A0A060WLI7_ONCMY Loading...

Succinate dehydrogenase cytochrome b560 subunit, mitochondrial

Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). SDH also oxidizes malate to the non-canonical enol form of oxaloacetate, enol-oxaloacetate. Enol-oxaloacetate, which is a potent inhibitor of the succinate dehydrogenase activity, is further isomerized into keto-oxaloacetate.

AlphaFold DB , UniProt , Accession A0A060WLI7, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110508324, Length 170 aa.

						>A0A060WLI7_ONCMY|A0A060WLI7|LOC110508324
MALLLRTFTRQGTCLFRPQFGILCRHAVPMGTTANEEMNRFWAKNNKLNRPMSPHLTIYKWSMPMMMSITHRGTGVGLSGGISAFALLALVLPGNYPYYLDLIHSLSVGPALLSLAKFGIAFPVSYHTLNGIRHLFWDSGKGFKIPEVYRSGYVVIVLSILTSIAAIAYM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.3	Very low	45.2	Very low	238 Å²	238	181.2 Å²	181.2	100%	1.172	90%	0.896	S	S	*	*				0	58.1	0	-132	147.8	74.7	0	0	107.4
2	A	47.8	Very low	45.2	Very low	88 Å²	88	171.8 Å²	171.8	73%	0.727	88%	0.88	S	S	*	*				54.1	111	90.1	0	0	0	0	0	111.2
3	L	43.9	Very low	45.1	Very low	178 Å²	178	169.1 Å²	169.1	93%	0.932	88%	0.877	S	S	*	*			trans	96.4	33	176.6	-65.3	122.8	0	0	0	118.8
4	L	50.8	Low	44.7	Very low	166 Å²	166	164.9 Å²	164.9	87%	0.869	87%	0.868	S	S	*	*	S	Bend	trans	-124.8	99	150.5	-95.6	166.4	0	0	0	107.4
5	L	47.1	Very low	44.6	Very low	168 Å²	168	164.5 Å²	164.5	88%	0.88	87%	0.865	S	S	*	*	S	Bend	trans	159.1	43.1	158	-89.2	162.4	0	0	0	114.2
6	R	45.4	Very low	44.3	Very low	249 Å²	249	167.3 Å²	167.3	94%	0.94	87%	0.868	S	S	*	*			trans	-145.6	46.9	163.6	-70.4	-164.3	178.3	176.1	-0.3	113.2
7	T	46	Very low	44.4	Very low	117 Å²	117	169.9 Å²	169.9	72%	0.718	86%	0.864	S	S	*	*	S	Bend	trans	-104.6	139.3	152.2	46.6	0	0	0	0	107.8
8	F	44	Very low	44.2	Very low	190 Å²	190	165.3 Å²	165.3	83%	0.833	85%	0.848	S	S	*	*			trans	78.1	90.1	174.8	-55.7	-79.2	0	0	0	117.5
9	T	46.6	Very low	44.4	Very low	144 Å²	144	165.8 Å²	165.8	88%	0.883	85%	0.847	S	S	*	*			trans	176.4	84	133.4	34.6	0	0	0	0	110.5
10	R	40.7	Very low	44.4	Very low	246 Å²	246	167 Å²	167	93%	0.928	85%	0.845	S	S	*	*			trans	-176.1	84.7	137.2	-109.9	178.5	154.4	-164	-6.2	110.1	G12	R10-G12 PolarHBondContact O-N 3.32Å
11	Q	44.1	Very low	44.6	Very low	209 Å²	209	161.9 Å²	161.9	98%	0.977	84%	0.835	S	S	*	*			trans	-57	120	141.5	-100.4	169.1	-28	0	0	107.4
12	G	44.4	Very low	45.2	Very low	68 Å²	68	157 Å²	157	70%	0.701	81%	0.812	S	S	*	*			trans	-146.1	91	170.3	0	0	0	0	0	107.3	R10 C14	R10-G12 PolarHBondContact O-N 3.32Å; G12-C14 PolarHBondContact O-N 2.98Å
13	T	44.9	Very low	45.4	Very low	137 Å²	137	159.4 Å²	159.4	84%	0.84	81%	0.812	S	S	*	*			trans	-55	127.7	162.3	36.8	0	0	0	0	109.4
14	C	39	Very low	45.7	Very low	111 Å²	111	155 Å²	155	75%	0.75	80%	0.795	S	S	*	*				167.9	130	127.3	-99.8	0	0	0	0	112.8	G12	G12-C14 PolarHBondContact O-N 2.98Å
15	L	43.5	Very low	45.8	Very low	158 Å²	158	156.9 Å²	156.9	83%	0.827	79%	0.791	S	S	*	*			trans	77.5	82.8	152.8	-55.8	171.7	0	0	0	117.5	R17	L15-R17 VanDerWaalsContact C-N 3.32Å; L15-R17 PolarHBondContact O-N 3.42Å
16	F	40	Very low	46	Very low	209 Å²	209	156.8 Å²	156.8	92%	0.917	79%	0.786	S	S	*	*			trans	-58.6	95.8	147.5	-141.2	-95.5	0	0	0	107.9	P18	F16-P18 VanDerWaalsContact O-CD 3.3Å; F16-P18 WeakPolarHBondContact O-CD 3.27Å
17	R	45.2	Very low	46.5	Very low	212 Å²	212	149 Å²	149	80%	0.8	77%	0.774	S	S	*	*			trans	-83.9	110.1	168.2	-168.8	177.5	-170.2	-175.1	3.3	106.3	L15 Q19	L15-R17 VanDerWaalsContact C-N 3.32Å; L15-R17 PolarHBondContact O-N 3.42Å; R17-Q19 VanDerWaalsContact C-N 3.34Å; R17-Q19 PolarHBondContact O-N 3.22Å
18	P	41.3	Very low	47.1	Very low	88 Å²	88	149.1 Å²	149.1	57%	0.571	77%	0.774	S	S	*	*			trans	-69.1	104.8	167.2	29.9	-28.7	0	0	0	105.1	F16 F20	F16-P18 VanDerWaalsContact O-CD 3.3Å; F16-P18 WeakPolarHBondContact O-CD 3.27Å; P18-F20 HydrophobicContact CB-CD2 4.06Å; P18-F20 HydrophobicContact CB-CE2 4.49Å; P18-F20 PolarHBondContact O-N 3.32Å
19	Q	46.9	Very low	47.8	Very low	175 Å²	175	145.2 Å²	145.2	82%	0.818	77%	0.768	S	S	*	*			trans	-66.6	81.4	156.5	-91.7	176.9	-41.8	0	0	106.1	R17 G21	R17-Q19 VanDerWaalsContact C-N 3.34Å; R17-Q19 PolarHBondContact O-N 3.22Å; Q19-G21 PolarHBondContact O-N 3.13Å
20	F	44.8	Very low	48.6	Very low	188 Å²	188	146.7 Å²	146.7	83%	0.825	77%	0.767	S	S	*	*			trans	-65.3	72.6	146.1	-90.8	-84.5	0	0	0	106.1	P18 I22	P18-F20 HydrophobicContact CB-CD2 4.06Å; P18-F20 HydrophobicContact CB-CE2 4.49Å; P18-F20 PolarHBondContact O-N 3.32Å; F20-I22 PolarHBondContact O-N 3.18Å
21	G	49.4	Very low	49.8	Very low	60 Å²	60	138.1 Å²	138.1	62%	0.619	76%	0.756	S	S	*	*			trans	-62.5	98.1	155.4	0	0	0	0	0	104.3	Q19 L23	Q19-G21 PolarHBondContact O-N 3.13Å; G21-L23 PolarHBondContact O-N 3.33Å
22	I	53.3	Low	51.2	Low	137 Å²	137	130.4 Å²	130.4	70%	0.703	72%	0.723	S	S	*	*			trans	-54.9	98.4	163.2	-65.6	171.8	0	0	0	103.9	F20 C24	F20-I22 PolarHBondContact O-N 3.18Å; I22-C24 HydrophobicContact CG2-CB 4.29Å; I22-C24 WeakPolarHBondContact CG2-SG 3.25Å; I22-C24 PolarHBondContact O-N 3.08Å
23	L	51.3	Low	53.4	Low	138 Å²	138	130.3 Å²	130.3	72%	0.723	71%	0.709	S	S	*	*			trans	-69.4	74.9	165.8	-155.9	99.9	0	0	0	104	G21 R25	G21-L23 PolarHBondContact O-N 3.33Å; L23-R25 HydrophobicContact CD2-CG 3.65Å; L23-R25 HydrophobicContact CG-CG 4.33Å; L23-R25 PolarHBondContact O-N 3.32Å
24	C	50.2	Low	55.6	Low	86 Å²	86	127.2 Å²	127.2	58%	0.581	70%	0.697	S	S	*	*			trans	-63.9	79.6	157.9	-89.7	0	0	0	0	104.5	I22 H26	I22-C24 HydrophobicContact CG2-CB 4.29Å; I22-C24 WeakPolarHBondContact CG2-SG 3.25Å; I22-C24 PolarHBondContact O-N 3.08Å; C24-H26 PolarHBondContact O-N 3.41Å; C24-H26 PolarHBondContact O-ND1 3.48Å; C24-H26 VanDerWaalsContact O-ND1 3.11Å
25	R	54.4	Low	58.3	Low	204 Å²	204	127.2 Å²	127.2	77%	0.77	69%	0.689	S	S	*	*			trans	-50.3	103.1	146.9	-68	-170.4	176.4	-148.5	-0.3	102.7	L23 A27	L23-R25 HydrophobicContact CD2-CG 3.65Å; L23-R25 HydrophobicContact CG-CG 4.33Å; L23-R25 PolarHBondContact O-N 3.32Å; R25-A27 PolarHBondContact O-N 2.99Å
26	H	50.2	Low	60.8	Low	167 Å²	167	124.3 Å²	124.3	77%	0.773	67%	0.672	S	S	*	*			trans	-64.2	76.2	159.2	-72.3	68.7	0	0	0	104.2	C24 V28	C24-H26 PolarHBondContact O-N 3.41Å; C24-H26 PolarHBondContact O-ND1 3.48Å; C24-H26 VanDerWaalsContact O-ND1 3.11Å; H26-V28 PolarHBondContact O-N 2.96Å
27	A	56.1	Low	63.4	Low	85 Å²	85	119.7 Å²	119.7	70%	0.702	65%	0.653	S	S	*	*			trans	-65	88.6	160	0	0	0	0	0	102.7	R25 P29	R25-A27 PolarHBondContact O-N 2.99Å; A27-P29 WeakPolarHBondContact O-CD 3.46Å
28	V	59.8	Low	65.9	Low	119 Å²	119	114.5 Å²	114.5	72%	0.721	64%	0.639	S	S	*	*			trans	-51.9	113.3	166.3	178.8	0	0	0	0	103.5	H26 M30	H26-V28 PolarHBondContact O-N 2.96Å; V28-M30 PolarHBondContact O-N 3.24Å
29	P	57.4	Low	68.5	Low	108 Å²	108	115.4 Å²	115.4	70%	0.701	64%	0.639	S	S	*	*			trans	-57.1	122.2	176.5	23	-29.6	0	0	0	105.2	A27 G31	A27-P29 WeakPolarHBondContact O-CD 3.46Å; P29-G31 PolarHBondContact O-N 2.95Å
30	M	64	Low	70.9	Confident	176 Å²	176	116 Å²	116	87%	0.867	63%	0.633	S	S	*	*			trans	-62.8	85.4	166.8	-82.4	-115.1	-65.1	0	0	105.6	V28 T32	V28-M30 PolarHBondContact O-N 3.24Å; M30-T32 PolarHBondContact O-N 2.84Å
31	G	65.9	Low	73.4	Confident	66 Å²	66	112.5 Å²	112.5	68%	0.68	62%	0.618	S	S	*	*			trans	-71.2	-12.1	-161.9	0	0	0	0	0	113.8	P29	P29-G31 PolarHBondContact O-N 2.95Å
32	T	73.3	Confident	75.7	Confident	47 Å²	47	116.5 Å²	116.5	29%	0.288	62%	0.615	S	S	.	*	S	Bend	trans	-161.1	153.2	172.9	33.2	0	0	0	0	108.4	M30 E36 E37	M30-T32 PolarHBondContact O-N 2.84Å; T32-E36 WeakPolarHBondContact CA-OE2 3.46Å; T32-E36 WeakPolarHBondContact CB-OE2 3.23Å; T32-E36 HydrophobicContact CG2-CB 4.15Å; T32-E36 WeakPolarHBondContact CG2-OE2 3.23Å; T32-E37 WeakPolarHBondContact OG1-CG 3.41Å; T32-E37 PolarHBondContact OG1-OE1 2.87Å
33	T	89.8	Confident	77.8	Confident	66 Å²	66	112.9 Å²	112.9	41%	0.405	61%	0.605	S	S	.	*			trans	-72.2	155.7	169.1	66.3	0	0	0	0	110.4	N35 E36 E37	T33-N35 PolarHBondContact O-N 3.05Å; T33-N35 VanDerWaalsContact O-N 3.14Å; T33-E36 PolarHBondContact N-OE2 2.9Å; T33-E36 WeakPolarHBondContact O-CB 3.23Å; T33-E36 PolarHBondContact O-N 3.44Å; T33-E36 VanDerWaalsContact OG1-CD 3.26Å; T33-E36 VanDerWaalsContact OG1-CG 3.32Å; T33-E36 WeakPolarHBondContact OG1-CG 3.21Å; T33-E36 PolarHBondContact OG1-N 3.48Å; T33-E36 PolarHBondContact OG1-OE1 3.19Å; T33-E37 PolarHBondContact O-N 3.44Å; T33-E37 VanDerWaalsContact O-N 3.08Å
34	A	92.9	Very high	80	Confident	71 Å²	71	111.8 Å²	111.8	59%	0.587	60%	0.595	S	S	*	*	H	α-helix	trans	-55.2	-34.2	176.2	0	0	0	0	0	112.5	E37 M38	A34-E37 PolarHBondContact O-N 2.94Å; A34-M38 WeakPolarHBondContact O-CB 3.46Å; A34-M38 WeakPolarHBondContact O-CG 3.28Å; A34-M38 PolarHBondContact O-N 3.35Å
35	N	94	Very high	82.3	Confident	111 Å²	111	109 Å²	109	59%	0.594	57%	0.574	S	S	*	*	H	α-helix	trans	-64.5	-42.6	174.7	-78.3	-42.1	0	0	0	112.3	T33 M38 N39	T33-N35 PolarHBondContact O-N 3.05Å; T33-N35 VanDerWaalsContact O-N 3.14Å; N35-M38 PolarHBondContact O-N 3.4Å; N35-N39 WeakPolarHBondContact O-CB 3.41Å; N35-N39 PolarHBondContact O-N 3Å; N35-N39 PolarHBondContact O-ND2 3.17Å
36	E	95.9	Very high	84.3	Confident	98 Å²	98	104.6 Å²	104.6	46%	0.458	57%	0.566	S	S	.	*	H	α-helix	trans	-64.4	-41.6	177.4	-74.4	159.3	-159	0	0	111.7	T32 T33 N39 R40	T32-E36 WeakPolarHBondContact CA-OE2 3.46Å; T32-E36 WeakPolarHBondContact CB-OE2 3.23Å; T32-E36 HydrophobicContact CG2-CB 4.15Å; T32-E36 WeakPolarHBondContact CG2-OE2 3.23Å; T33-E36 PolarHBondContact N-OE2 2.9Å; T33-E36 WeakPolarHBondContact O-CB 3.23Å; T33-E36 PolarHBondContact O-N 3.44Å; T33-E36 VanDerWaalsContact OG1-CD 3.26Å; T33-E36 VanDerWaalsContact OG1-CG 3.32Å; T33-E36 WeakPolarHBondContact OG1-CG 3.21Å; T33-E36 PolarHBondContact OG1-N 3.48Å; T33-E36 PolarHBondContact OG1-OE1 3.19Å; E36-N39 PolarHBondContact O-N 3.08Å; E36-R40 WeakPolarHBondContact O-CB 3.44Å; E36-R40 PolarHBondContact O-N 2.7Å
37	E	96	Very high	86.6	Confident	112 Å²	112	105.2 Å²	105.2	52%	0.523	57%	0.566	S	S	.	*	H	α-helix	trans	-62.8	-45.2	176	-67.1	-176.4	-178.8	0	0	111.9	T32 T33 A34 R40 F41	T32-E37 WeakPolarHBondContact OG1-CG 3.41Å; T32-E37 PolarHBondContact OG1-OE1 2.87Å; T33-E37 PolarHBondContact O-N 3.44Å; T33-E37 VanDerWaalsContact O-N 3.08Å; A34-E37 PolarHBondContact O-N 2.94Å; E37-R40 PolarHBondContact O-N 3.49Å; E37-F41 WeakPolarHBondContact O-CB 3.13Å; E37-F41 PolarHBondContact O-N 3.39Å
38	M	96.1	Very high	88.6	Confident	103 Å²	103	105.4 Å²	105.4	51%	0.507	56%	0.555	S	S	.	*	H	α-helix	trans	-60.6	-46	175.3	-82	174.4	44.7	0	0	112	A34 N35 R40 F41 W42	A34-M38 WeakPolarHBondContact O-CB 3.46Å; A34-M38 WeakPolarHBondContact O-CG 3.28Å; A34-M38 PolarHBondContact O-N 3.35Å; N35-M38 PolarHBondContact O-N 3.4Å; M38-R40 VanDerWaalsContact C-N 3.33Å; M38-R40 PolarHBondContact O-N 3.44Å; M38-F41 WeakPolarHBondContact O-CB 3.37Å; M38-F41 PolarHBondContact O-N 3.25Å; M38-W42 PolarHBondContact O-N 2.93Å
39	N	96.9	Very high	90.3	Very high	106 Å²	106	106.6 Å²	106.6	57%	0.567	56%	0.557	S	S	*	*	H	α-helix	trans	-61.7	-42.9	178.5	-72.9	-22.7	0	0	0	111.3	N35 E36 F41 W42 A43	N35-N39 WeakPolarHBondContact O-CB 3.41Å; N35-N39 PolarHBondContact O-N 3Å; N35-N39 PolarHBondContact O-ND2 3.17Å; E36-N39 PolarHBondContact O-N 3.08Å; N39-F41 VanDerWaalsContact C-N 3.35Å; N39-F41 PolarHBondContact O-N 3.47Å; N39-W42 PolarHBondContact O-N 2.94Å; N39-A43 VanDerWaalsContact O-CB 3.28Å; N39-A43 WeakPolarHBondContact O-CB 3.2Å; N39-A43 PolarHBondContact O-N 3.42Å
40	R	97.3	Very high	92.2	Very high	188 Å²	188	107.7 Å²	107.7	71%	0.709	55%	0.547	S	S	*	.	H	α-helix	trans	-62	-41.3	174.8	-177	-178	-112.2	179.1	-1.7	111.8	E36 E37 M38 K44	E36-R40 WeakPolarHBondContact O-CB 3.44Å; E36-R40 PolarHBondContact O-N 2.7Å; E37-R40 PolarHBondContact O-N 3.49Å; M38-R40 VanDerWaalsContact C-N 3.33Å; M38-R40 PolarHBondContact O-N 3.44Å; R40-K44 VanDerWaalsContact O-CB 3.23Å; R40-K44 WeakPolarHBondContact O-CB 3.43Å; R40-K44 PolarHBondContact O-N 3.01Å
41	F	96.9	Very high	93.7	Very high	114 Å²	114	105.2 Å²	105.2	50%	0.5	55%	0.545	S	S	.	.	H	α-helix	trans	-60.6	-50.1	176.9	171.5	-91.4	0	0	0	111.9	E37 M38 N39 K44 N45	E37-F41 WeakPolarHBondContact O-CB 3.13Å; E37-F41 PolarHBondContact O-N 3.39Å; M38-F41 WeakPolarHBondContact O-CB 3.37Å; M38-F41 PolarHBondContact O-N 3.25Å; N39-F41 VanDerWaalsContact C-N 3.35Å; N39-F41 PolarHBondContact O-N 3.47Å; F41-K44 PolarHBondContact O-N 3.33Å; F41-N45 WeakPolarHBondContact CD2-ND2 3.48Å; F41-N45 WeakPolarHBondContact CE1-ND2 3.47Å; F41-N45 WeakPolarHBondContact CE2-ND2 3.28Å; F41-N45 WeakPolarHBondContact CZ-ND2 3.46Å; F41-N45 PolarHBondContact O-N 3.14Å; F41-N45 PolarHBondContact O-ND2 3.01Å
42	W	97.1	Very high	95.2	Very high	144 Å²	144	109.2 Å²	109.2	55%	0.545	55%	0.547	S	S	.	.	H	α-helix	trans	-65	-47.1	179.8	-72.2	116.3	0	0	0	112	M38 N39 K44 N45 N46	M38-W42 PolarHBondContact O-N 2.93Å; N39-W42 PolarHBondContact O-N 2.94Å; W42-K44 VanDerWaalsContact C-N 3.28Å; W42-K44 PolarHBondContact O-N 2.97Å; W42-N45 PolarHBondContact O-N 2.96Å; W42-N46 WeakPolarHBondContact O-CB 3.37Å; W42-N46 VanDerWaalsContact O-CG 3.28Å; W42-N46 PolarHBondContact O-N 3.31Å; W42-N46 PolarHBondContact O-ND2 2.72Å
43	A	97.4	Very high	96.4	Very high	61 Å²	61	111.3 Å²	111.3	50%	0.504	56%	0.564	S	S	.	*	H	α-helix	trans	-57.6	-42.2	177.4	0	0	0	0	0	111.8	N39 K47	N39-A43 VanDerWaalsContact O-CB 3.28Å; N39-A43 WeakPolarHBondContact O-CB 3.2Å; N39-A43 PolarHBondContact O-N 3.42Å; A43-K47 VanDerWaalsContact O-CB 3.27Å; A43-K47 WeakPolarHBondContact O-CB 3.22Å; A43-K47 PolarHBondContact O-N 3.11Å
44	K	98	Very high	96.7	Very high	116 Å²	116	111.9 Å²	111.9	50%	0.504	57%	0.568	S	S	.	*	H	α-helix	trans	-63.7	-48.4	176.8	178.8	179.5	175.8	178.9	0	112.3	R40 F41 W42 K47 L48	R40-K44 VanDerWaalsContact O-CB 3.23Å; R40-K44 WeakPolarHBondContact O-CB 3.43Å; R40-K44 PolarHBondContact O-N 3.01Å; F41-K44 PolarHBondContact O-N 3.33Å; W42-K44 VanDerWaalsContact C-N 3.28Å; W42-K44 PolarHBondContact O-N 2.97Å; K44-K47 PolarHBondContact O-N 2.76Å; K44-L48 HydrophobicContact CG-CD1 3.84Å; K44-L48 WeakPolarHBondContact O-CB 3.32Å; K44-L48 VanDerWaalsContact O-CG 3.25Å; K44-L48 WeakPolarHBondContact O-CG 3.49Å; K44-L48 PolarHBondContact O-N 2.76Å; K44-L48 VanDerWaalsContact O-N 3.08Å
45	N	97.9	Very high	96.9	Very high	28 Å²	28	113.7 Å²	113.7	15%	0.15	57%	0.565	C	S	.	*	H	α-helix	trans	-67.9	-39.1	-177.7	-73.9	-66.1	0	0	0	112.1	F41 W42 L48 N49 R50	F41-N45 WeakPolarHBondContact CD2-ND2 3.48Å; F41-N45 WeakPolarHBondContact CE1-ND2 3.47Å; F41-N45 WeakPolarHBondContact CE2-ND2 3.28Å; F41-N45 WeakPolarHBondContact CZ-ND2 3.46Å; F41-N45 PolarHBondContact O-N 3.14Å; F41-N45 PolarHBondContact O-ND2 3.01Å; W42-N45 PolarHBondContact O-N 2.96Å; N45-L48 PolarHBondContact O-N 2.94Å; N45-N49 PolarHBondContact O-N 2.82Å; N45-R50 WeakPolarHBondContact OD1-CD 3.41Å; N45-R50 PolarHBondContact OD1-NH1 2.84Å
46	N	96.8	Very high	97	Very high	111 Å²	111	113.8 Å²	113.8	59%	0.594	56%	0.564	S	S	*	*	H	α-helix	trans	-62.8	-45.4	174.3	-69.7	-13.2	0	0	0	111.1	W42 L48 N49	W42-N46 WeakPolarHBondContact O-CB 3.37Å; W42-N46 VanDerWaalsContact O-CG 3.28Å; W42-N46 PolarHBondContact O-N 3.31Å; W42-N46 PolarHBondContact O-ND2 2.72Å; N46-L48 VanDerWaalsContact C-N 3.27Å; N46-L48 PolarHBondContact O-N 2.7Å; N46-N49 PolarHBondContact O-N 2.83Å; N46-N49 PolarHBondContact O-OD1 2.82Å
47	K	98.1	Very high	97	Very high	179 Å²	179	115 Å²	115	78%	0.778	58%	0.579	S	S	*	*	H	α-helix	trans	-60.4	-36.6	177	-178	178.1	180	179.7	0	112.8	A43 K44 N49	A43-K47 VanDerWaalsContact O-CB 3.27Å; A43-K47 WeakPolarHBondContact O-CB 3.22Å; A43-K47 PolarHBondContact O-N 3.11Å; K44-K47 PolarHBondContact O-N 2.76Å; K47-N49 VanDerWaalsContact C-N 3.33Å
48	L	98.1	Very high	97.1	Very high	90 Å²	90	115.5 Å²	115.5	47%	0.471	58%	0.584	S	S	.	*	T	Hydrogen-bonded Turn	trans	-86.4	-2.1	-177.1	-65.9	174.1	0	0	0	113.5	K44 N45 N46 R50	K44-L48 HydrophobicContact CG-CD1 3.84Å; K44-L48 WeakPolarHBondContact O-CB 3.32Å; K44-L48 VanDerWaalsContact O-CG 3.25Å; K44-L48 WeakPolarHBondContact O-CG 3.49Å; K44-L48 PolarHBondContact O-N 2.76Å; K44-L48 VanDerWaalsContact O-N 3.08Å; N45-L48 PolarHBondContact O-N 2.94Å; N46-L48 VanDerWaalsContact C-N 3.27Å; N46-L48 PolarHBondContact O-N 2.7Å; L48-R50 HydrophobicContact CB-CG 3.96Å; L48-R50 PolarHBondContact O-N 2.94Å; L48-R50 VanDerWaalsContact O-N 3.13Å
49	N	96.6	Very high	97.2	Very high	143 Å²	143	117.8 Å²	117.8	77%	0.765	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	46.4	42.5	-177.6	-69	-46.2	0	0	0	113.2	N45 N46 K47	N45-N49 PolarHBondContact O-N 2.82Å; N46-N49 PolarHBondContact O-N 2.83Å; N46-N49 PolarHBondContact O-OD1 2.82Å; K47-N49 VanDerWaalsContact C-N 3.33Å
50	R	96.6	Very high	97.2	Very high	131 Å²	131	121.4 Å²	121.4	49%	0.494	60%	0.599	S	S	.	*	P	Polyproline II helix	trans	-70.5	132	-180	-70.1	171.9	177.3	176.3	-11.3	109.5	N45 L48	N45-R50 WeakPolarHBondContact OD1-CD 3.41Å; N45-R50 PolarHBondContact OD1-NH1 2.84Å; L48-R50 HydrophobicContact CB-CG 3.96Å; L48-R50 PolarHBondContact O-N 2.94Å; L48-R50 VanDerWaalsContact O-N 3.13Å
51	P	96.7	Very high	97.2	Very high	125 Å²	125	119.2 Å²	119.2	81%	0.812	59%	0.59	S	S	*	*	P	Polyproline II helix	trans	-67	144.5	178	28.3	-34.2	0	0	0	110.5
52	M	96.9	Very high	97.2	Very high	150 Å²	150	115.7 Å²	115.7	74%	0.739	58%	0.58	S	S	*	*	P	Polyproline II helix	trans	-74.7	131.6	171.2	-170.3	171.4	-66.9	0	0	109.2
53	S	97.5	Very high	97.3	Very high	91 Å²	91	110.2 Å²	110.2	64%	0.636	56%	0.561	S	S	*	*	P	Polyproline II helix	trans	-59.2	139.4	172.8	54.1	0	0	0	0	110.1	H55	S53-H55 PolarHBondContact O-N 2.98Å
54	P	97.6	Very high	97.3	Very high	77 Å²	77	108.7 Å²	108.7	50%	0.5	55%	0.546	S	S	.	.	P	Polyproline II helix	trans	-59.2	141.7	176.4	26.1	-33.9	0	0	0	110.3	I58	P54-I58 HydrophobicContact CB-CD1 4.39Å; P54-I58 HydrophobicContact CB-CG1 4.22Å; P54-I58 HydrophobicContact CB-CG2 4.01Å; P54-I58 HydrophobicContact CG-CD1 4.02Å; P54-I58 HydrophobicContact CG-CG1 4.37Å; P54-I58 HydrophobicContact CG-CG2 4.14Å; P54-I58 VanDerWaalsContact O-CD1 3.28Å; P54-I58 WeakPolarHBondContact O-CD1 3.3Å; P54-I58 WeakPolarHBondContact O-CG1 3.46Å
55	H	95.7	Very high	97.3	Very high	109 Å²	109	106.2 Å²	106.2	51%	0.505	54%	0.537	S	S	.	.			trans	-126.8	-69.7	-176.8	49	75	0	0	0	111.8	S53 T57 I58 Y59	S53-H55 PolarHBondContact O-N 2.98Å; H55-T57 VanDerWaalsContact C-N 3.32Å; H55-T57 PolarHBondContact O-N 3.49Å; H55-I58 PolarHBondContact O-N 3.09Å; H55-Y59 VanDerWaalsContact O-CB 3.25Å; H55-Y59 WeakPolarHBondContact O-CB 3.25Å; H55-Y59 PolarHBondContact O-N 3.35Å; H55-Y59 VanDerWaalsContact O-N 3.09Å
56	L	95.9	Very high	97.3	Very high	113 Å²	113	109 Å²	109	59%	0.592	55%	0.55	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.4	-30.5	-174.8	-74.7	174.9	0	0	0	112.3	I58	L56-I58 VanDerWaalsContact C-N 3.33Å
57	T	97.1	Very high	97.4	Very high	125 Å²	125	104 Å²	104	77%	0.767	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.8	-21.4	-177	50.6	0	0	0	0	113.4	H55	H55-T57 VanDerWaalsContact C-N 3.32Å; H55-T57 PolarHBondContact O-N 3.49Å
58	I	97.8	Very high	97.4	Very high	122 Å²	122	97.1 Å²	97.1	63%	0.626	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	-113.8	-15.8	-176.6	62.7	157.1	0	0	0	113.3	P54 H55 L56	P54-I58 HydrophobicContact CB-CD1 4.39Å; P54-I58 HydrophobicContact CB-CG1 4.22Å; P54-I58 HydrophobicContact CB-CG2 4.01Å; P54-I58 HydrophobicContact CG-CD1 4.02Å; P54-I58 HydrophobicContact CG-CG1 4.37Å; P54-I58 HydrophobicContact CG-CG2 4.14Å; P54-I58 VanDerWaalsContact O-CD1 3.28Å; P54-I58 WeakPolarHBondContact O-CD1 3.3Å; P54-I58 WeakPolarHBondContact O-CG1 3.46Å; H55-I58 PolarHBondContact O-N 3.09Å; L56-I58 VanDerWaalsContact C-N 3.33Å
59	Y	97.6	Very high	97.4	Very high	151 Å²	151	96.9 Å²	96.9	59%	0.592	50%	0.496	S	S	*	.	S	Bend	trans	-75.6	136	-176.7	-160	-86.3	0	0	0	111.3	H55 W61 M65	H55-Y59 VanDerWaalsContact O-CB 3.25Å; H55-Y59 WeakPolarHBondContact O-CB 3.25Å; H55-Y59 PolarHBondContact O-N 3.35Å; H55-Y59 VanDerWaalsContact O-N 3.09Å; Y59-W61 PolarHBondContact O-N 3.38Å; Y59-M65 HydrophobicContact CD1-CE 3.45Å; Y59-M65 VanDerWaalsContact CD1-CE 3.45Å; Y59-M65 HydrophobicContact CD1-SD 4.33Å; Y59-M65 HydrophobicContact CE1-CE 3.4Å; Y59-M65 VanDerWaalsContact CE1-CE 3.4Å; Y59-M65 HydrophobicContact CG-CE 4.45Å
60	K	97.8	Very high	97.5	Very high	181 Å²	181	92.6 Å²	92.6	79%	0.787	48%	0.475	S	S	*	.	P	Polyproline II helix	trans	-72.5	121.1	177.2	-176.3	178.5	179.3	178.7	0	110.4	S62	K60-S62 PolarHBondContact O-N 3.37Å
61	W	97.1	Very high	97.6	Very high	142 Å²	142	87.9 Å²	87.9	54%	0.538	46%	0.458	S	S	.	.	P	Polyproline II helix	trans	-61.5	129.8	175.4	-68.2	88.7	0	0	0	111.6	Y59 M65 M66 I69	Y59-W61 PolarHBondContact O-N 3.38Å; W61-M65 HydrophobicContact CD2-SD 4.33Å; W61-M65 HydrophobicContact CE3-CG 4.12Å; W61-M65 HydrophobicContact CE3-SD 3.73Å; W61-M65 HydrophobicContact CZ3-CG 4.28Å; W61-M65 HydrophobicContact CZ3-SD 4.15Å; W61-M66 HydrophobicContact CD2-SD 3.82Å; W61-M66 HydrophobicContact CE3-CG 3.99Å; W61-M66 HydrophobicContact CE3-SD 3.04Å; W61-M66 HydrophobicContact CG-SD 4.5Å; W61-M66 HydrophobicContact CH2-SD 4.27Å; W61-M66 HydrophobicContact CZ3-SD 3.3Å; W61-M66 WeakPolarHBondContact CZ3-SD 3.46Å; W61-I69 HydrophobicContact CZ3-CG2 4.45Å
62	S	97.6	Very high	97.7	Very high	40 Å²	40	89.3 Å²	89.3	28%	0.28	45%	0.448	S	S	.	.			trans	-114.1	154.9	173.3	69.1	0	0	0	0	110.1	K60 M65 M66	K60-S62 PolarHBondContact O-N 3.37Å; S62-M65 WeakPolarHBondContact O-CB 3.16Å; S62-M65 PolarHBondContact O-N 3.4Å; S62-M65 WeakPolarHBondContact OG-CB 3.45Å; S62-M66 PolarHBondContact O-N 3.25Å
63	M	97.8	Very high	97.8	Very high	30 Å²	30	84.3 Å²	84.3	15%	0.148	44%	0.435	C	S	.	.	H	α-helix	trans	-57.1	-45.7	-179.5	-179.5	-77.4	-77.7	0	0	112.6	M65 M66 M67 Y149 Y153 I156	M63-M65 VanDerWaalsContact C-N 3.3Å; M63-M65 PolarHBondContact O-N 2.88Å; M63-M66 PolarHBondContact O-N 3.24Å; M63-M67 HydrophobicContact CE-SD 4.38Å; M63-M67 WeakPolarHBondContact O-CG 3.3Å; M63-M67 PolarHBondContact O-N 2.95Å; M63-M67 HydrophobicContact SD-CG 3.71Å; M63-M67 HydrophobicContact SD-SD 3.21Å; M63-Y149 HydrophobicContact CB-CD1 4.43Å; M63-Y149 HydrophobicContact CB-CE1 3.96Å; M63-Y149 HydrophobicContact CE-CD1 3.6Å; M63-Y149 HydrophobicContact CE-CE1 4.23Å; M63-Y149 HydrophobicContact CE-CG 3.99Å; M63-Y149 WeakPolarHBondContact CE-O 3.49Å; M63-Y153 HydrophobicContact CE-CE2 4.5Å; M63-I156 HydrophobicContact CG-CD1 4.48Å
64	P	97.8	Very high	97.8	Very high	29 Å²	29	80.6 Å²	80.6	19%	0.188	41%	0.408	C	S	.	.	H	α-helix	trans	-63.3	-33.8	178.2	-23.7	35.9	0	0	0	113.6	M67 S68 V148 Y149	P64-M67 PolarHBondContact O-N 3.38Å; P64-S68 PolarHBondContact O-N 2.94Å; P64-V148 HydrophobicContact CB-CG1 3.94Å; P64-V148 HydrophobicContact CG-CG1 3.63Å; P64-Y149 HydrophobicContact CG-CD2 4.46Å; P64-Y149 HydrophobicContact CG-CE2 4.09Å
65	M	97.9	Very high	97.9	Very high	63 Å²	63	77.5 Å²	77.5	31%	0.31	39%	0.391	S	S	.	.	H	α-helix	trans	-64.9	-47.9	174.8	177.1	-175	-69.8	0	0	111.1	Y59 W61 S62 M63 M67 S68 I69	Y59-M65 HydrophobicContact CD1-CE 3.45Å; Y59-M65 VanDerWaalsContact CD1-CE 3.45Å; Y59-M65 HydrophobicContact CD1-SD 4.33Å; Y59-M65 HydrophobicContact CE1-CE 3.4Å; Y59-M65 VanDerWaalsContact CE1-CE 3.4Å; Y59-M65 HydrophobicContact CG-CE 4.45Å; W61-M65 HydrophobicContact CD2-SD 4.33Å; W61-M65 HydrophobicContact CE3-CG 4.12Å; W61-M65 HydrophobicContact CE3-SD 3.73Å; W61-M65 HydrophobicContact CZ3-CG 4.28Å; W61-M65 HydrophobicContact CZ3-SD 4.15Å; S62-M65 WeakPolarHBondContact O-CB 3.16Å; S62-M65 PolarHBondContact O-N 3.4Å; S62-M65 WeakPolarHBondContact OG-CB 3.45Å; M63-M65 VanDerWaalsContact C-N 3.3Å; M63-M65 PolarHBondContact O-N 2.88Å; M65-M67 VanDerWaalsContact C-N 3.31Å; M65-M67 PolarHBondContact O-N 3.44Å; M65-S68 WeakPolarHBondContact O-CB 3.41Å; M65-S68 PolarHBondContact O-N 3.42Å; M65-S68 VanDerWaalsContact O-N 3.17Å; M65-I69 PolarHBondContact O-N 3.46Å; M65-I69 VanDerWaalsContact O-N 3.12Å
66	M	98.2	Very high	98	Very high	86 Å²	86	77.6 Å²	77.6	42%	0.424	40%	0.399	S	S	.	.	H	α-helix	trans	-57.8	-45.8	175.3	-71.5	-59.3	-61.3	0	0	111	W61 S62 M63 S68 I69 T70	W61-M66 HydrophobicContact CD2-SD 3.82Å; W61-M66 HydrophobicContact CE3-CG 3.99Å; W61-M66 HydrophobicContact CE3-SD 3.04Å; W61-M66 HydrophobicContact CG-SD 4.5Å; W61-M66 HydrophobicContact CH2-SD 4.27Å; W61-M66 HydrophobicContact CZ3-SD 3.3Å; W61-M66 WeakPolarHBondContact CZ3-SD 3.46Å; S62-M66 PolarHBondContact O-N 3.25Å; M63-M66 PolarHBondContact O-N 3.24Å; M66-S68 VanDerWaalsContact C-N 3.32Å; M66-S68 PolarHBondContact O-N 3.12Å; M66-I69 WeakPolarHBondContact O-CG2 3.42Å; M66-I69 PolarHBondContact O-N 2.94Å; M66-T70 WeakPolarHBondContact O-CB 3.45Å; M66-T70 PolarHBondContact O-N 3.32Å; M66-T70 PolarHBondContact O-OG1 3.35Å
67	M	98.4	Very high	98.1	Very high	6 Å²	6	74.5 Å²	74.5	3%	0.03	39%	0.394	C	S	.	.	H	α-helix	trans	-61.6	-39.3	176.9	-71.1	-172.5	81.4	0	0	112.7	M63 P64 M65 T70 H71 Y126 N130 R133 G152 V155 I156	M63-M67 HydrophobicContact CE-SD 4.38Å; M63-M67 WeakPolarHBondContact O-CG 3.3Å; M63-M67 PolarHBondContact O-N 2.95Å; M63-M67 HydrophobicContact SD-CG 3.71Å; M63-M67 HydrophobicContact SD-SD 3.21Å; P64-M67 PolarHBondContact O-N 3.38Å; M65-M67 VanDerWaalsContact C-N 3.31Å; M65-M67 PolarHBondContact O-N 3.44Å; M67-T70 PolarHBondContact O-N 3.18Å; M67-H71 WeakPolarHBondContact O-CB 3.42Å; M67-H71 PolarHBondContact O-N 3.49Å; M67-Y126 WeakPolarHBondContact CA-OH 3.28Å; M67-Y126 VanDerWaalsContact CB-OH 3.28Å; M67-Y126 WeakPolarHBondContact CB-OH 3.24Å; M67-Y126 HydrophobicContact CE-CE2 4.02Å; M67-Y126 PolarHBondContact O-OH 3.45Å; M67-N130 VanDerWaalsContact CE-OD1 3.24Å; M67-N130 WeakPolarHBondContact CE-OD1 3.4Å; M67-R133 PolarHBondContact SD-NH1 3.35Å; M67-R133 VanDerWaalsContact SD-NH1 3.38Å; M67-G152 WeakPolarHBondContact SD-CA 3.44Å; M67-V155 HydrophobicContact CE-CB 3.79Å; M67-V155 HydrophobicContact CE-CG1 3.63Å; M67-I156 HydrophobicContact CE-CG1 4.26Å; M67-I156 HydrophobicContact CG-CD1 4.47Å; M67-I156 HydrophobicContact SD-CD1 4.31Å
68	S	98.3	Very high	98.2	Very high	36 Å²	36	70.4 Å²	70.4	25%	0.252	37%	0.367	S	S	.	.	H	α-helix	trans	-62.5	-45	178.2	179.7	0	0	0	0	112.1	P64 M65 M66 H71 R72	P64-S68 PolarHBondContact O-N 2.94Å; M65-S68 WeakPolarHBondContact O-CB 3.41Å; M65-S68 PolarHBondContact O-N 3.42Å; M65-S68 VanDerWaalsContact O-N 3.17Å; M66-S68 VanDerWaalsContact C-N 3.32Å; M66-S68 PolarHBondContact O-N 3.12Å; S68-H71 PolarHBondContact O-N 3.5Å; S68-R72 PolarHBondContact O-N 3.49Å; S68-R72 PolarHBondContact OG-NH1 3.24Å
69	I	98.3	Very high	98.2	Very high	84 Å²	84	68.3 Å²	68.3	43%	0.431	36%	0.363	S	S	.	.	H	α-helix	trans	-69.6	-38.6	177.6	-169.9	61.7	0	0	0	111.6	W61 M65 M66 H71 R72 G73	W61-I69 HydrophobicContact CZ3-CG2 4.45Å; M65-I69 PolarHBondContact O-N 3.46Å; M65-I69 VanDerWaalsContact O-N 3.12Å; M66-I69 WeakPolarHBondContact O-CG2 3.42Å; M66-I69 PolarHBondContact O-N 2.94Å; I69-H71 VanDerWaalsContact C-N 3.31Å; I69-H71 PolarHBondContact O-N 3.23Å; I69-R72 PolarHBondContact O-N 3.04Å; I69-G73 PolarHBondContact O-N 3.17Å
70	T	98.4	Very high	98.2	Very high	53 Å²	53	63 Å²	63	33%	0.325	36%	0.355	S	S	.	.	H	α-helix	trans	-61.8	-40	174.6	-57.2	0	0	0	0	111.2	M66 M67 R72 G73 T74 Y126	M66-T70 WeakPolarHBondContact O-CB 3.45Å; M66-T70 PolarHBondContact O-N 3.32Å; M66-T70 PolarHBondContact O-OG1 3.35Å; M67-T70 PolarHBondContact O-N 3.18Å; T70-R72 VanDerWaalsContact C-N 3.33Å; T70-R72 PolarHBondContact O-N 2.96Å; T70-G73 PolarHBondContact O-N 3.19Å; T70-T74 HydrophobicContact CG2-CG2 4.19Å; T70-T74 WeakPolarHBondContact O-CG2 3.45Å; T70-T74 PolarHBondContact O-N 3.02Å; T70-T74 PolarHBondContact O-OG1 2.86Å; T70-Y126 HydrophobicContact CG2-CD1 3.95Å; T70-Y126 HydrophobicContact CG2-CE1 3.51Å
71	H	98.8	Very high	98.2	Very high	32 Å²	32	56.4 Å²	56.4	15%	0.148	34%	0.338	C	S	.	.	H	α-helix	trans	-63.1	-39.3	177.6	-175.1	62	0	0	0	112.4	M67 S68 I69 T74 G75 Y126 H127 N130 H134	M67-H71 WeakPolarHBondContact O-CB 3.42Å; M67-H71 PolarHBondContact O-N 3.49Å; S68-H71 PolarHBondContact O-N 3.5Å; I69-H71 VanDerWaalsContact C-N 3.31Å; I69-H71 PolarHBondContact O-N 3.23Å; H71-T74 PolarHBondContact O-OG1 2.89Å; H71-G75 PolarHBondContact O-N 3.5Å; H71-Y126 HydrophobicContact CB-CE1 4.2Å; H71-H127 AromaticContact CE1-CD2 3.95Å; H71-H127 AromaticContact CE1-CE1 3.28Å; H71-H127 PolarHBondContact CE1-CE1 2.88Å; H71-H127 AromaticContact CE1-CG 3.89Å; H71-H127 AromaticContact CE1-ND1 3.48Å; H71-H127 PolarHBondContact CE1-ND1 3.45Å; H71-H127 AromaticContact CE1-NE2 3.58Å; H71-H127 PolarHBondContact CE1-O 3.31Å; H71-H127 AromaticContact ND1-CE1 3.58Å; H71-H127 AromaticContact ND1-CG 3.91Å; H71-H127 AromaticContact ND1-ND1 3.35Å; H71-H127 PolarHBondContact ND1-ND1 3.13Å; H71-H127 AromaticContact NE2-CE1 3.76Å; H71-H127 PolarHBondContact O-CE1 3.02Å; H71-H127 VanDerWaalsContact O-CE1 3.22Å; H71-H127 PolarHBondContact O-ND1 3.4Å; H71-N130 WeakPolarHBondContact CB-ND2 3.35Å; H71-H134 AromaticContact CD2-CD2 3.79Å; H71-H134 AromaticContact CD2-NE2 3.71Å; H71-H134 AromaticContact NE2-CD2 3.87Å
72	R	98.7	Very high	98.2	Very high	155 Å²	155	55.4 Å²	55.4	59%	0.585	34%	0.342	S	S	*	.	H	α-helix	trans	-64.8	-47.5	171.6	-66.1	-179.4	-174.4	112.4	1.3	111.3	S68 I69 T70 T74 G75 V76	S68-R72 PolarHBondContact O-N 3.49Å; S68-R72 PolarHBondContact OG-NH1 3.24Å; I69-R72 PolarHBondContact O-N 3.04Å; T70-R72 VanDerWaalsContact C-N 3.33Å; T70-R72 PolarHBondContact O-N 2.96Å; R72-T74 PolarHBondContact O-N 2.93Å; R72-G75 PolarHBondContact O-N 2.81Å; R72-V76 WeakPolarHBondContact O-CG2 3.15Å; R72-V76 PolarHBondContact O-N 3Å
73	G	98.6	Very high	98.3	Very high	45 Å²	45	56.8 Å²	56.8	46%	0.464	35%	0.351	S	S	.	.	H	α-helix	trans	-59.8	-46.4	180	0	0	0	0	0	112.7	I69 T70 G77	I69-G73 PolarHBondContact O-N 3.17Å; T70-G73 PolarHBondContact O-N 3.19Å; G73-G77 PolarHBondContact O-N 3.15Å
74	T	98.6	Very high	98.2	Very high	13 Å²	13	57.6 Å²	57.6	8%	0.08	36%	0.363	C	S	.	.	H	α-helix	trans	-66.7	-37.8	176	58.4	0	0	0	0	111.7	T70 H71 R72 G77 L78 P123 Y126 H127	T70-T74 HydrophobicContact CG2-CG2 4.19Å; T70-T74 WeakPolarHBondContact O-CG2 3.45Å; T70-T74 PolarHBondContact O-N 3.02Å; T70-T74 PolarHBondContact O-OG1 2.86Å; H71-T74 PolarHBondContact O-OG1 2.89Å; R72-T74 PolarHBondContact O-N 2.93Å; T74-G77 PolarHBondContact O-N 3.43Å; T74-L78 VanDerWaalsContact O-CB 3.3Å; T74-L78 WeakPolarHBondContact O-CB 3.35Å; T74-L78 WeakPolarHBondContact O-CG 3.39Å; T74-L78 PolarHBondContact O-N 3.23Å; T74-P123 HydrophobicContact CG2-CB 3.88Å; T74-Y126 HydrophobicContact CG2-CD1 3.91Å; T74-H127 WeakPolarHBondContact OG1-CB 3.24Å; T74-H127 PolarHBondContact OG1-ND1 3.27Å
75	G	98.4	Very high	98.2	Very high	13 Å²	13	62.5 Å²	62.5	13%	0.134	38%	0.381	C	S	.	.	H	α-helix	trans	-60.7	-50.8	175.6	0	0	0	0	0	112.2	H71 R72 G77 L78 S79 H127	H71-G75 PolarHBondContact O-N 3.5Å; R72-G75 PolarHBondContact O-N 2.81Å; G75-G77 PolarHBondContact O-N 3.23Å; G75-L78 PolarHBondContact O-N 2.92Å; G75-S79 WeakPolarHBondContact O-CB 3.34Å; G75-S79 PolarHBondContact O-N 3.06Å; G75-S79 PolarHBondContact O-OG 3.38Å; G75-H127 WeakPolarHBondContact CA-CE1 3.34Å; G75-H127 WeakPolarHBondContact CA-ND1 3.28Å; G75-H127 PolarHBondContact N-ND1 3.2Å; G75-H127 VanDerWaalsContact N-ND1 3.19Å
76	V	98.6	Very high	98.1	Very high	111 Å²	111	61.8 Å²	61.8	67%	0.673	39%	0.386	S	S	*	.	H	α-helix	trans	-61.5	-44.8	176.4	173	0	0	0	0	111.2	R72 L78 S79 G80	R72-V76 WeakPolarHBondContact O-CG2 3.15Å; R72-V76 PolarHBondContact O-N 3Å; V76-L78 PolarHBondContact O-N 3.19Å; V76-S79 PolarHBondContact O-N 2.86Å; V76-G80 PolarHBondContact O-N 3.42Å
77	G	98.1	Very high	98.1	Very high	47 Å²	47	62.9 Å²	62.9	49%	0.485	39%	0.393	S	S	.	.	H	α-helix	trans	-61.7	-43.3	178.9	0	0	0	0	0	112.8	G73 T74 G75 G81	G73-G77 PolarHBondContact O-N 3.15Å; T74-G77 PolarHBondContact O-N 3.43Å; G75-G77 PolarHBondContact O-N 3.23Å; G77-G81 PolarHBondContact O-N 3.08Å
78	L	98.3	Very high	98	Very high	40 Å²	40	66.9 Å²	66.9	21%	0.209	41%	0.414	C	S	.	.	H	α-helix	trans	-67.2	-47.5	177.5	-71.5	172.3	0	0	0	111.9	T74 G75 V76 G80 G81 I82 P123 V124 H127	T74-L78 VanDerWaalsContact O-CB 3.3Å; T74-L78 WeakPolarHBondContact O-CB 3.35Å; T74-L78 WeakPolarHBondContact O-CG 3.39Å; T74-L78 PolarHBondContact O-N 3.23Å; G75-L78 PolarHBondContact O-N 2.92Å; V76-L78 PolarHBondContact O-N 3.19Å; L78-G80 VanDerWaalsContact C-N 3.34Å; L78-G80 PolarHBondContact O-N 2.81Å; L78-G81 PolarHBondContact O-N 3.11Å; L78-I82 WeakPolarHBondContact O-CG1 3.39Å; L78-I82 PolarHBondContact O-N 3.43Å; L78-P123 HydrophobicContact CD2-CB 4.11Å; L78-P123 HydrophobicContact CG-CB 4.21Å; L78-V124 HydrophobicContact CD1-CG2 4.49Å; L78-V124 HydrophobicContact CD2-CB 4.49Å; L78-V124 HydrophobicContact CD2-CG2 3.46Å; L78-V124 VanDerWaalsContact CD2-CG2 3.46Å; L78-H127 HydrophobicContact CD1-CB 3.75Å
79	S	98.4	Very high	97.9	Very high	77 Å²	77	68.8 Å²	68.8	54%	0.538	43%	0.431	S	S	.	.	H	α-helix	trans	-59	-47	175.7	-63.8	0	0	0	0	111.1	G75 V76 G81 I82 S83	G75-S79 WeakPolarHBondContact O-CB 3.34Å; G75-S79 PolarHBondContact O-N 3.06Å; G75-S79 PolarHBondContact O-OG 3.38Å; V76-S79 PolarHBondContact O-N 2.86Å; S79-G81 PolarHBondContact O-N 3.45Å; S79-I82 PolarHBondContact O-N 3.06Å; S79-S83 WeakPolarHBondContact O-CB 3.35Å; S79-S83 PolarHBondContact O-N 3.3Å; S79-S83 PolarHBondContact O-OG 3.05Å; S79-S83 VanDerWaalsContact O-OG 3.05Å
80	G	98.2	Very high	97.8	Very high	41 Å²	41	71.7 Å²	71.7	42%	0.423	45%	0.447	S	S	.	.	H	α-helix	trans	-60	-43.5	176.1	0	0	0	0	0	112.7	V76 L78 S83 A84	V76-G80 PolarHBondContact O-N 3.42Å; L78-G80 VanDerWaalsContact C-N 3.34Å; L78-G80 PolarHBondContact O-N 2.81Å; G80-S83 PolarHBondContact O-N 2.85Å; G80-A84 WeakPolarHBondContact O-CB 3.33Å; G80-A84 PolarHBondContact O-N 3.12Å
81	G	97.4	Very high	97.7	Very high	42 Å²	42	74.9 Å²	74.9	43%	0.433	47%	0.466	S	S	.	.	H	α-helix	trans	-63.1	-45.3	177.8	0	0	0	0	0	113.1	G77 L78 S79 A84 F85	G77-G81 PolarHBondContact O-N 3.08Å; L78-G81 PolarHBondContact O-N 3.11Å; S79-G81 PolarHBondContact O-N 3.45Å; G81-A84 PolarHBondContact O-N 3.46Å; G81-F85 WeakPolarHBondContact O-CB 3.2Å; G81-F85 PolarHBondContact O-N 3.29Å
82	I	97.8	Very high	97.6	Very high	120 Å²	120	76.6 Å²	76.6	62%	0.615	48%	0.476	S	S	*	.	H	α-helix	trans	-66	-45.4	177.4	-67.1	167.4	0	0	0	110.6	L78 S79 A84 F85 A86	L78-I82 WeakPolarHBondContact O-CG1 3.39Å; L78-I82 PolarHBondContact O-N 3.43Å; S79-I82 PolarHBondContact O-N 3.06Å; I82-A84 PolarHBondContact O-N 3.43Å; I82-F85 PolarHBondContact O-N 2.95Å; I82-A86 WeakPolarHBondContact O-CB 3.4Å; I82-A86 PolarHBondContact O-N 3.35Å
83	S	98.3	Very high	97.4	Very high	69 Å²	69	75.6 Å²	75.6	48%	0.483	49%	0.49	S	S	.	.	H	α-helix	trans	-62.1	-43.5	177	-64.7	0	0	0	0	111.8	S79 G80 A86 L87	S79-S83 WeakPolarHBondContact O-CB 3.35Å; S79-S83 PolarHBondContact O-N 3.3Å; S79-S83 PolarHBondContact O-OG 3.05Å; S79-S83 VanDerWaalsContact O-OG 3.05Å; G80-S83 PolarHBondContact O-N 2.85Å; S83-A86 PolarHBondContact O-N 2.91Å; S83-L87 WeakPolarHBondContact O-CB 3.16Å; S83-L87 VanDerWaalsContact O-CG 3.28Å; S83-L87 WeakPolarHBondContact O-CG 3.41Å; S83-L87 PolarHBondContact O-N 3.44Å
84	A	97.4	Very high	97.2	Very high	47 Å²	47	74.7 Å²	74.7	39%	0.388	48%	0.481	S	S	.	.	H	α-helix	trans	-63.2	-45.1	176.1	0	0	0	0	0	111.5	G80 G81 I82 A86 L87 L88	G80-A84 WeakPolarHBondContact O-CB 3.33Å; G80-A84 PolarHBondContact O-N 3.12Å; G81-A84 PolarHBondContact O-N 3.46Å; I82-A84 PolarHBondContact O-N 3.43Å; A84-A86 VanDerWaalsContact C-N 3.34Å; A84-A86 PolarHBondContact O-N 2.85Å; A84-L87 PolarHBondContact O-N 3.5Å; A84-L88 WeakPolarHBondContact O-CB 3.49Å; A84-L88 VanDerWaalsContact O-CG 3.23Å; A84-L88 WeakPolarHBondContact O-CG 3.46Å; A84-L88 PolarHBondContact O-N 3.05Å
85	F	96.6	Very high	97	Very high	132 Å²	132	79 Å²	79	58%	0.579	50%	0.503	S	S	*	.	H	α-helix	trans	-58.2	-46.2	176	-179.5	-98.3	0	0	0	111.7	G81 I82 L88 A89	G81-F85 WeakPolarHBondContact O-CB 3.2Å; G81-F85 PolarHBondContact O-N 3.29Å; I82-F85 PolarHBondContact O-N 2.95Å; F85-L88 PolarHBondContact O-N 2.92Å; F85-A89 WeakPolarHBondContact O-CB 3.23Å; F85-A89 PolarHBondContact O-N 3.48Å
86	A	97.1	Very high	96.8	Very high	49 Å²	49	85.4 Å²	85.4	41%	0.405	52%	0.524	S	S	.	.	H	α-helix	trans	-62.9	-42.9	177.6	0	0	0	0	0	112.6	I82 S83 A84 A89 L90	I82-A86 WeakPolarHBondContact O-CB 3.4Å; I82-A86 PolarHBondContact O-N 3.35Å; S83-A86 PolarHBondContact O-N 2.91Å; A84-A86 VanDerWaalsContact C-N 3.34Å; A84-A86 PolarHBondContact O-N 2.85Å; A86-A89 PolarHBondContact O-N 2.89Å; A86-L90 WeakPolarHBondContact O-CG 3.37Å; A86-L90 PolarHBondContact O-N 3.41Å
87	L	97.9	Very high	96.6	Very high	108 Å²	108	83.6 Å²	83.6	57%	0.565	52%	0.515	S	S	*	.	H	α-helix	trans	-66.4	-43.4	177.3	-72.2	172.3	0	0	0	112.1	S83 A84 A89 L90 V91	S83-L87 WeakPolarHBondContact O-CB 3.16Å; S83-L87 VanDerWaalsContact O-CG 3.28Å; S83-L87 WeakPolarHBondContact O-CG 3.41Å; S83-L87 PolarHBondContact O-N 3.44Å; A84-L87 PolarHBondContact O-N 3.5Å; L87-A89 VanDerWaalsContact C-N 3.31Å; L87-A89 PolarHBondContact O-N 3.46Å; L87-L90 WeakPolarHBondContact O-CB 3.23Å; L87-L90 PolarHBondContact O-N 2.83Å; L87-L90 VanDerWaalsContact O-N 3.12Å; L87-V91 WeakPolarHBondContact O-CG2 3.2Å; L87-V91 PolarHBondContact O-N 3.39Å
88	L	96.4	Very high	96.5	Very high	91 Å²	91	87.6 Å²	87.6	48%	0.476	52%	0.516	S	S	.	.	H	α-helix	trans	-64.8	-37.1	177.8	-69.9	174.2	0	0	0	111.5	A84 F85 L90 V91 L92	A84-L88 WeakPolarHBondContact O-CB 3.49Å; A84-L88 VanDerWaalsContact O-CG 3.23Å; A84-L88 WeakPolarHBondContact O-CG 3.46Å; A84-L88 PolarHBondContact O-N 3.05Å; F85-L88 PolarHBondContact O-N 2.92Å; L88-L90 PolarHBondContact O-N 2.94Å; L88-V91 PolarHBondContact O-N 2.85Å; L88-L92 HydrophobicContact CB-CD1 3.95Å; L88-L92 HydrophobicContact CB-CG 4.24Å; L88-L92 HydrophobicContact CD2-CD1 3.99Å; L88-L92 HydrophobicContact CD2-CD2 4.4Å; L88-L92 HydrophobicContact CD2-CG 4.07Å; L88-L92 HydrophobicContact CG-CD1 4.44Å; L88-L92 VanDerWaalsContact O-CB 3.23Å; L88-L92 WeakPolarHBondContact O-CB 3.36Å; L88-L92 VanDerWaalsContact O-CG 3.31Å; L88-L92 WeakPolarHBondContact O-CG 3.28Å; L88-L92 PolarHBondContact O-N 3.46Å
89	A	95.1	Very high	96.4	Very high	75 Å²	75	88.6 Å²	88.6	62%	0.62	52%	0.517	S	S	*	.	H	α-helix	trans	-63.2	-24.9	174.4	0	0	0	0	0	113.3	F85 A86 L87	F85-A89 WeakPolarHBondContact O-CB 3.23Å; F85-A89 PolarHBondContact O-N 3.48Å; A86-A89 PolarHBondContact O-N 2.89Å; L87-A89 VanDerWaalsContact C-N 3.31Å; L87-A89 PolarHBondContact O-N 3.46Å
90	L	96.1	Very high	96.1	Very high	145 Å²	145	87.6 Å²	87.6	76%	0.759	51%	0.506	S	S	*	.	H	α-helix	trans	-86.6	-35.8	176.9	-71	166.9	0	0	0	113	A86 L87 L88	A86-L90 WeakPolarHBondContact O-CG 3.37Å; A86-L90 PolarHBondContact O-N 3.41Å; L87-L90 WeakPolarHBondContact O-CB 3.23Å; L87-L90 PolarHBondContact O-N 2.83Å; L87-L90 VanDerWaalsContact O-N 3.12Å; L88-L90 PolarHBondContact O-N 2.94Å
91	V	97.3	Very high	96	Very high	120 Å²	120	90.6 Å²	90.6	73%	0.727	51%	0.512	S	S	*	.	H	α-helix	trans	-96.1	-32	-169.8	177.2	0	0	0	0	112.4	L87 L88	L87-V91 WeakPolarHBondContact O-CG2 3.2Å; L87-V91 PolarHBondContact O-N 3.39Å; L88-V91 PolarHBondContact O-N 2.85Å
92	L	96.5	Very high	95.9	Very high	68 Å²	68	92.5 Å²	92.5	36%	0.356	51%	0.512	S	S	.	.			trans	-82.9	143	-175.6	-60.3	-178.6	0	0	0	112	L88 Y99	L88-L92 HydrophobicContact CB-CD1 3.95Å; L88-L92 HydrophobicContact CB-CG 4.24Å; L88-L92 HydrophobicContact CD2-CD1 3.99Å; L88-L92 HydrophobicContact CD2-CD2 4.4Å; L88-L92 HydrophobicContact CD2-CG 4.07Å; L88-L92 HydrophobicContact CG-CD1 4.44Å; L88-L92 VanDerWaalsContact O-CB 3.23Å; L88-L92 WeakPolarHBondContact O-CB 3.36Å; L88-L92 VanDerWaalsContact O-CG 3.31Å; L88-L92 WeakPolarHBondContact O-CG 3.28Å; L88-L92 PolarHBondContact O-N 3.46Å; L92-Y99 HydrophobicContact CB-CE2 4.33Å; L92-Y99 WeakPolarHBondContact CB-OH 3.33Å; L92-Y99 HydrophobicContact CD1-CE1 4.24Å; L92-Y99 HydrophobicContact CD1-CE2 4.27Å
93	P	94.9	Very high	95.6	Very high	135 Å²	135	90.8 Å²	90.8	88%	0.877	50%	0.503	S	S	*	.	S	Bend	trans	-80.6	-24.7	-171.6	30.8	-36.1	0	0	0	114.6
94	G	93.6	Very high	95.3	Very high	26 Å²	26	93.6 Å²	93.6	27%	0.268	51%	0.509	S	S	.	.	S	Bend	trans	-77.3	159.5	178.2	0	0	0	0	0	113.4	Y99	G94-Y99 VanDerWaalsContact CA-OH 3.29Å; G94-Y99 WeakPolarHBondContact CA-OH 3.36Å; G94-Y99 PolarHBondContact N-OH 3.27Å; G94-Y99 VanDerWaalsContact O-CE2 3.27Å; G94-Y99 WeakPolarHBondContact O-CE2 3.42Å
95	N	94.1	Very high	95.2	Very high	103 Å²	103	95 Å²	95	55%	0.551	52%	0.515	S	S	*	.			trans	-91.1	171.8	172	64	20.9	0	0	0	111.4	P97 Y98 Y99	N95-P97 WeakPolarHBondContact OD1-CD 3.48Å; N95-Y98 WeakPolarHBondContact O-CB 3.4Å; N95-Y98 PolarHBondContact O-N 3.47Å; N95-Y98 VanDerWaalsContact OD1-CB 3.27Å; N95-Y98 WeakPolarHBondContact OD1-CB 3.15Å; N95-Y98 PolarHBondContact OD1-N 3.15Å; N95-Y99 WeakPolarHBondContact O-CD2 3.28Å; N95-Y99 PolarHBondContact O-N 2.96Å
96	Y	93.9	Very high	95.1	Very high	148 Å²	148	94.1 Å²	94.1	58%	0.58	52%	0.516	S	S	*	.	H	α-helix	trans	-57.3	-47.1	-178.3	177.7	-101.4	0	0	0	114	Y98 Y99 L100	Y96-Y98 VanDerWaalsContact C-N 3.32Å; Y96-Y98 PolarHBondContact O-N 3.35Å; Y96-Y99 PolarHBondContact O-N 3.29Å; Y96-L100 HydrophobicContact CD1-CD1 3.93Å; Y96-L100 HydrophobicContact CD1-CG 4.32Å; Y96-L100 HydrophobicContact CE1-CD1 3.3Å; Y96-L100 HydrophobicContact CE1-CD2 4.42Å; Y96-L100 HydrophobicContact CE1-CG 3.88Å; Y96-L100 HydrophobicContact CE2-CD2 4.32Å; Y96-L100 HydrophobicContact CE2-CG 4.33Å; Y96-L100 PolarHBondContact O-N 2.86Å; Y96-L100 VanDerWaalsContact O-N 3.11Å
97	P	96.1	Very high	94.7	Very high	72 Å²	72	96.8 Å²	96.8	47%	0.468	53%	0.532	S	S	.	.	H	α-helix	trans	-56.5	-41.4	175.3	-27.1	35.4	0	0	0	113.9	N95 Y99 L100 D101	N95-P97 WeakPolarHBondContact OD1-CD 3.48Å; P97-Y99 VanDerWaalsContact C-N 3.32Å; P97-Y99 PolarHBondContact O-N 3.22Å; P97-L100 WeakPolarHBondContact O-CB 3.49Å; P97-L100 PolarHBondContact O-N 3.4Å; P97-L100 VanDerWaalsContact O-N 3.13Å; P97-D101 PolarHBondContact O-N 3.28Å
98	Y	96.1	Very high	94.5	Very high	131 Å²	131	93.7 Å²	93.7	51%	0.514	52%	0.517	S	S	.	.	H	α-helix	trans	-57	-43.5	177.6	170.3	-94.9	0	0	0	112.4	N95 Y96 D101 L102	N95-Y98 WeakPolarHBondContact O-CB 3.4Å; N95-Y98 PolarHBondContact O-N 3.47Å; N95-Y98 VanDerWaalsContact OD1-CB 3.27Å; N95-Y98 WeakPolarHBondContact OD1-CB 3.15Å; N95-Y98 PolarHBondContact OD1-N 3.15Å; Y96-Y98 VanDerWaalsContact C-N 3.32Å; Y96-Y98 PolarHBondContact O-N 3.35Å; Y98-D101 PolarHBondContact O-N 3.28Å; Y98-L102 WeakPolarHBondContact O-CB 3.45Å; Y98-L102 PolarHBondContact O-N 3.44Å
99	Y	94.9	Very high	94.3	Very high	61 Å²	61	91.2 Å²	91.2	24%	0.239	51%	0.514	C	S	.	.	H	α-helix	trans	-72.7	-31.2	177.8	-64.2	-62.6	0	0	0	113.2	L92 G94 N95 Y96 P97 L102 I103	L92-Y99 HydrophobicContact CB-CE2 4.33Å; L92-Y99 WeakPolarHBondContact CB-OH 3.33Å; L92-Y99 HydrophobicContact CD1-CE1 4.24Å; L92-Y99 HydrophobicContact CD1-CE2 4.27Å; G94-Y99 VanDerWaalsContact CA-OH 3.29Å; G94-Y99 WeakPolarHBondContact CA-OH 3.36Å; G94-Y99 PolarHBondContact N-OH 3.27Å; G94-Y99 VanDerWaalsContact O-CE2 3.27Å; G94-Y99 WeakPolarHBondContact O-CE2 3.42Å; N95-Y99 WeakPolarHBondContact O-CD2 3.28Å; N95-Y99 PolarHBondContact O-N 2.96Å; Y96-Y99 PolarHBondContact O-N 3.29Å; P97-Y99 VanDerWaalsContact C-N 3.32Å; P97-Y99 PolarHBondContact O-N 3.22Å; Y99-L102 HydrophobicContact CD1-CD2 4.43Å; Y99-L102 PolarHBondContact O-N 3.1Å; Y99-I103 VanDerWaalsContact O-CG1 3.28Å; Y99-I103 WeakPolarHBondContact O-CG1 3.3Å; Y99-I103 PolarHBondContact O-N 3.09Å
100	L	93.4	Very high	94.1	Very high	57 Å²	57	92.7 Å²	92.7	30%	0.298	52%	0.517	S	S	.	.	H	α-helix	trans	-63.8	-45.7	171.7	-72.5	-175.1	0	0	0	111.3	Y96 P97 L102 I103 H104	Y96-L100 HydrophobicContact CD1-CD1 3.93Å; Y96-L100 HydrophobicContact CD1-CG 4.32Å; Y96-L100 HydrophobicContact CE1-CD1 3.3Å; Y96-L100 HydrophobicContact CE1-CD2 4.42Å; Y96-L100 HydrophobicContact CE1-CG 3.88Å; Y96-L100 HydrophobicContact CE2-CD2 4.32Å; Y96-L100 HydrophobicContact CE2-CG 4.33Å; Y96-L100 PolarHBondContact O-N 2.86Å; Y96-L100 VanDerWaalsContact O-N 3.11Å; P97-L100 WeakPolarHBondContact O-CB 3.49Å; P97-L100 PolarHBondContact O-N 3.4Å; P97-L100 VanDerWaalsContact O-N 3.13Å; L100-L102 VanDerWaalsContact C-N 3.3Å; L100-L102 PolarHBondContact O-N 3.43Å; L100-I103 PolarHBondContact O-N 3.42Å; L100-H104 VanDerWaalsContact O-CG 3.3Å; L100-H104 PolarHBondContact O-N 3.21Å; L100-H104 PolarHBondContact O-ND1 3.22Å
101	D	95.1	Very high	93.9	Very high	104 Å²	104	89.7 Å²	89.7	56%	0.556	51%	0.513	S	S	*	.	H	α-helix	trans	-63.4	-38.7	177.1	-69.7	-22	0	0	0	111.5	P97 Y98 H104 S105	P97-D101 PolarHBondContact O-N 3.28Å; Y98-D101 PolarHBondContact O-N 3.28Å; D101-H104 PolarHBondContact O-N 3.19Å; D101-S105 WeakPolarHBondContact O-CB 3.45Å; D101-S105 PolarHBondContact O-N 3.24Å
102	L	94.4	Very high	93.8	Very high	81 Å²	81	89 Å²	89	42%	0.424	51%	0.505	S	S	.	.	H	α-helix	trans	-58.7	-48.6	172.4	-178.3	62.9	0	0	0	111.1	Y98 Y99 L100 H104 S105 L106	Y98-L102 WeakPolarHBondContact O-CB 3.45Å; Y98-L102 PolarHBondContact O-N 3.44Å; Y99-L102 HydrophobicContact CD1-CD2 4.43Å; Y99-L102 PolarHBondContact O-N 3.1Å; L100-L102 VanDerWaalsContact C-N 3.3Å; L100-L102 PolarHBondContact O-N 3.43Å; L102-H104 VanDerWaalsContact C-N 3.34Å; L102-H104 PolarHBondContact O-N 2.91Å; L102-S105 PolarHBondContact O-N 3.18Å; L102-S105 PolarHBondContact O-OG 2.88Å; L102-L106 WeakPolarHBondContact O-CG 3.1Å; L102-L106 PolarHBondContact O-N 3.06Å
103	I	92.7	Very high	93.6	Very high	84 Å²	84	89 Å²	89	43%	0.431	51%	0.505	S	S	.	.	H	α-helix	trans	-62.6	-40.9	177.4	-67.7	165.2	0	0	0	111.2	Y99 L100 S105 L106	Y99-I103 VanDerWaalsContact O-CG1 3.28Å; Y99-I103 WeakPolarHBondContact O-CG1 3.3Å; Y99-I103 PolarHBondContact O-N 3.09Å; L100-I103 PolarHBondContact O-N 3.42Å; I103-S105 VanDerWaalsContact C-N 3.32Å; I103-S105 PolarHBondContact O-N 3.27Å; I103-L106 WeakPolarHBondContact O-CB 3.46Å; I103-L106 PolarHBondContact O-N 3.48Å
104	H	91.7	Very high	93.6	Very high	129 Å²	129	85.4 Å²	85.4	60%	0.597	48%	0.483	S	S	*	.	H	α-helix	trans	-63	-38.2	175.7	-68.6	157.3	0	0	0	112	L100 D101 L102 L106 S107	L100-H104 VanDerWaalsContact O-CG 3.3Å; L100-H104 PolarHBondContact O-N 3.21Å; L100-H104 PolarHBondContact O-ND1 3.22Å; D101-H104 PolarHBondContact O-N 3.19Å; L102-H104 VanDerWaalsContact C-N 3.34Å; L102-H104 PolarHBondContact O-N 2.91Å; H104-L106 PolarHBondContact O-N 3.35Å; H104-S107 PolarHBondContact O-N 3.34Å; H104-S107 VanDerWaalsContact O-N 3.1Å
105	S	95.1	Very high	93.6	Very high	76 Å²	76	89.6 Å²	89.6	53%	0.531	50%	0.498	S	S	.	.	H	α-helix	trans	-63.9	-26.6	178.9	79.4	0	0	0	0	113.4	D101 L102 I103 S107	D101-S105 WeakPolarHBondContact O-CB 3.45Å; D101-S105 PolarHBondContact O-N 3.24Å; L102-S105 PolarHBondContact O-N 3.18Å; L102-S105 PolarHBondContact O-OG 2.88Å; I103-S105 VanDerWaalsContact C-N 3.32Å; I103-S105 PolarHBondContact O-N 3.27Å; S105-S107 PolarHBondContact O-N 3.35Å; S105-S107 VanDerWaalsContact O-N 3.09Å; S105-S107 PolarHBondContact O-OG 3.33Å
106	L	94	Very high	93.6	Very high	114 Å²	114	87.4 Å²	87.4	60%	0.597	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.5	-9.8	175.6	-61.6	175.9	0	0	0	113.2	L102 I103 H104 V108	L102-L106 WeakPolarHBondContact O-CG 3.1Å; L102-L106 PolarHBondContact O-N 3.06Å; I103-L106 WeakPolarHBondContact O-CB 3.46Å; I103-L106 PolarHBondContact O-N 3.48Å; H104-L106 PolarHBondContact O-N 3.35Å; L106-V108 HydrophobicContact CB-CG2 3.86Å; L106-V108 PolarHBondContact O-N 3.23Å
107	S	89.9	Confident	93.7	Very high	104 Å²	104	83.9 Å²	83.9	73%	0.727	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.7	39.6	175.2	-54	0	0	0	0	113	H104 S105 G109	H104-S107 PolarHBondContact O-N 3.34Å; H104-S107 VanDerWaalsContact O-N 3.1Å; S105-S107 PolarHBondContact O-N 3.35Å; S105-S107 VanDerWaalsContact O-N 3.09Å; S105-S107 PolarHBondContact O-OG 3.33Å; S107-G109 PolarHBondContact O-N 2.82Å
108	V	92.1	Very high	93.7	Very high	44 Å²	44	83.5 Å²	83.5	27%	0.267	47%	0.474	S	S	.	.			trans	-64.9	132.2	-177.4	-176.1	0	0	0	0	109.9	L106 L112 L113	L106-V108 HydrophobicContact CB-CG2 3.86Å; L106-V108 PolarHBondContact O-N 3.23Å; V108-L112 HydrophobicContact CG1-CB 3.7Å; V108-L112 HydrophobicContact CG1-CD2 3.5Å; V108-L112 VanDerWaalsContact CG1-CD2 3.5Å; V108-L112 HydrophobicContact CG1-CG 3.66Å; V108-L113 HydrophobicContact CB-CD1 4.42Å; V108-L113 HydrophobicContact CB-CD2 4.08Å; V108-L113 HydrophobicContact CB-CG 3.97Å; V108-L113 HydrophobicContact CG1-CD2 4.19Å; V108-L113 HydrophobicContact CG1-CG 3.93Å; V108-L113 WeakPolarHBondContact O-CD1 3.1Å
109	G	92.8	Very high	93.6	Very high	39 Å²	39	79.5 Å²	79.5	40%	0.402	47%	0.472	S	S	.	.			trans	-61.1	151	179.8	0	0	0	0	0	113.1	S107 A111 L112 L113	S107-G109 PolarHBondContact O-N 2.82Å; G109-A111 VanDerWaalsContact C-N 3.25Å; G109-A111 PolarHBondContact O-N 3.44Å; G109-A111 VanDerWaalsContact O-N 3.16Å; G109-L112 PolarHBondContact O-N 3.27Å; G109-L112 VanDerWaalsContact O-N 3.09Å; G109-L113 PolarHBondContact O-N 3.22Å; G109-L113 VanDerWaalsContact O-N 3.15Å
110	P	91.4	Very high	93.7	Very high	106 Å²	106	82.4 Å²	82.4	69%	0.688	49%	0.49	S	S	*	.	H	α-helix	trans	-58.5	-35.1	-173.5	21.4	-32.9	0	0	0	113	L112 L113 S114	P110-L112 PolarHBondContact O-N 3.44Å; P110-L113 PolarHBondContact O-N 2.88Å; P110-S114 WeakPolarHBondContact O-CB 3.45Å; P110-S114 PolarHBondContact O-N 2.97Å; P110-S114 PolarHBondContact O-OG 2.87Å; P110-S114 VanDerWaalsContact O-OG 3.06Å
111	A	92.8	Very high	93.9	Very high	82 Å²	82	80.4 Å²	80.4	68%	0.678	48%	0.482	S	S	*	.	H	α-helix	trans	-62.8	-43.2	178.4	0	0	0	0	0	112.8	G109 S114 L115	G109-A111 VanDerWaalsContact C-N 3.25Å; G109-A111 PolarHBondContact O-N 3.44Å; G109-A111 VanDerWaalsContact O-N 3.16Å; A111-S114 PolarHBondContact O-N 3.16Å; A111-L115 WeakPolarHBondContact O-CB 3.21Å; A111-L115 PolarHBondContact O-N 3.15Å
112	L	94.2	Very high	94	Very high	106 Å²	106	78 Å²	78	56%	0.555	47%	0.466	S	S	*	.	H	α-helix	trans	-72.4	-37.4	179.9	178.9	59.6	0	0	0	111.1	V108 G109 P110 L115 A116	V108-L112 HydrophobicContact CG1-CB 3.7Å; V108-L112 HydrophobicContact CG1-CD2 3.5Å; V108-L112 VanDerWaalsContact CG1-CD2 3.5Å; V108-L112 HydrophobicContact CG1-CG 3.66Å; G109-L112 PolarHBondContact O-N 3.27Å; G109-L112 VanDerWaalsContact O-N 3.09Å; P110-L112 PolarHBondContact O-N 3.44Å; L112-L115 PolarHBondContact O-N 3.09Å; L112-A116 WeakPolarHBondContact O-CB 3.42Å; L112-A116 PolarHBondContact O-N 3.17Å
113	L	92.9	Very high	94.2	Very high	67 Å²	67	75.5 Å²	75.5	35%	0.351	46%	0.455	S	S	.	.	H	α-helix	trans	-62.2	-45.8	172.3	-73.7	173.4	0	0	0	111.8	V108 G109 P110 L115 A116 K117	V108-L113 HydrophobicContact CB-CD1 4.42Å; V108-L113 HydrophobicContact CB-CD2 4.08Å; V108-L113 HydrophobicContact CB-CG 3.97Å; V108-L113 HydrophobicContact CG1-CD2 4.19Å; V108-L113 HydrophobicContact CG1-CG 3.93Å; V108-L113 WeakPolarHBondContact O-CD1 3.1Å; G109-L113 PolarHBondContact O-N 3.22Å; G109-L113 VanDerWaalsContact O-N 3.15Å; P110-L113 PolarHBondContact O-N 2.88Å; L113-L115 VanDerWaalsContact C-N 3.32Å; L113-L115 PolarHBondContact O-N 3.45Å; L113-A116 PolarHBondContact O-N 3.32Å; L113-K117 WeakPolarHBondContact O-CG 3.48Å; L113-K117 PolarHBondContact O-N 3.27Å
114	S	93.3	Very high	94.4	Very high	60 Å²	60	74.8 Å²	74.8	42%	0.42	45%	0.454	S	S	.	.	H	α-helix	trans	-61.8	-39.9	175.6	-65.4	0	0	0	0	112	P110 A111 K117 F118	P110-S114 WeakPolarHBondContact O-CB 3.45Å; P110-S114 PolarHBondContact O-N 2.97Å; P110-S114 PolarHBondContact O-OG 2.87Å; P110-S114 VanDerWaalsContact O-OG 3.06Å; A111-S114 PolarHBondContact O-N 3.16Å; S114-K117 PolarHBondContact O-N 3.42Å; S114-F118 WeakPolarHBondContact O-CB 3.17Å; S114-F118 PolarHBondContact O-N 3.48Å
115	L	94.6	Very high	94.7	Very high	113 Å²	113	69.6 Å²	69.6	59%	0.592	43%	0.433	S	S	*	.	H	α-helix	trans	-65.2	-41.2	175.9	-176.6	61.9	0	0	0	111.9	A111 L112 L113 F118 G119	A111-L115 WeakPolarHBondContact O-CB 3.21Å; A111-L115 PolarHBondContact O-N 3.15Å; L112-L115 PolarHBondContact O-N 3.09Å; L113-L115 VanDerWaalsContact C-N 3.32Å; L113-L115 PolarHBondContact O-N 3.45Å; L115-F118 PolarHBondContact O-N 3.06Å; L115-G119 PolarHBondContact O-N 3.34Å
116	A	94.4	Very high	94.9	Very high	57 Å²	57	66.2 Å²	66.2	47%	0.471	41%	0.408	S	S	.	.	H	α-helix	trans	-63.6	-45.3	175.4	0	0	0	0	0	111.6	L112 L113 F118 G119 I120	L112-A116 WeakPolarHBondContact O-CB 3.42Å; L112-A116 PolarHBondContact O-N 3.17Å; L113-A116 PolarHBondContact O-N 3.32Å; A116-F118 VanDerWaalsContact C-N 3.31Å; A116-F118 PolarHBondContact O-N 2.96Å; A116-G119 PolarHBondContact O-N 3.49Å; A116-I120 PolarHBondContact O-N 2.88Å
117	K	95	Very high	95.1	Very high	75 Å²	75	63.3 Å²	63.3	33%	0.326	39%	0.392	S	S	.	.	H	α-helix	trans	-58.3	-43.4	173.4	-70.9	-179.5	171.3	-172.7	0	111.1	L113 S114 I120 A121 I167 M170	L113-K117 WeakPolarHBondContact O-CG 3.48Å; L113-K117 PolarHBondContact O-N 3.27Å; S114-K117 PolarHBondContact O-N 3.42Å; K117-I120 PolarHBondContact O-N 3.3Å; K117-A121 WeakPolarHBondContact O-CB 3.39Å; K117-A121 PolarHBondContact O-N 2.9Å; K117-I167 HydrophobicContact CB-CG1 4Å; K117-I167 HydrophobicContact CB-CG2 4Å; K117-I167 HydrophobicContact CD-CG2 4.07Å; K117-M170 PolarHBondContact NZ-O 3.15Å; K117-M170 VanDerWaalsContact NZ-O 3.13Å; K117-M170 PolarHBondContact NZ-OXT 2.96Å
118	F	96.1	Very high	95.6	Very high	64 Å²	64	62.2 Å²	62.2	28%	0.281	38%	0.381	S	S	.	.	H	α-helix	trans	-64.3	-40.9	175.6	-170	-92.6	0	0	0	113.1	S114 L115 A116 I120 A121 F122 I164 I167	S114-F118 WeakPolarHBondContact O-CB 3.17Å; S114-F118 PolarHBondContact O-N 3.48Å; L115-F118 PolarHBondContact O-N 3.06Å; A116-F118 VanDerWaalsContact C-N 3.31Å; A116-F118 PolarHBondContact O-N 2.96Å; F118-I120 PolarHBondContact O-N 2.89Å; F118-A121 PolarHBondContact O-N 2.83Å; F118-F122 HydrophobicContact CD1-CB 4.03Å; F118-F122 HydrophobicContact CE1-CB 3.64Å; F118-F122 HydrophobicContact CE1-CD2 4.12Å; F118-F122 AromaticContact CE1-CG 3.87Å; F118-F122 HydrophobicContact CE1-CG 3.87Å; F118-F122 HydrophobicContact CE2-CB 4.3Å; F118-F122 HydrophobicContact CE2-CD2 4.45Å; F118-F122 HydrophobicContact CZ-CB 3.79Å; F118-F122 AromaticContact CZ-CD2 3.68Å; F118-F122 HydrophobicContact CZ-CD2 3.68Å; F118-F122 AromaticContact CZ-CG 3.89Å; F118-F122 HydrophobicContact CZ-CG 3.89Å; F118-F122 VanDerWaalsContact O-CB 3.29Å; F118-F122 WeakPolarHBondContact O-CB 3.43Å; F118-F122 PolarHBondContact O-N 2.87Å; F118-I164 HydrophobicContact CE2-CG1 4.42Å; F118-I167 HydrophobicContact CB-CD1 3.49Å; F118-I167 VanDerWaalsContact CB-CD1 3.49Å; F118-I167 HydrophobicContact CD2-CD1 3.52Å; F118-I167 HydrophobicContact CG-CD1 3.97Å
119	G	95.5	Very high	95.9	Very high	46 Å²	46	62.1 Å²	62.1	47%	0.474	38%	0.378	S	S	.	.	H	α-helix	trans	-60	-24.5	176.7	0	0	0	0	0	113.6	L115 A116 P123	L115-G119 PolarHBondContact O-N 3.34Å; A116-G119 PolarHBondContact O-N 3.49Å; G119-P123 WeakPolarHBondContact O-CD 3.3Å; G119-P123 WeakPolarHBondContact O-CG 3.2Å
120	I	95.6	Very high	96.2	Very high	123 Å²	123	60.2 Å²	60.2	63%	0.631	36%	0.359	S	S	*	.	H	α-helix	trans	-90.5	-47.4	173.5	-61.1	169.4	0	0	0	110.9	A116 K117 F118 P123 V124	A116-I120 PolarHBondContact O-N 2.88Å; K117-I120 PolarHBondContact O-N 3.3Å; F118-I120 PolarHBondContact O-N 2.89Å; I120-P123 WeakPolarHBondContact O-CD 3.39Å; I120-V124 WeakPolarHBondContact O-CG2 3.41Å
121	A	97.3	Very high	96.5	Very high	14 Å²	14	56 Å²	56	12%	0.116	34%	0.335	C	S	.	.	H	α-helix	trans	-65.9	-41.1	-175.2	0	0	0	0	0	112.9	K117 F118 V124 S125 S163 A166 I167	K117-A121 WeakPolarHBondContact O-CB 3.39Å; K117-A121 PolarHBondContact O-N 2.9Å; F118-A121 PolarHBondContact O-N 2.83Å; A121-V124 PolarHBondContact O-N 3.47Å; A121-S125 PolarHBondContact O-N 2.91Å; A121-S125 PolarHBondContact O-OG 3.35Å; A121-S163 PolarHBondContact O-OG 2.99Å; A121-A166 HydrophobicContact CB-CB 4.41Å; A121-I167 HydrophobicContact CB-CD1 4.46Å; A121-I167 HydrophobicContact CB-CG1 4.22Å
122	F	98.1	Very high	96.8	Very high	53 Å²	53	56 Å²	56	23%	0.232	32%	0.322	C	S	.	.	H	α-helix	trans	-64.9	-48.8	-175.3	179.7	-94.8	0	0	0	114.2	F118 V124 S125 Y126 I160 S163	F118-F122 HydrophobicContact CD1-CB 4.03Å; F118-F122 HydrophobicContact CE1-CB 3.64Å; F118-F122 HydrophobicContact CE1-CD2 4.12Å; F118-F122 AromaticContact CE1-CG 3.87Å; F118-F122 HydrophobicContact CE1-CG 3.87Å; F118-F122 HydrophobicContact CE2-CB 4.3Å; F118-F122 HydrophobicContact CE2-CD2 4.45Å; F118-F122 HydrophobicContact CZ-CB 3.79Å; F118-F122 AromaticContact CZ-CD2 3.68Å; F118-F122 HydrophobicContact CZ-CD2 3.68Å; F118-F122 AromaticContact CZ-CG 3.89Å; F118-F122 HydrophobicContact CZ-CG 3.89Å; F118-F122 VanDerWaalsContact O-CB 3.29Å; F118-F122 WeakPolarHBondContact O-CB 3.43Å; F118-F122 PolarHBondContact O-N 2.87Å; F122-V124 VanDerWaalsContact C-N 3.28Å; F122-V124 PolarHBondContact O-N 2.87Å; F122-S125 PolarHBondContact O-N 3.42Å; F122-Y126 HydrophobicContact CZ-CD2 4.4Å; F122-Y126 HydrophobicContact CZ-CG 4.5Å; F122-Y126 VanDerWaalsContact O-CB 3.23Å; F122-Y126 WeakPolarHBondContact O-CB 3.29Å; F122-Y126 PolarHBondContact O-N 2.86Å; F122-I160 HydrophobicContact CE2-CG1 3.98Å; F122-S163 WeakPolarHBondContact CA-OG 3.42Å; F122-S163 PolarHBondContact N-OG 3.48Å
123	P	98.2	Very high	97	Very high	30 Å²	30	51.5 Å²	51.5	20%	0.195	30%	0.298	C	S	.	.	H	α-helix	trans	-56.4	-40.5	174.3	-28.5	37.1	0	0	0	113.2	T74 L78 G119 I120 H127	T74-P123 HydrophobicContact CG2-CB 3.88Å; L78-P123 HydrophobicContact CD2-CB 4.11Å; L78-P123 HydrophobicContact CG-CB 4.21Å; G119-P123 WeakPolarHBondContact O-CD 3.3Å; G119-P123 WeakPolarHBondContact O-CG 3.2Å; I120-P123 WeakPolarHBondContact O-CD 3.39Å; P123-H127 WeakPolarHBondContact O-CB 3.23Å; P123-H127 PolarHBondContact O-N 2.6Å
124	V	98.1	Very high	97.2	Very high	68 Å²	68	50.6 Å²	50.6	41%	0.412	29%	0.292	S	S	.	.	H	α-helix	trans	-61.8	-58.3	176.5	177.6	0	0	0	0	110.2	L78 I120 A121 F122 Y126 H127 T128	L78-V124 HydrophobicContact CD1-CG2 4.49Å; L78-V124 HydrophobicContact CD2-CB 4.49Å; L78-V124 HydrophobicContact CD2-CG2 3.46Å; L78-V124 VanDerWaalsContact CD2-CG2 3.46Å; I120-V124 WeakPolarHBondContact O-CG2 3.41Å; A121-V124 PolarHBondContact O-N 3.47Å; F122-V124 VanDerWaalsContact C-N 3.28Å; F122-V124 PolarHBondContact O-N 2.87Å; V124-Y126 VanDerWaalsContact C-N 3.33Å; V124-Y126 PolarHBondContact O-N 3.16Å; V124-H127 PolarHBondContact O-N 2.97Å; V124-T128 WeakPolarHBondContact O-CB 3.47Å; V124-T128 PolarHBondContact O-N 3.3Å; V124-T128 PolarHBondContact O-OG1 3.48Å; V124-T128 VanDerWaalsContact O-OG1 3.05Å
125	S	98.3	Very high	97.5	Very high	20 Å²	20	52.9 Å²	52.9	14%	0.14	30%	0.299	C	S	.	.	H	α-helix	trans	-53.3	-50.1	179.5	-75	0	0	0	0	112	A121 F122 L129 T162 S163	A121-S125 PolarHBondContact O-N 2.91Å; A121-S125 PolarHBondContact O-OG 3.35Å; F122-S125 PolarHBondContact O-N 3.42Å; S125-L129 WeakPolarHBondContact O-CB 3.3Å; S125-L129 WeakPolarHBondContact O-CD1 3.28Å; S125-L129 VanDerWaalsContact O-CG 3.25Å; S125-L129 WeakPolarHBondContact O-CG 3.33Å; S125-L129 PolarHBondContact O-N 3.47Å; S125-T162 VanDerWaalsContact CB-OG1 3.29Å; S125-T162 WeakPolarHBondContact CB-OG1 3.32Å; S125-T162 PolarHBondContact OG-OG1 2.91Å; S125-S163 WeakPolarHBondContact CB-OG 3.43Å; S125-S163 PolarHBondContact OG-OG 3.24Å
126	Y	98.8	Very high	97.7	Very high	6 Å²	6	52.8 Å²	52.8	2%	0.024	29%	0.294	C	S	.	.	H	α-helix	trans	-65.5	-47.4	-178	177.3	-92.4	0	0	0	112.9	M67 T70 H71 T74 F122 V124 T128 L129 N130 V155 S159	M67-Y126 WeakPolarHBondContact CA-OH 3.28Å; M67-Y126 VanDerWaalsContact CB-OH 3.28Å; M67-Y126 WeakPolarHBondContact CB-OH 3.24Å; M67-Y126 HydrophobicContact CE-CE2 4.02Å; M67-Y126 PolarHBondContact O-OH 3.45Å; T70-Y126 HydrophobicContact CG2-CD1 3.95Å; T70-Y126 HydrophobicContact CG2-CE1 3.51Å; H71-Y126 HydrophobicContact CB-CE1 4.2Å; T74-Y126 HydrophobicContact CG2-CD1 3.91Å; F122-Y126 HydrophobicContact CZ-CD2 4.4Å; F122-Y126 HydrophobicContact CZ-CG 4.5Å; F122-Y126 VanDerWaalsContact O-CB 3.23Å; F122-Y126 WeakPolarHBondContact O-CB 3.29Å; F122-Y126 PolarHBondContact O-N 2.86Å; V124-Y126 VanDerWaalsContact C-N 3.33Å; V124-Y126 PolarHBondContact O-N 3.16Å; Y126-T128 VanDerWaalsContact C-N 3.32Å; Y126-T128 PolarHBondContact O-N 3Å; Y126-L129 PolarHBondContact O-N 3.19Å; Y126-N130 HydrophobicContact CE1-CB 4.26Å; Y126-N130 HydrophobicContact CE2-CB 4.47Å; Y126-N130 VanDerWaalsContact O-CB 3.24Å; Y126-N130 WeakPolarHBondContact O-CB 3.19Å; Y126-N130 PolarHBondContact O-N 3.43Å; Y126-V155 HydrophobicContact CD2-CG1 4.16Å; Y126-V155 HydrophobicContact CE2-CG1 4.03Å; Y126-S159 VanDerWaalsContact CA-OG 3.28Å; Y126-S159 WeakPolarHBondContact CA-OG 3.35Å
127	H	98.8	Very high	97.9	Very high	53 Å²	53	52.4 Å²	52.4	25%	0.245	28%	0.28	C	S	.	.	H	α-helix	trans	-63.3	-42.1	-177.6	-165.9	85.5	0	0	0	111.1	H71 T74 G75 L78 P123 V124 G131	H71-H127 AromaticContact CE1-CD2 3.95Å; H71-H127 AromaticContact CE1-CE1 3.28Å; H71-H127 PolarHBondContact CE1-CE1 2.88Å; H71-H127 AromaticContact CE1-CG 3.89Å; H71-H127 AromaticContact CE1-ND1 3.48Å; H71-H127 PolarHBondContact CE1-ND1 3.45Å; H71-H127 AromaticContact CE1-NE2 3.58Å; H71-H127 PolarHBondContact CE1-O 3.31Å; H71-H127 AromaticContact ND1-CE1 3.58Å; H71-H127 AromaticContact ND1-CG 3.91Å; H71-H127 AromaticContact ND1-ND1 3.35Å; H71-H127 PolarHBondContact ND1-ND1 3.13Å; H71-H127 AromaticContact NE2-CE1 3.76Å; H71-H127 PolarHBondContact O-CE1 3.02Å; H71-H127 VanDerWaalsContact O-CE1 3.22Å; H71-H127 PolarHBondContact O-ND1 3.4Å; T74-H127 WeakPolarHBondContact OG1-CB 3.24Å; T74-H127 PolarHBondContact OG1-ND1 3.27Å; G75-H127 WeakPolarHBondContact CA-CE1 3.34Å; G75-H127 WeakPolarHBondContact CA-ND1 3.28Å; G75-H127 PolarHBondContact N-ND1 3.2Å; G75-H127 VanDerWaalsContact N-ND1 3.19Å; L78-H127 HydrophobicContact CD1-CB 3.75Å; P123-H127 WeakPolarHBondContact O-CB 3.23Å; P123-H127 PolarHBondContact O-N 2.6Å; V124-H127 PolarHBondContact O-N 2.97Å; H127-G131 WeakPolarHBondContact O-CA 3.49Å; H127-G131 PolarHBondContact O-N 2.71Å
128	T	98.6	Very high	98	Very high	81 Å²	81	54.9 Å²	54.9	50%	0.497	30%	0.297	S	S	.	.	H	α-helix	trans	-65.4	-50.3	177.8	-58.6	0	0	0	0	111.9	V124 Y126 G131 I132	V124-T128 WeakPolarHBondContact O-CB 3.47Å; V124-T128 PolarHBondContact O-N 3.3Å; V124-T128 PolarHBondContact O-OG1 3.48Å; V124-T128 VanDerWaalsContact O-OG1 3.05Å; Y126-T128 VanDerWaalsContact C-N 3.32Å; Y126-T128 PolarHBondContact O-N 3Å; T128-G131 PolarHBondContact O-N 2.96Å; T128-I132 WeakPolarHBondContact O-CG1 3.43Å; T128-I132 PolarHBondContact O-N 3.44Å
129	L	98.8	Very high	98.1	Very high	41 Å²	41	55.7 Å²	55.7	22%	0.215	31%	0.311	C	S	.	.	H	α-helix	trans	-67.3	-42.1	-178.1	-69.7	169.7	0	0	0	112.3	S125 Y126 G131 I132 R133 V155 L158	S125-L129 WeakPolarHBondContact O-CB 3.3Å; S125-L129 WeakPolarHBondContact O-CD1 3.28Å; S125-L129 VanDerWaalsContact O-CG 3.25Å; S125-L129 WeakPolarHBondContact O-CG 3.33Å; S125-L129 PolarHBondContact O-N 3.47Å; Y126-L129 PolarHBondContact O-N 3.19Å; L129-G131 VanDerWaalsContact C-N 3.3Å; L129-I132 PolarHBondContact O-N 3.25Å; L129-R133 PolarHBondContact O-N 3.38Å; L129-V155 HydrophobicContact CB-CG1 4.19Å; L129-L158 HydrophobicContact CD1-CB 3.7Å
130	N	98.7	Very high	98.2	Very high	0 Å²	0	56.2 Å²	56.2	0%	0	32%	0.316	C	S	.	.	H	α-helix	trans	-69.4	-32.1	174.6	-162.4	60.8	0	0	0	111.3	M67 H71 Y126 R133 H134 V155	M67-N130 VanDerWaalsContact CE-OD1 3.24Å; M67-N130 WeakPolarHBondContact CE-OD1 3.4Å; H71-N130 WeakPolarHBondContact CB-ND2 3.35Å; Y126-N130 HydrophobicContact CE1-CB 4.26Å; Y126-N130 HydrophobicContact CE2-CB 4.47Å; Y126-N130 VanDerWaalsContact O-CB 3.24Å; Y126-N130 WeakPolarHBondContact O-CB 3.19Å; Y126-N130 PolarHBondContact O-N 3.43Å; N130-R133 WeakPolarHBondContact O-CA 3.28Å; N130-R133 WeakPolarHBondContact O-CB 3.5Å; N130-R133 PolarHBondContact O-N 3.16Å; N130-R133 VanDerWaalsContact O-N 3.16Å; N130-R133 PolarHBondContact OD1-NH1 2.99Å; N130-H134 PolarHBondContact ND2-CD2 3.28Å; N130-H134 VanDerWaalsContact ND2-CD2 3.27Å; N130-H134 PolarHBondContact ND2-NE2 3.32Å; N130-H134 PolarHBondContact O-CD2 3.36Å; N130-H134 PolarHBondContact O-N 3.46Å; N130-V155 HydrophobicContact CB-CG1 3.78Å
131	G	98.6	Very high	98.3	Very high	17 Å²	17	56.2 Å²	56.2	18%	0.175	31%	0.312	C	S	.	.	H	α-helix	trans	-59.5	-44.4	172.2	0	0	0	0	0	112.3	H127 T128 L129 R133 H134 L135	H127-G131 WeakPolarHBondContact O-CA 3.49Å; H127-G131 PolarHBondContact O-N 2.71Å; T128-G131 PolarHBondContact O-N 2.96Å; L129-G131 VanDerWaalsContact C-N 3.3Å; G131-R133 VanDerWaalsContact C-N 3.3Å; G131-R133 PolarHBondContact O-N 2.86Å; G131-H134 WeakPolarHBondContact O-CA 3.31Å; G131-H134 WeakPolarHBondContact O-CB 3.31Å; G131-H134 PolarHBondContact O-N 3.41Å; G131-H134 VanDerWaalsContact O-N 3.07Å; G131-L135 WeakPolarHBondContact O-CG 3.16Å; G131-L135 PolarHBondContact O-N 3.46Å
132	I	98.6	Very high	98.3	Very high	82 Å²	82	56.8 Å²	56.8	42%	0.421	32%	0.319	S	S	.	.	H	α-helix	trans	-57.9	-44.1	172.5	-68.5	163.2	0	0	0	110.9	T128 L129 H134 L135 F136	T128-I132 WeakPolarHBondContact O-CG1 3.43Å; T128-I132 PolarHBondContact O-N 3.44Å; L129-I132 PolarHBondContact O-N 3.25Å; I132-H134 VanDerWaalsContact C-N 3.31Å; I132-H134 PolarHBondContact O-N 3.49Å; I132-L135 PolarHBondContact O-N 2.95Å; I132-F136 HydrophobicContact CG2-CD2 3.93Å; I132-F136 HydrophobicContact CG2-CE2 3.62Å; I132-F136 WeakPolarHBondContact O-CD2 3.36Å; I132-F136 PolarHBondContact O-N 2.94Å
133	R	98.4	Very high	98.2	Very high	12 Å²	12	60.2 Å²	60.2	5%	0.045	33%	0.334	C	S	.	.	H	α-helix	trans	-59.6	-39.7	174.5	173.9	177.9	175.1	-122.1	8.1	112.3	M67 L129 N130 G131 F136 W137 V148 S151 V155	M67-R133 PolarHBondContact SD-NH1 3.35Å; M67-R133 VanDerWaalsContact SD-NH1 3.38Å; L129-R133 PolarHBondContact O-N 3.38Å; N130-R133 WeakPolarHBondContact O-CA 3.28Å; N130-R133 WeakPolarHBondContact O-CB 3.5Å; N130-R133 PolarHBondContact O-N 3.16Å; N130-R133 VanDerWaalsContact O-N 3.16Å; N130-R133 PolarHBondContact OD1-NH1 2.99Å; G131-R133 VanDerWaalsContact C-N 3.3Å; G131-R133 PolarHBondContact O-N 2.86Å; R133-F136 WeakPolarHBondContact O-CB 3.3Å; R133-F136 PolarHBondContact O-N 3.38Å; R133-W137 HydrophobicContact CG-CH2 4.47Å; R133-W137 HydrophobicContact CG-CZ2 4.07Å; R133-W137 VanDerWaalsContact NE-CZ2 3.3Å; R133-W137 VanDerWaalsContact NH2-CZ2 3.32Å; R133-W137 PolarHBondContact O-N 3.02Å; R133-V148 PolarHBondContact NH2-O 3.28Å; R133-S151 PolarHBondContact NE-OG 3.39Å; R133-V155 HydrophobicContact CB-CG2 4.14Å
134	H	98.4	Very high	98.2	Very high	47 Å²	47	65.8 Å²	65.8	22%	0.218	36%	0.355	C	S	.	.	H	α-helix	trans	-63.7	-41.9	173.5	-84.5	-85.8	0	0	0	112.2	H71 N130 G131 I132 F136 W137 D138	H71-H134 AromaticContact CD2-CD2 3.79Å; H71-H134 AromaticContact CD2-NE2 3.71Å; H71-H134 AromaticContact NE2-CD2 3.87Å; N130-H134 PolarHBondContact ND2-CD2 3.28Å; N130-H134 VanDerWaalsContact ND2-CD2 3.27Å; N130-H134 PolarHBondContact ND2-NE2 3.32Å; N130-H134 PolarHBondContact O-CD2 3.36Å; N130-H134 PolarHBondContact O-N 3.46Å; G131-H134 WeakPolarHBondContact O-CA 3.31Å; G131-H134 WeakPolarHBondContact O-CB 3.31Å; G131-H134 PolarHBondContact O-N 3.41Å; G131-H134 VanDerWaalsContact O-N 3.07Å; I132-H134 VanDerWaalsContact C-N 3.31Å; I132-H134 PolarHBondContact O-N 3.49Å; H134-F136 VanDerWaalsContact C-N 3.27Å; H134-F136 PolarHBondContact O-N 2.88Å; H134-W137 AromaticContact CE1-CE3 3.76Å; H134-W137 AromaticContact CE1-CZ3 3.45Å; H134-W137 VanDerWaalsContact CE1-CZ3 3.45Å; H134-W137 WeakPolarHBondContact CE1-CZ3 3.27Å; H134-W137 AromaticContact CG-CE3 3.94Å; H134-W137 AromaticContact ND1-CE3 3.49Å; H134-W137 AromaticContact ND1-CZ3 3.69Å; H134-W137 AromaticContact NE2-CZ3 3.78Å; H134-W137 CarbonylContact O-C 3.58Å; H134-W137 WeakPolarHBondContact O-CA 3.44Å; H134-W137 VanDerWaalsContact O-CB 3.3Å; H134-W137 WeakPolarHBondContact O-CB 3.29Å; H134-W137 PolarHBondContact O-N 2.92Å; H134-D138 PolarHBondContact O-N 3.11Å
135	L	98.6	Very high	98.2	Very high	108 Å²	108	68.2 Å²	68.2	57%	0.565	36%	0.364	S	S	*	.	H	α-helix	trans	-62.9	-32.8	175.9	-65.7	173.8	0	0	0	112.8	G131 I132 D138 S139	G131-L135 WeakPolarHBondContact O-CG 3.16Å; G131-L135 PolarHBondContact O-N 3.46Å; I132-L135 PolarHBondContact O-N 2.95Å; L135-D138 PolarHBondContact O-N 2.99Å; L135-S139 PolarHBondContact O-N 3.21Å; L135-S139 VanDerWaalsContact O-N 3.12Å; L135-S139 PolarHBondContact O-OG 2.64Å
136	F	98.4	Very high	98.2	Very high	111 Å²	111	71.9 Å²	71.9	49%	0.487	39%	0.388	S	S	.	.	H	α-helix	trans	-64.3	-39.9	170	-81.4	-71.3	0	0	0	112.1	I132 R133 H134 S139 G140 K141	I132-F136 HydrophobicContact CG2-CD2 3.93Å; I132-F136 HydrophobicContact CG2-CE2 3.62Å; I132-F136 WeakPolarHBondContact O-CD2 3.36Å; I132-F136 PolarHBondContact O-N 2.94Å; R133-F136 WeakPolarHBondContact O-CB 3.3Å; R133-F136 PolarHBondContact O-N 3.38Å; H134-F136 VanDerWaalsContact C-N 3.27Å; H134-F136 PolarHBondContact O-N 2.88Å; F136-S139 CarbonylContact O-C 3.56Å; F136-S139 WeakPolarHBondContact O-CB 3.28Å; F136-S139 PolarHBondContact O-N 3.45Å; F136-G140 PolarHBondContact O-N 2.93Å; F136-K141 HydrophobicContact CD1-CD 4.09Å; F136-K141 WeakPolarHBondContact O-CB 3.43Å; F136-K141 PolarHBondContact O-N 3.46Å
137	W	98.2	Very high	98.2	Very high	49 Å²	49	74.3 Å²	74.3	19%	0.186	40%	0.399	C	S	.	.	H	α-helix	trans	-64.6	-42.7	173.8	-65.7	-25.4	0	0	0	112	R133 H134 S139 G140 K141 G142 F143 V148	R133-W137 HydrophobicContact CG-CH2 4.47Å; R133-W137 HydrophobicContact CG-CZ2 4.07Å; R133-W137 VanDerWaalsContact NE-CZ2 3.3Å; R133-W137 VanDerWaalsContact NH2-CZ2 3.32Å; R133-W137 PolarHBondContact O-N 3.02Å; H134-W137 AromaticContact CE1-CE3 3.76Å; H134-W137 AromaticContact CE1-CZ3 3.45Å; H134-W137 VanDerWaalsContact CE1-CZ3 3.45Å; H134-W137 WeakPolarHBondContact CE1-CZ3 3.27Å; H134-W137 AromaticContact CG-CE3 3.94Å; H134-W137 AromaticContact ND1-CE3 3.49Å; H134-W137 AromaticContact ND1-CZ3 3.69Å; H134-W137 AromaticContact NE2-CZ3 3.78Å; H134-W137 CarbonylContact O-C 3.58Å; H134-W137 WeakPolarHBondContact O-CA 3.44Å; H134-W137 VanDerWaalsContact O-CB 3.3Å; H134-W137 WeakPolarHBondContact O-CB 3.29Å; H134-W137 PolarHBondContact O-N 2.92Å; W137-S139 PolarHBondContact O-N 2.98Å; W137-S139 VanDerWaalsContact O-N 3.17Å; W137-G140 PolarHBondContact O-N 3.44Å; W137-K141 VanDerWaalsContact CD1-O 3.27Å; W137-G142 PolarHBondContact NE1-O 3.13Å; W137-F143 HydrophobicContact CB-CE1 4.16Å; W137-F143 HydrophobicContact CB-CE2 4.31Å; W137-F143 HydrophobicContact CB-CZ 3.69Å; W137-F143 HydrophobicContact CG-CE1 4.3Å; W137-F143 HydrophobicContact CG-CZ 4.22Å; W137-F143 WeakPolarHBondContact O-CE2 3.44Å; W137-F143 WeakPolarHBondContact O-CZ 3.49Å; W137-V148 HydrophobicContact CZ2-CG1 4.23Å
138	D	98.4	Very high	98.1	Very high	128 Å²	128	72.7 Å²	72.7	68%	0.684	39%	0.393	S	S	*	.	H	α-helix	trans	-60.7	-28	175.9	-62.4	-24.9	0	0	0	111.7	H134 L135 G140	H134-D138 PolarHBondContact O-N 3.11Å; L135-D138 PolarHBondContact O-N 2.99Å; D138-G140 VanDerWaalsContact C-N 3.29Å; D138-G140 PolarHBondContact O-N 3.34Å
139	S	98.2	Very high	98.1	Very high	81 Å²	81	72.6 Å²	72.6	57%	0.566	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.9	8	174	-55.4	0	0	0	0	114.4	L135 F136 W137	L135-S139 PolarHBondContact O-N 3.21Å; L135-S139 VanDerWaalsContact O-N 3.12Å; L135-S139 PolarHBondContact O-OG 2.64Å; F136-S139 CarbonylContact O-C 3.56Å; F136-S139 WeakPolarHBondContact O-CB 3.28Å; F136-S139 PolarHBondContact O-N 3.45Å; W137-S139 PolarHBondContact O-N 2.98Å; W137-S139 VanDerWaalsContact O-N 3.17Å
140	G	97.6	Very high	98.1	Very high	57 Å²	57	79 Å²	79	59%	0.588	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.8	11.1	179.1	0	0	0	0	0	115.5	F136 W137 D138	F136-G140 PolarHBondContact O-N 2.93Å; W137-G140 PolarHBondContact O-N 3.44Å; D138-G140 VanDerWaalsContact C-N 3.29Å; D138-G140 PolarHBondContact O-N 3.34Å
141	K	97.7	Very high	98.1	Very high	123 Å²	123	80.6 Å²	80.6	54%	0.535	42%	0.416	S	S	.	.			trans	-108.9	142.9	-170.8	-63.8	172.1	-179.1	173.5	0	112.4	F136 W137	F136-K141 HydrophobicContact CD1-CD 4.09Å; F136-K141 WeakPolarHBondContact O-CB 3.43Å; F136-K141 PolarHBondContact O-N 3.46Å; W137-K141 VanDerWaalsContact CD1-O 3.27Å
142	G	96.1	Very high	98.1	Very high	26 Å²	26	79.8 Å²	79.8	27%	0.268	41%	0.408	S	S	.	.			trans	83.5	27.3	167.6	0	0	0	0	0	115.9	W137 E147 V148	W137-G142 PolarHBondContact NE1-O 3.13Å; G142-E147 VanDerWaalsContact CA-OE2 3.28Å; G142-E147 WeakPolarHBondContact CA-OE2 3.4Å; G142-V148 WeakPolarHBondContact O-CG2 3.47Å
143	F	97.1	Very high	98.1	Very high	124 Å²	124	82.2 Å²	82.2	54%	0.544	41%	0.413	S	S	.	.			trans	-88.1	-11.1	-176.8	-75.2	-77.9	0	0	0	114.8	W137 I145	W137-F143 HydrophobicContact CB-CE1 4.16Å; W137-F143 HydrophobicContact CB-CE2 4.31Å; W137-F143 HydrophobicContact CB-CZ 3.69Å; W137-F143 HydrophobicContact CG-CE1 4.3Å; W137-F143 HydrophobicContact CG-CZ 4.22Å; W137-F143 WeakPolarHBondContact O-CE2 3.44Å; W137-F143 WeakPolarHBondContact O-CZ 3.49Å; F143-I145 PolarHBondContact O-N 3.21Å
144	K	98.1	Very high	98.1	Very high	148 Å²	148	85.2 Å²	85.2	64%	0.643	43%	0.433	S	S	*	.	S	Bend	trans	-65.8	138	175.7	-62.2	-179.2	-178.6	173.6	0	108.8	P146 E147 V148	K144-P146 VanDerWaalsContact C-N 3.33Å; K144-E147 HydrophobicContact CB-CB 4.38Å; K144-E147 HydrophobicContact CB-CG 4.02Å; K144-E147 WeakPolarHBondContact CB-OE2 3.44Å; K144-E147 PolarHBondContact N-OE2 3.18Å; K144-E147 WeakPolarHBondContact O-CA 3.4Å; K144-E147 WeakPolarHBondContact O-CB 3.38Å; K144-E147 PolarHBondContact O-N 2.85Å; K144-V148 PolarHBondContact O-N 3.47Å
145	I	97.9	Very high	98.1	Very high	118 Å²	118	83.5 Å²	83.5	61%	0.605	43%	0.425	S	S	*	.	H	α-helix	trans	-50.4	-46.3	-176.9	-60.9	-60.4	0	0	0	112.7	F143 E147 V148 Y149	F143-I145 PolarHBondContact O-N 3.21Å; I145-E147 VanDerWaalsContact C-N 3.29Å; I145-E147 PolarHBondContact O-N 3.46Å; I145-V148 PolarHBondContact O-N 2.92Å; I145-Y149 HydrophobicContact CG2-CD2 3.93Å; I145-Y149 HydrophobicContact CG2-CE2 3.93Å; I145-Y149 WeakPolarHBondContact O-CD2 3.46Å; I145-Y149 PolarHBondContact O-N 3.05Å
146	P	98.1	Very high	98.1	Very high	97 Å²	97	81 Å²	81	63%	0.63	41%	0.412	S	S	*	.	H	α-helix	trans	-60.1	-36	175.8	-24.4	35.5	0	0	0	113.9	K144 Y149 R150	K144-P146 VanDerWaalsContact C-N 3.33Å; P146-Y149 PolarHBondContact O-N 3.04Å; P146-R150 VanDerWaalsContact O-CB 3.31Å; P146-R150 WeakPolarHBondContact O-CB 3.47Å; P146-R150 PolarHBondContact O-N 3.44Å
147	E	98.1	Very high	98.1	Very high	58 Å²	58	79.5 Å²	79.5	27%	0.271	41%	0.411	S	S	.	.	H	α-helix	trans	-71	-39.6	178.5	-62.7	171.2	166.9	0	0	111.5	G142 K144 I145 Y149 R150 S151	G142-E147 VanDerWaalsContact CA-OE2 3.28Å; G142-E147 WeakPolarHBondContact CA-OE2 3.4Å; K144-E147 HydrophobicContact CB-CB 4.38Å; K144-E147 HydrophobicContact CB-CG 4.02Å; K144-E147 WeakPolarHBondContact CB-OE2 3.44Å; K144-E147 PolarHBondContact N-OE2 3.18Å; K144-E147 WeakPolarHBondContact O-CA 3.4Å; K144-E147 WeakPolarHBondContact O-CB 3.38Å; K144-E147 PolarHBondContact O-N 2.85Å; I145-E147 VanDerWaalsContact C-N 3.29Å; I145-E147 PolarHBondContact O-N 3.46Å; E147-Y149 VanDerWaalsContact C-N 3.29Å; E147-Y149 PolarHBondContact O-N 3.46Å; E147-R150 PolarHBondContact O-N 3.29Å; E147-S151 VanDerWaalsContact O-CB 3.28Å; E147-S151 WeakPolarHBondContact O-CB 3.19Å; E147-S151 PolarHBondContact O-N 2.86Å; E147-S151 PolarHBondContact O-OG 2.93Å
148	V	98.3	Very high	98.1	Very high	18 Å²	18	80.8 Å²	80.8	11%	0.109	42%	0.422	C	S	.	.	H	α-helix	trans	-59	-43.4	173.5	173.7	0	0	0	0	110.2	P64 R133 W137 G142 K144 I145 S151 G152	P64-V148 HydrophobicContact CB-CG1 3.94Å; P64-V148 HydrophobicContact CG-CG1 3.63Å; R133-V148 PolarHBondContact NH2-O 3.28Å; W137-V148 HydrophobicContact CZ2-CG1 4.23Å; G142-V148 WeakPolarHBondContact O-CG2 3.47Å; K144-V148 PolarHBondContact O-N 3.47Å; I145-V148 PolarHBondContact O-N 2.92Å; V148-S151 PolarHBondContact O-OG 2.96Å; V148-S151 VanDerWaalsContact O-OG 3.08Å; V148-G152 PolarHBondContact O-N 3.36Å; V148-G152 VanDerWaalsContact O-N 3.11Å
149	Y	98.6	Very high	98.1	Very high	80 Å²	80	74.7 Å²	74.7	31%	0.314	39%	0.389	S	S	.	.	H	α-helix	trans	-70.1	-46.9	177.2	-85.3	-97	0	0	0	112.5	M63 P64 I145 P146 E147 S151 G152 Y153	M63-Y149 HydrophobicContact CB-CD1 4.43Å; M63-Y149 HydrophobicContact CB-CE1 3.96Å; M63-Y149 HydrophobicContact CE-CD1 3.6Å; M63-Y149 HydrophobicContact CE-CE1 4.23Å; M63-Y149 HydrophobicContact CE-CG 3.99Å; M63-Y149 WeakPolarHBondContact CE-O 3.49Å; P64-Y149 HydrophobicContact CG-CD2 4.46Å; P64-Y149 HydrophobicContact CG-CE2 4.09Å; I145-Y149 HydrophobicContact CG2-CD2 3.93Å; I145-Y149 HydrophobicContact CG2-CE2 3.93Å; I145-Y149 WeakPolarHBondContact O-CD2 3.46Å; I145-Y149 PolarHBondContact O-N 3.05Å; P146-Y149 PolarHBondContact O-N 3.04Å; E147-Y149 VanDerWaalsContact C-N 3.29Å; E147-Y149 PolarHBondContact O-N 3.46Å; Y149-S151 PolarHBondContact O-N 3.33Å; Y149-G152 PolarHBondContact O-N 3.18Å; Y149-G152 VanDerWaalsContact O-N 3.16Å; Y149-Y153 HydrophobicContact CD1-CE2 4.21Å; Y149-Y153 WeakPolarHBondContact O-CD2 3.39Å; Y149-Y153 PolarHBondContact O-N 2.94Å
150	R	98.4	Very high	98.1	Very high	175 Å²	175	74 Å²	74	66%	0.66	38%	0.379	S	S	*	.	H	α-helix	trans	-58.4	-51	178.8	-174.5	-178.8	69.5	-174.8	-0.1	111.6	P146 E147 G152 Y153 V154	P146-R150 VanDerWaalsContact O-CB 3.31Å; P146-R150 WeakPolarHBondContact O-CB 3.47Å; P146-R150 PolarHBondContact O-N 3.44Å; E147-R150 PolarHBondContact O-N 3.29Å; R150-G152 VanDerWaalsContact C-N 3.26Å; R150-G152 PolarHBondContact O-N 3.38Å; R150-Y153 PolarHBondContact O-N 3.12Å; R150-V154 VanDerWaalsContact O-CG2 3.3Å; R150-V154 WeakPolarHBondContact O-CG2 3.25Å; R150-V154 PolarHBondContact O-N 3.25Å
151	S	98.4	Very high	98.1	Very high	33 Å²	33	76.1 Å²	76.1	23%	0.231	38%	0.376	C	S	.	.	H	α-helix	trans	-61.3	-36.1	177.1	57.3	0	0	0	0	111.9	R133 E147 V148 Y149 V154 V155	R133-S151 PolarHBondContact NE-OG 3.39Å; E147-S151 VanDerWaalsContact O-CB 3.28Å; E147-S151 WeakPolarHBondContact O-CB 3.19Å; E147-S151 PolarHBondContact O-N 2.86Å; E147-S151 PolarHBondContact O-OG 2.93Å; V148-S151 PolarHBondContact O-OG 2.96Å; V148-S151 VanDerWaalsContact O-OG 3.08Å; Y149-S151 PolarHBondContact O-N 3.33Å; S151-V154 PolarHBondContact O-N 2.98Å; S151-V155 WeakPolarHBondContact O-CG2 3.34Å; S151-V155 PolarHBondContact O-N 3.45Å
152	G	98.3	Very high	98.1	Very high	0 Å²	0	73 Å²	73	0%	0	37%	0.367	C	S	.	.	H	α-helix	trans	-63.7	-47.9	176.1	0	0	0	0	0	113.3	M67 V148 Y149 R150 V154 V155 I156	M67-G152 WeakPolarHBondContact SD-CA 3.44Å; V148-G152 PolarHBondContact O-N 3.36Å; V148-G152 VanDerWaalsContact O-N 3.11Å; Y149-G152 PolarHBondContact O-N 3.18Å; Y149-G152 VanDerWaalsContact O-N 3.16Å; R150-G152 VanDerWaalsContact C-N 3.26Å; R150-G152 PolarHBondContact O-N 3.38Å; G152-V154 VanDerWaalsContact C-N 3.35Å; G152-V154 PolarHBondContact O-N 3.07Å; G152-V155 PolarHBondContact O-N 3.34Å; G152-I156 WeakPolarHBondContact O-CG1 3.29Å; G152-I156 PolarHBondContact O-N 3.5Å
153	Y	98.6	Very high	98.2	Very high	134 Å²	134	71.8 Å²	71.8	53%	0.525	36%	0.355	S	S	.	.	H	α-helix	trans	-63.1	-40.1	175.7	-70.4	-57.9	0	0	0	112.5	M63 Y149 R150 V155 I156 V157	M63-Y153 HydrophobicContact CE-CE2 4.5Å; Y149-Y153 HydrophobicContact CD1-CE2 4.21Å; Y149-Y153 WeakPolarHBondContact O-CD2 3.39Å; Y149-Y153 PolarHBondContact O-N 2.94Å; R150-Y153 PolarHBondContact O-N 3.12Å; Y153-V155 PolarHBondContact O-N 3.09Å; Y153-I156 PolarHBondContact O-N 2.81Å; Y153-V157 WeakPolarHBondContact O-CG2 3.25Å; Y153-V157 PolarHBondContact O-N 2.94Å
154	V	98.6	Very high	98.2	Very high	75 Å²	75	70.3 Å²	70.3	46%	0.455	35%	0.351	S	S	.	.	H	α-helix	trans	-57.8	-48.6	174.8	168.3	0	0	0	0	110.8	R150 S151 G152 I156 V157 L158	R150-V154 VanDerWaalsContact O-CG2 3.3Å; R150-V154 WeakPolarHBondContact O-CG2 3.25Å; R150-V154 PolarHBondContact O-N 3.25Å; S151-V154 PolarHBondContact O-N 2.98Å; G152-V154 VanDerWaalsContact C-N 3.35Å; G152-V154 PolarHBondContact O-N 3.07Å; V154-I156 PolarHBondContact O-N 3.47Å; V154-V157 PolarHBondContact O-N 3.08Å; V154-L158 HydrophobicContact CG1-CD1 3.64Å; V154-L158 HydrophobicContact CG1-CG 4.25Å; V154-L158 WeakPolarHBondContact O-CB 3.36Å; V154-L158 VanDerWaalsContact O-CG 3.28Å; V154-L158 WeakPolarHBondContact O-CG 3.45Å; V154-L158 PolarHBondContact O-N 3.39Å
155	V	98.7	Very high	98.1	Very high	10 Å²	10	65.2 Å²	65.2	6%	0.061	34%	0.337	C	S	.	.	H	α-helix	trans	-59.1	-46.9	177.2	166.5	0	0	0	0	111.1	M67 Y126 L129 N130 R133 S151 G152 Y153 S159	M67-V155 HydrophobicContact CE-CB 3.79Å; M67-V155 HydrophobicContact CE-CG1 3.63Å; Y126-V155 HydrophobicContact CD2-CG1 4.16Å; Y126-V155 HydrophobicContact CE2-CG1 4.03Å; L129-V155 HydrophobicContact CB-CG1 4.19Å; N130-V155 HydrophobicContact CB-CG1 3.78Å; R133-V155 HydrophobicContact CB-CG2 4.14Å; S151-V155 WeakPolarHBondContact O-CG2 3.34Å; S151-V155 PolarHBondContact O-N 3.45Å; G152-V155 PolarHBondContact O-N 3.34Å; Y153-V155 PolarHBondContact O-N 3.09Å; V155-S159 VanDerWaalsContact O-CB 3.3Å; V155-S159 WeakPolarHBondContact O-CB 3.33Å; V155-S159 PolarHBondContact O-N 3.17Å; V155-S159 PolarHBondContact O-OG 3.02Å
156	I	98.5	Very high	97.9	Very high	56 Å²	56	61.5 Å²	61.5	29%	0.287	32%	0.323	S	S	.	.	H	α-helix	trans	-59.6	-51.1	-179.2	-68.4	165.1	0	0	0	111	M63 M67 G152 Y153 V154 S159 I160	M63-I156 HydrophobicContact CG-CD1 4.48Å; M67-I156 HydrophobicContact CE-CG1 4.26Å; M67-I156 HydrophobicContact CG-CD1 4.47Å; M67-I156 HydrophobicContact SD-CD1 4.31Å; G152-I156 WeakPolarHBondContact O-CG1 3.29Å; G152-I156 PolarHBondContact O-N 3.5Å; Y153-I156 PolarHBondContact O-N 2.81Å; V154-I156 PolarHBondContact O-N 3.47Å; I156-S159 PolarHBondContact O-N 3.33Å; I156-I160 HydrophobicContact CG2-CD1 4.14Å; I156-I160 WeakPolarHBondContact O-CG1 3.23Å; I156-I160 PolarHBondContact O-N 2.99Å; I156-I160 VanDerWaalsContact O-N 3.13Å
157	V	98.6	Very high	97.7	Very high	79 Å²	79	58.1 Å²	58.1	48%	0.479	30%	0.3	S	S	.	.	H	α-helix	trans	-63	-48.8	-178.5	172	0	0	0	0	110.9	Y153 V154 S159 I160 L161	Y153-V157 WeakPolarHBondContact O-CG2 3.25Å; Y153-V157 PolarHBondContact O-N 2.94Å; V154-V157 PolarHBondContact O-N 3.08Å; V157-S159 VanDerWaalsContact C-N 3.27Å; V157-S159 PolarHBondContact O-N 2.74Å; V157-I160 PolarHBondContact O-N 3.21Å; V157-L161 HydrophobicContact CG1-CD1 3.87Å; V157-L161 HydrophobicContact CG1-CG 4.32Å; V157-L161 WeakPolarHBondContact O-CG 3.49Å; V157-L161 PolarHBondContact O-N 3.06Å
158	L	98.6	Very high	97.3	Very high	76 Å²	76	59 Å²	59	40%	0.398	32%	0.317	S	S	.	.	H	α-helix	trans	-63.2	-34.8	179.1	-70.4	179	0	0	0	112.2	L129 V154 L161 T162	L129-L158 HydrophobicContact CD1-CB 3.7Å; V154-L158 HydrophobicContact CG1-CD1 3.64Å; V154-L158 HydrophobicContact CG1-CG 4.25Å; V154-L158 WeakPolarHBondContact O-CB 3.36Å; V154-L158 VanDerWaalsContact O-CG 3.28Å; V154-L158 WeakPolarHBondContact O-CG 3.45Å; V154-L158 PolarHBondContact O-N 3.39Å; L158-L161 PolarHBondContact O-N 3.01Å; L158-T162 WeakPolarHBondContact O-CB 3.28Å; L158-T162 VanDerWaalsContact O-CG2 3.23Å; L158-T162 WeakPolarHBondContact O-CG2 3.21Å; L158-T162 PolarHBondContact O-N 2.94Å; L158-T162 PolarHBondContact O-OG1 2.92Å
159	S	98.4	Very high	96.6	Very high	0 Å²	0	68.1 Å²	68.1	0%	0	35%	0.351	C	S	.	.	H	α-helix	trans	-62.1	-48.9	176.1	-56.1	0	0	0	0	110.5	Y126 V155 I156 V157 L161 T162 S163	Y126-S159 VanDerWaalsContact CA-OG 3.28Å; Y126-S159 WeakPolarHBondContact CA-OG 3.35Å; V155-S159 VanDerWaalsContact O-CB 3.3Å; V155-S159 WeakPolarHBondContact O-CB 3.33Å; V155-S159 PolarHBondContact O-N 3.17Å; V155-S159 PolarHBondContact O-OG 3.02Å; I156-S159 PolarHBondContact O-N 3.33Å; V157-S159 VanDerWaalsContact C-N 3.27Å; V157-S159 PolarHBondContact O-N 2.74Å; S159-L161 PolarHBondContact O-N 3.47Å; S159-T162 PolarHBondContact O-N 3.5Å; S159-T162 PolarHBondContact O-OG1 3.5Å; S159-T162 VanDerWaalsContact O-OG1 3.08Å; S159-S163 WeakPolarHBondContact O-CB 3.27Å; S159-S163 PolarHBondContact O-N 3.49Å; S159-S163 PolarHBondContact O-OG 3.35Å
160	I	98.1	Very high	95.3	Very high	68 Å²	68	71.8 Å²	71.8	35%	0.349	37%	0.373	S	S	.	.	H	α-helix	trans	-61	-48.9	178.4	-65	167.6	0	0	0	110.9	F122 I156 V157 T162 S163 I164	F122-I160 HydrophobicContact CE2-CG1 3.98Å; I156-I160 HydrophobicContact CG2-CD1 4.14Å; I156-I160 WeakPolarHBondContact O-CG1 3.23Å; I156-I160 PolarHBondContact O-N 2.99Å; I156-I160 VanDerWaalsContact O-N 3.13Å; V157-I160 PolarHBondContact O-N 3.21Å; I160-T162 PolarHBondContact O-N 3.5Å; I160-S163 PolarHBondContact O-N 2.98Å; I160-I164 HydrophobicContact CG2-CD1 3.71Å; I160-I164 HydrophobicContact CG2-CG1 4.43Å; I160-I164 WeakPolarHBondContact O-CG1 3.43Å; I160-I164 PolarHBondContact O-N 2.93Å
161	L	98.1	Very high	95.1	Very high	101 Å²	101	66.6 Å²	66.6	53%	0.529	36%	0.358	S	S	.	.	H	α-helix	trans	-62	-46.4	-178.4	-68.9	177	0	0	0	112.2	V157 L158 S159 S163 I164 A165	V157-L161 HydrophobicContact CG1-CD1 3.87Å; V157-L161 HydrophobicContact CG1-CG 4.32Å; V157-L161 WeakPolarHBondContact O-CG 3.49Å; V157-L161 PolarHBondContact O-N 3.06Å; L158-L161 PolarHBondContact O-N 3.01Å; S159-L161 PolarHBondContact O-N 3.47Å; L161-S163 VanDerWaalsContact C-N 3.33Å; L161-S163 PolarHBondContact O-N 3.24Å; L161-I164 PolarHBondContact O-N 3.35Å; L161-A165 WeakPolarHBondContact O-CB 3.37Å; L161-A165 PolarHBondContact O-N 3.4Å
162	T	97.6	Very high	94.9	Very high	58 Å²	58	68.4 Å²	68.4	36%	0.356	37%	0.365	S	S	.	.	H	α-helix	trans	-66.7	-35.1	179.5	54.6	0	0	0	0	111.9	S125 L158 S159 I160 A166	S125-T162 VanDerWaalsContact CB-OG1 3.29Å; S125-T162 WeakPolarHBondContact CB-OG1 3.32Å; S125-T162 PolarHBondContact OG-OG1 2.91Å; L158-T162 WeakPolarHBondContact O-CB 3.28Å; L158-T162 VanDerWaalsContact O-CG2 3.23Å; L158-T162 WeakPolarHBondContact O-CG2 3.21Å; L158-T162 PolarHBondContact O-N 2.94Å; L158-T162 PolarHBondContact O-OG1 2.92Å; S159-T162 PolarHBondContact O-N 3.5Å; S159-T162 PolarHBondContact O-OG1 3.5Å; S159-T162 VanDerWaalsContact O-OG1 3.08Å; I160-T162 PolarHBondContact O-N 3.5Å; T162-A166 WeakPolarHBondContact O-CB 3.12Å; T162-A166 PolarHBondContact O-N 2.68Å
163	S	97.4	Very high	94.8	Very high	0 Å²	0	72.2 Å²	72.2	0%	0	39%	0.385	C	S	.	.	H	α-helix	trans	-69.1	-43.1	175	-56.6	0	0	0	0	112.6	A121 F122 S125 S159 I160 L161 A165 A166 I167	A121-S163 PolarHBondContact O-OG 2.99Å; F122-S163 WeakPolarHBondContact CA-OG 3.42Å; F122-S163 PolarHBondContact N-OG 3.48Å; S125-S163 WeakPolarHBondContact CB-OG 3.43Å; S125-S163 PolarHBondContact OG-OG 3.24Å; S159-S163 WeakPolarHBondContact O-CB 3.27Å; S159-S163 PolarHBondContact O-N 3.49Å; S159-S163 PolarHBondContact O-OG 3.35Å; I160-S163 PolarHBondContact O-N 2.98Å; L161-S163 VanDerWaalsContact C-N 3.33Å; L161-S163 PolarHBondContact O-N 3.24Å; S163-A165 VanDerWaalsContact C-N 3.33Å; S163-A166 PolarHBondContact O-N 3.35Å; S163-I167 VanDerWaalsContact O-CD1 3.25Å; S163-I167 WeakPolarHBondContact O-CD1 3.36Å; S163-I167 WeakPolarHBondContact O-CG1 3.45Å; S163-I167 PolarHBondContact O-N 2.94Å; S163-I167 VanDerWaalsContact O-N 3.09Å
164	I	96.4	Very high	94.5	Very high	93 Å²	93	68.5 Å²	68.5	48%	0.477	38%	0.377	S	S	.	.	H	α-helix	trans	-61.7	-45.5	175.1	-68.9	170	0	0	0	110.1	F118 I160 L161 A166 I167 A168	F118-I164 HydrophobicContact CE2-CG1 4.42Å; I160-I164 HydrophobicContact CG2-CD1 3.71Å; I160-I164 HydrophobicContact CG2-CG1 4.43Å; I160-I164 WeakPolarHBondContact O-CG1 3.43Å; I160-I164 PolarHBondContact O-N 2.93Å; L161-I164 PolarHBondContact O-N 3.35Å; I164-A166 PolarHBondContact O-N 3.13Å; I164-I167 PolarHBondContact O-N 3.35Å; I164-A168 WeakPolarHBondContact O-CB 3.34Å; I164-A168 PolarHBondContact O-N 3.37Å
165	A	95.8	Very high	94.3	Very high	41 Å²	41	68.1 Å²	68.1	34%	0.339	37%	0.372	S	S	.	.	H	α-helix	trans	-58.5	-48.8	176.3	0	0	0	0	0	111.1	L161 S163 I167 A168 Y169	L161-A165 WeakPolarHBondContact O-CB 3.37Å; L161-A165 PolarHBondContact O-N 3.4Å; S163-A165 VanDerWaalsContact C-N 3.33Å; A165-I167 VanDerWaalsContact C-N 3.29Å; A165-I167 PolarHBondContact O-N 3.29Å; A165-A168 PolarHBondContact O-N 3.41Å; A165-A168 VanDerWaalsContact O-N 3.15Å; A165-Y169 HydrophobicContact CB-CE2 4.48Å; A165-Y169 WeakPolarHBondContact O-CD2 3.48Å; A165-Y169 PolarHBondContact O-N 3.25Å
166	A	94.1	Very high	94	Very high	39 Å²	39	72 Å²	72	32%	0.322	39%	0.393	S	S	.	.	H	α-helix	trans	-54.8	-45.5	178.6	0	0	0	0	0	112.1	A121 T162 S163 I164 Y169 M170	A121-A166 HydrophobicContact CB-CB 4.41Å; T162-A166 WeakPolarHBondContact O-CB 3.12Å; T162-A166 PolarHBondContact O-N 2.68Å; S163-A166 PolarHBondContact O-N 3.35Å; I164-A166 PolarHBondContact O-N 3.13Å; A166-Y169 PolarHBondContact O-N 3.29Å; A166-M170 WeakPolarHBondContact O-CB 3.42Å; A166-M170 WeakPolarHBondContact O-CG 3.03Å; A166-M170 PolarHBondContact O-N 2.91Å
167	I	94.1	Very high	93.7	Very high	26 Å²	26	73.1 Å²	73.1	13%	0.133	40%	0.4	C	S	.	.	H	α-helix	trans	-71.3	-33.9	-178.9	-58.8	157.7	0	0	0	111.9	K117 F118 A121 S163 I164 A165 Y169 M170	K117-I167 HydrophobicContact CB-CG1 4Å; K117-I167 HydrophobicContact CB-CG2 4Å; K117-I167 HydrophobicContact CD-CG2 4.07Å; F118-I167 HydrophobicContact CB-CD1 3.49Å; F118-I167 VanDerWaalsContact CB-CD1 3.49Å; F118-I167 HydrophobicContact CD2-CD1 3.52Å; F118-I167 HydrophobicContact CG-CD1 3.97Å; A121-I167 HydrophobicContact CB-CD1 4.46Å; A121-I167 HydrophobicContact CB-CG1 4.22Å; S163-I167 VanDerWaalsContact O-CD1 3.25Å; S163-I167 WeakPolarHBondContact O-CD1 3.36Å; S163-I167 WeakPolarHBondContact O-CG1 3.45Å; S163-I167 PolarHBondContact O-N 2.94Å; S163-I167 VanDerWaalsContact O-N 3.09Å; I164-I167 PolarHBondContact O-N 3.35Å; A165-I167 VanDerWaalsContact C-N 3.29Å; A165-I167 PolarHBondContact O-N 3.29Å; I167-Y169 PolarHBondContact O-N 3.31Å; I167-M170 PolarHBondContact O-N 3.49Å; I167-M170 VanDerWaalsContact O-OXT 3.06Å
168	A	90.1	Very high	93.3	Very high	76 Å²	76	72.7 Å²	72.7	63%	0.628	39%	0.394	S	S	*	.	H	α-helix	trans	-66.3	-26.9	179.2	0	0	0	0	0	112.7	I164 A165	I164-A168 WeakPolarHBondContact O-CB 3.34Å; I164-A168 PolarHBondContact O-N 3.37Å; A165-A168 PolarHBondContact O-N 3.41Å; A165-A168 VanDerWaalsContact O-N 3.15Å
169	Y	83.1	Confident	92.8	Very high	210 Å²	210	72.4 Å²	72.4	82%	0.824	39%	0.394	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100	1.7	178.6	-62.8	-68.2	0	0	0	114	A165 A166 I167	A165-Y169 HydrophobicContact CB-CE2 4.48Å; A165-Y169 WeakPolarHBondContact O-CD2 3.48Å; A165-Y169 PolarHBondContact O-N 3.25Å; A166-Y169 PolarHBondContact O-N 3.29Å; I167-Y169 PolarHBondContact O-N 3.31Å
170	M	71.1	Confident	92.3	Very high	157 Å²	157	79 Å²	79	77%	0.773	43%	0.43	S	S	*	.			trans	-110.9	0	178.4	-74.6	175.1	77.6	0	0	112	K117 A166 I167	K117-M170 PolarHBondContact NZ-O 3.15Å; K117-M170 VanDerWaalsContact NZ-O 3.13Å; K117-M170 PolarHBondContact NZ-OXT 2.96Å; A166-M170 WeakPolarHBondContact O-CB 3.42Å; A166-M170 WeakPolarHBondContact O-CG 3.03Å; A166-M170 PolarHBondContact O-N 2.91Å; I167-M170 PolarHBondContact O-N 3.49Å; I167-M170 VanDerWaalsContact O-OXT 3.06Å

Retrieved 170 of 170 residues in 82.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).