact O-N 3.39Å; A105-A108 PolarHBondContact O-N 3.43Å; A108-R110 VanDerWaalsContact C-N 3.35Å; A108-G111 PolarHBondContact O-N 2.98Å
109	A	53.6	Low	50.9	Low	79 Å²	79	126.5 Å²	126.5	65%	0.653	72%	0.718	S	S	*	*	H	α-helix	trans	-74.3	-21.9	178.6	0	0	0	0	0	113.6	A105 G111	A105-A109 VanDerWaalsContact O-CB 3.28Å; A105-A109 WeakPolarHBondContact O-CB 3.33Å; A105-A109 PolarHBondContact O-N 2.92Å; A109-G111 VanDerWaalsContact C-N 3.33Å
110	R	51.7	Low	49.9	Very low	236 Å²	236	122.5 Å²	122.5	89%	0.891	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.4	-8	174.1	-103.5	179.5	166.4	160.5	-3.1	114.1	Q106 V107 A108	Q106-R110 PolarHBondContact O-N 3.42Å; V107-R110 PolarHBondContact O-N 3.44Å; A108-R110 VanDerWaalsContact C-N 3.35Å
111	G	49.4	Very low	49.3	Very low	65 Å²	65	126.4 Å²	126.4	67%	0.67	74%	0.735	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.6	-1.6	-177.2	0	0	0	0	0	115.9	A108 A109	A108-G111 PolarHBondContact O-N 2.98Å; A109-G111 VanDerWaalsContact C-N 3.33Å
112	R	52.8	Low	48.5	Very low	237 Å²	237	131.3 Å²	131.3	89%	0.894	75%	0.751	S	S	*	*	S	Bend	trans	-130.6	93.3	178.8	-83.6	-176.1	173.2	166.9	-2	111.3
113	G	44.1	Very low	47.5	Very low	74 Å²	74	135 Å²	135	76%	0.763	76%	0.764	S	S	*	*	S	Bend	trans	155.7	119.6	159.1	0	0	0	0	0	113.5
114	R	41.8	Very low	47.4	Very low	242 Å²	242	134.7 Å²	134.7	91%	0.913	77%	0.768	S	S	*	*			trans	95.3	58	153.8	-136.7	164	-175.9	169.1	-1	116.3	G116	R114-G116 PolarHBondContact O-N 3.02Å
115	G	37.1	Very low	46.6	Very low	97 Å²	97	134.2 Å²	134.2	100%	1	77%	0.766	S	S	*	*			trans	-65.3	88	144.3	0	0	0	0	0	109.1
116	G	40.9	Very low	45.7	Very low	60 Å²	60	141.7 Å²	141.7	62%	0.619	78%	0.782	S	S	*	*			trans	-118.1	150	169.1	0	0	0	0	0	109.8	R114	R114-G116 PolarHBondContact O-N 3.02Å
117	M	34	Very low	45	Very low	184 Å²	184	150.7 Å²	150.7	91%	0.906	81%	0.81	S	S	*	*			trans	92.9	86.1	166.5	-135.4	69.7	111.6	0	0	116.5
118	G	39.8	Very low	44.3	Very low	80 Å²	80	152.9 Å²	152.9	83%	0.825	82%	0.818	S	S	*	*			trans	-56.4	132	157.7	0	0	0	0	0	110.8
119	R	38	Very low	43.6	Very low	253 Å²	253	157.1 Å²	157.1	96%	0.955	83%	0.83	S	S	*	*			trans	-96.2	127.2	168.6	-84.1	178.1	164.2	175.1	-4.7	108.3
120	G	36.2	Very low	43	Very low	81 Å²	81	161.4 Å²	161.4	84%	0.835	84%	0.84	S	S	*	*			trans	-162.4	72	172.1	0	0	0	0	0	110
121	N	44.4	Very low	42.5	Very low	148 Å²	148	157.1 Å²	157.1	79%	0.791	84%	0.836	S	S	*	*			trans	-77.5	128.5	170.2	-164.4	54.7	0	0	0	108
122	I	42.1	Very low	42.1	Very low	163 Å²	163	162.8 Å²	162.8	84%	0.836	85%	0.847	S	S	*	*			trans	-168.2	104.5	148.4	-77.5	124.6	0	0	0	107.9
123	F	38.4	Very low	41.3	Very low	186 Å²	186	157.9 Å²	157.9	82%	0.816	84%	0.844	S	S	*	*			trans	-92.1	166.1	140.9	-76.1	-87.1	0	0	0	106.7
124	P	57.1	Low	41.1	Very low	106 Å²	106	163.9 Å²	163.9	69%	0.688	85%	0.85	S	S	*	*			cis	-145.4	-179.7	16.3	40	-19.2	0	0	0	117.4
125	K	42.5	Very low	41.1	Very low	157 Å²	157	157.8 Å²	157.8	68%	0.683	85%	0.845	S	S	*	*			trans	92.3	124.5	137.5	-95.7	-178.7	170.6	173.6	0	122.1
126	R	40.8	Very low	41.4	Very low	217 Å²	217	162.9 Å²	162.9	82%	0.819	83%	0.832	S	S	*	*			trans	69.7	131.2	136	-73.2	169.9	165.5	-171.6	-10	116
127	R	42.9	Very low	41.5	Very low	320 Å²	320	172.3 Å²	172.3	100%	1.208	85%	0.851	S	S	*	*				-159.6	0	51.7	-162.1	179.7	-170.4	-173.9	2.1	109.7

Retrieved 127 of 127 residues in 37.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).