A0A060WN65_ONCMY Loading...

Potassium voltage-gated channel subfamily E member 2

AlphaFold DB , UniProt , Accession A0A060WN65, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110501637, Length 110 aa.

						>A0A060WN65_ONCMY|A0A060WN65|LOC110501637
MLPNWSNMTLHLEDSLTRALGHYLDNWSRNSSKAEQALDNTLAEENFRNVIWYLIVMIGMFAFIVVAILVSTVKSKRREHSNDPYHKYIEEDWTAQLQQQSFVINNPTAN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.7	Very low	73.2	Confident	243 Å²	243	125.1 Å²	125.1	100%	1.197	65%	0.645	S	S	*	*				0	112.1	0	-64.2	172.6	-179.5	0	0	106.3
2	L	53.6	Low	74.9	Confident	176 Å²	176	123.3 Å²	123.3	92%	0.921	64%	0.637	S	S	*	*			trans	-73.9	130.6	-176.2	-74.8	162.2	0	0	0	109.6
3	P	61.1	Low	76.4	Confident	83 Å²	83	122.8 Å²	122.8	54%	0.539	63%	0.63	S	S	.	*			trans	-64.9	134.7	178.9	22.9	-31.5	0	0	0	111.6	W5	P3-W5 HydrophobicContact CB-CG 4.42Å; P3-W5 VanDerWaalsContact CB-NE1 3.32Å; P3-W5 VanDerWaalsContact CG-CD1 3.46Å; P3-W5 PolarHBondContact O-N 2.93Å
4	N	65.6	Low	77.7	Confident	91 Å²	91	119.1 Å²	119.1	49%	0.487	61%	0.612	S	S	.	*			trans	-81.1	58	-175.4	-168.7	-1	0	0	0	111.9	S6 N7	N4-S6 VanDerWaalsContact C-N 3.28Å; N4-S6 PolarHBondContact O-N 3.07Å; N4-S6 PolarHBondContact OD1-OG 2.83Å; N4-N7 PolarHBondContact ND2-ND2 3.17Å; N4-N7 PolarHBondContact O-N 3.44Å; N4-N7 WeakPolarHBondContact OD1-CB 3.48Å; N4-N7 PolarHBondContact OD1-N 2.87Å; N4-N7 PolarHBondContact OD1-ND2 2.78Å; N4-N7 PolarHBondContact OD1-OD1 3.31Å
5	W	70.5	Confident	78.9	Confident	171 Å²	171	115.5 Å²	115.5	65%	0.648	60%	0.601	S	S	*	*	H	α-helix	trans	-63.5	-32.1	-177.4	-69.8	110.4	0	0	0	113.1	P3 N7 M8 T9	P3-W5 HydrophobicContact CB-CG 4.42Å; P3-W5 VanDerWaalsContact CB-NE1 3.32Å; P3-W5 VanDerWaalsContact CG-CD1 3.46Å; P3-W5 PolarHBondContact O-N 2.93Å; W5-N7 VanDerWaalsContact C-N 3.32Å; W5-N7 PolarHBondContact O-N 2.6Å; W5-M8 HydrophobicContact CE3-SD 4.26Å; W5-M8 HydrophobicContact CZ3-SD 4.34Å; W5-M8 PolarHBondContact O-N 2.8Å; W5-T9 PolarHBondContact O-N 3.4Å; W5-T9 PolarHBondContact O-OG1 3.04Å; W5-T9 VanDerWaalsContact O-OG1 3.13Å
6	S	72.2	Confident	79.9	Confident	74 Å²	74	114.7 Å²	114.7	52%	0.517	60%	0.597	S	S	.	*	H	α-helix	trans	-59.5	-42.3	177.5	52	0	0	0	0	112	N4 M8 T9 L10	N4-S6 VanDerWaalsContact C-N 3.28Å; N4-S6 PolarHBondContact O-N 3.07Å; N4-S6 PolarHBondContact OD1-OG 2.83Å; S6-M8 VanDerWaalsContact C-N 3.33Å; S6-M8 PolarHBondContact O-N 3.34Å; S6-T9 PolarHBondContact O-N 3.12Å; S6-L10 WeakPolarHBondContact O-CB 3.47Å; S6-L10 VanDerWaalsContact O-CG 3.27Å; S6-L10 WeakPolarHBondContact O-CG 3.42Å; S6-L10 PolarHBondContact O-N 3.35Å; S6-L10 VanDerWaalsContact O-N 3.07Å
7	N	81.9	Confident	80.9	Confident	94 Å²	94	113.2 Å²	113.2	50%	0.503	60%	0.595	S	S	.	*	H	α-helix	trans	-69.6	-32.2	179.2	-74.6	5.8	0	0	0	112.3	N4 W5 H11	N4-N7 PolarHBondContact ND2-ND2 3.17Å; N4-N7 PolarHBondContact O-N 3.44Å; N4-N7 WeakPolarHBondContact OD1-CB 3.48Å; N4-N7 PolarHBondContact OD1-N 2.87Å; N4-N7 PolarHBondContact OD1-ND2 2.78Å; N4-N7 PolarHBondContact OD1-OD1 3.31Å; W5-N7 VanDerWaalsContact C-N 3.32Å; W5-N7 PolarHBondContact O-N 2.6Å; N7-H11 WeakPolarHBondContact O-CB 3.25Å; N7-H11 PolarHBondContact O-N 2.99Å; N7-H11 VanDerWaalsContact O-N 3.17Å
8	M	84.6	Confident	81.8	Confident	118 Å²	118	115.3 Å²	115.3	58%	0.581	59%	0.593	S	S	*	*	H	α-helix	trans	-69.9	-45.8	174.8	-73	-178.1	170	0	0	111.6	W5 S6 L10 H11 L12	W5-M8 HydrophobicContact CE3-SD 4.26Å; W5-M8 HydrophobicContact CZ3-SD 4.34Å; W5-M8 PolarHBondContact O-N 2.8Å; S6-M8 VanDerWaalsContact C-N 3.33Å; S6-M8 PolarHBondContact O-N 3.34Å; M8-L10 PolarHBondContact O-N 3.25Å; M8-H11 PolarHBondContact O-N 3.41Å; M8-L12 WeakPolarHBondContact O-CB 3.4Å; M8-L12 VanDerWaalsContact O-CG 3.26Å; M8-L12 WeakPolarHBondContact O-CG 3.21Å; M8-L12 PolarHBondContact O-N 3.32Å
9	T	90.4	Very high	82.6	Confident	86 Å²	86	112.3 Å²	112.3	53%	0.528	59%	0.587	S	S	.	*	H	α-helix	trans	-61.3	-44.4	178.7	-56.7	0	0	0	0	111.5	W5 S6 H11 L12 E13	W5-T9 PolarHBondContact O-N 3.4Å; W5-T9 PolarHBondContact O-OG1 3.04Å; W5-T9 VanDerWaalsContact O-OG1 3.13Å; S6-T9 PolarHBondContact O-N 3.12Å; T9-H11 PolarHBondContact O-N 3.04Å; T9-L12 PolarHBondContact O-N 3.49Å; T9-E13 WeakPolarHBondContact O-CB 3.47Å; T9-E13 PolarHBondContact O-N 3.05Å
10	L	87.8	Confident	83.3	Confident	106 Å²	106	111.9 Å²	111.9	56%	0.555	59%	0.585	S	S	*	*	H	α-helix	trans	-63.1	-41.1	177.7	-71.1	170.3	0	0	0	112.3	S6 M8 E13 D14	S6-L10 WeakPolarHBondContact O-CB 3.47Å; S6-L10 VanDerWaalsContact O-CG 3.27Å; S6-L10 WeakPolarHBondContact O-CG 3.42Å; S6-L10 PolarHBondContact O-N 3.35Å; S6-L10 VanDerWaalsContact O-N 3.07Å; M8-L10 PolarHBondContact O-N 3.25Å; L10-E13 PolarHBondContact O-N 2.99Å; L10-D14 PolarHBondContact O-N 2.88Å
11	H	91.4	Very high	84	Confident	134 Å²	134	107.9 Å²	107.9	62%	0.62	57%	0.571	S	S	*	*	H	α-helix	trans	-69.7	-35.5	178	-169.5	-94.5	0	0	0	112.3	N7 M8 T9 S15	N7-H11 WeakPolarHBondContact O-CB 3.25Å; N7-H11 PolarHBondContact O-N 2.99Å; N7-H11 VanDerWaalsContact O-N 3.17Å; M8-H11 PolarHBondContact O-N 3.41Å; T9-H11 PolarHBondContact O-N 3.04Å; H11-S15 VanDerWaalsContact O-CB 3.31Å; H11-S15 WeakPolarHBondContact O-CB 3.34Å; H11-S15 PolarHBondContact O-N 3.37Å
12	L	93.8	Very high	86.4	Confident	104 Å²	104	102.1 Å²	102.1	55%	0.545	54%	0.541	S	S	.	.	H	α-helix	trans	-65.8	-43.5	173.6	-75.1	167.9	0	0	0	111.4	M8 T9 S15 L16	M8-L12 WeakPolarHBondContact O-CB 3.4Å; M8-L12 VanDerWaalsContact O-CG 3.26Å; M8-L12 WeakPolarHBondContact O-CG 3.21Å; M8-L12 PolarHBondContact O-N 3.32Å; T9-L12 PolarHBondContact O-N 3.49Å; L12-S15 PolarHBondContact O-N 3.28Å; L12-L16 VanDerWaalsContact O-CB 3.32Å; L12-L16 WeakPolarHBondContact O-CB 3.45Å; L12-L16 VanDerWaalsContact O-CG 3.23Å; L12-L16 WeakPolarHBondContact O-CG 3.5Å; L12-L16 PolarHBondContact O-N 3.41Å
13	E	94.7	Very high	88.4	Confident	117 Å²	117	101 Å²	101	55%	0.547	53%	0.526	S	S	.	.	H	α-helix	trans	-59.8	-48.6	176.2	-175.8	-173.7	162.5	0	0	111.6	T9 L10 S15 L16 T17	T9-E13 WeakPolarHBondContact O-CB 3.47Å; T9-E13 PolarHBondContact O-N 3.05Å; L10-E13 PolarHBondContact O-N 2.99Å; E13-S15 PolarHBondContact O-N 2.75Å; E13-L16 PolarHBondContact O-N 3.35Å; E13-T17 VanDerWaalsContact O-CB 3.24Å; E13-T17 WeakPolarHBondContact O-CB 3.5Å; E13-T17 PolarHBondContact O-N 3.09Å; E13-T17 PolarHBondContact O-OG1 2.94Å
14	D	94.7	Very high	90.1	Very high	71 Å²	71	101.6 Å²	101.6	38%	0.38	52%	0.524	S	S	.	.	H	α-helix	trans	-63.2	-43	178.9	-176.2	55.3	0	0	0	111.4	L10 R18	L10-D14 PolarHBondContact O-N 2.88Å; D14-R18 WeakPolarHBondContact O-CB 3.21Å; D14-R18 WeakPolarHBondContact O-CG 3.41Å; D14-R18 PolarHBondContact O-N 3.06Å; D14-R18 IonicContact OD1-CZ 3.28Å; D14-R18 IonicContact OD1-NE 2.99Å; D14-R18 PolarHBondContact OD1-NE 3.42Å; D14-R18 IonicContact OD1-NH2 2.99Å; D14-R18 PolarHBondContact OD1-NH2 3.32Å; D14-R18 IonicContact OD2-CZ 3.75Å; D14-R18 VanDerWaalsContact OD2-CZ 3.28Å; D14-R18 IonicContact OD2-NE 3.04Å; D14-R18 PolarHBondContact OD2-NE 2.99Å; D14-R18 IonicContact OD2-NH2 3.41Å; D14-R18 PolarHBondContact OD2-NH2 3.45Å
15	S	94.8	Very high	91.5	Very high	65 Å²	65	101.4 Å²	101.4	46%	0.455	52%	0.523	S	S	.	.	H	α-helix	trans	-64.5	-44.9	177.9	-179.3	0	0	0	0	112.5	H11 L12 E13 R18 A19	H11-S15 VanDerWaalsContact O-CB 3.31Å; H11-S15 WeakPolarHBondContact O-CB 3.34Å; H11-S15 PolarHBondContact O-N 3.37Å; L12-S15 PolarHBondContact O-N 3.28Å; E13-S15 PolarHBondContact O-N 2.75Å; S15-R18 PolarHBondContact O-N 3.23Å; S15-A19 WeakPolarHBondContact O-CB 3.44Å; S15-A19 PolarHBondContact O-N 3.45Å
16	L	96.2	Very high	92.6	Very high	102 Å²	102	98 Å²	98	53%	0.534	52%	0.517	S	S	.	.	H	α-helix	trans	-67.2	-43.9	179.1	-73.2	171.5	0	0	0	111.5	L12 E13 R18 A19 L20	L12-L16 VanDerWaalsContact O-CB 3.32Å; L12-L16 WeakPolarHBondContact O-CB 3.45Å; L12-L16 VanDerWaalsContact O-CG 3.23Å; L12-L16 WeakPolarHBondContact O-CG 3.5Å; L12-L16 PolarHBondContact O-N 3.41Å; E13-L16 PolarHBondContact O-N 3.35Å; L16-R18 VanDerWaalsContact C-N 3.3Å; L16-R18 PolarHBondContact O-N 2.83Å; L16-A19 PolarHBondContact O-N 2.9Å; L16-L20 VanDerWaalsContact O-CB 3.31Å; L16-L20 WeakPolarHBondContact O-CB 3.38Å; L16-L20 VanDerWaalsContact O-CG 3.29Å; L16-L20 WeakPolarHBondContact O-CG 3.26Å; L16-L20 PolarHBondContact O-N 3.48Å
17	T	97.1	Very high	93.7	Very high	90 Å²	90	102 Å²	102	55%	0.552	52%	0.521	S	S	*	.	H	α-helix	trans	-59.8	-43.6	178.5	-59.4	0	0	0	0	110.9	E13 G21	E13-T17 VanDerWaalsContact O-CB 3.24Å; E13-T17 WeakPolarHBondContact O-CB 3.5Å; E13-T17 PolarHBondContact O-N 3.09Å; E13-T17 PolarHBondContact O-OG1 2.94Å; T17-G21 PolarHBondContact O-N 3.16Å
18	R	96.8	Very high	94.1	Very high	150 Å²	150	100.2 Å²	100.2	57%	0.566	52%	0.516	S	S	*	.	H	α-helix	trans	-66.8	-46	176.8	-70.3	173	-167.9	-130.7	8.4	112.6	D14 S15 L16 G21 H22	D14-R18 WeakPolarHBondContact O-CB 3.21Å; D14-R18 WeakPolarHBondContact O-CG 3.41Å; D14-R18 PolarHBondContact O-N 3.06Å; D14-R18 IonicContact OD1-CZ 3.28Å; D14-R18 IonicContact OD1-NE 2.99Å; D14-R18 PolarHBondContact OD1-NE 3.42Å; D14-R18 IonicContact OD1-NH2 2.99Å; D14-R18 PolarHBondContact OD1-NH2 3.32Å; D14-R18 IonicContact OD2-CZ 3.75Å; D14-R18 VanDerWaalsContact OD2-CZ 3.28Å; D14-R18 IonicContact OD2-NE 3.04Å; D14-R18 PolarHBondContact OD2-NE 2.99Å; D14-R18 IonicContact OD2-NH2 3.41Å; D14-R18 PolarHBondContact OD2-NH2 3.45Å; S15-R18 PolarHBondContact O-N 3.23Å; L16-R18 VanDerWaalsContact C-N 3.3Å; L16-R18 PolarHBondContact O-N 2.83Å; R18-G21 PolarHBondContact O-N 2.84Å; R18-H22 PolarHBondContact O-CD2 3.17Å; R18-H22 PolarHBondContact O-N 3.4Å
19	A	96.9	Very high	94.3	Very high	59 Å²	59	102.6 Å²	102.6	49%	0.488	52%	0.519	S	S	.	.	H	α-helix	trans	-63	-44.7	-179.2	0	0	0	0	0	111.6	S15 L16 Y23	S15-A19 WeakPolarHBondContact O-CB 3.44Å; S15-A19 PolarHBondContact O-N 3.45Å; L16-A19 PolarHBondContact O-N 2.9Å; A19-Y23 WeakPolarHBondContact O-CB 3.46Å; A19-Y23 PolarHBondContact O-N 2.99Å
20	L	96.8	Very high	94.2	Very high	103 Å²	103	104 Å²	104	54%	0.539	52%	0.523	S	S	.	.	H	α-helix	trans	-66.6	-42.7	176.5	-70.3	172.6	0	0	0	111.6	L16 H22 Y23 L24	L16-L20 VanDerWaalsContact O-CB 3.31Å; L16-L20 WeakPolarHBondContact O-CB 3.38Å; L16-L20 VanDerWaalsContact O-CG 3.29Å; L16-L20 WeakPolarHBondContact O-CG 3.26Å; L16-L20 PolarHBondContact O-N 3.48Å; L20-H22 PolarHBondContact O-N 2.85Å; L20-Y23 PolarHBondContact O-N 3.26Å; L20-L24 WeakPolarHBondContact O-CB 3.27Å; L20-L24 VanDerWaalsContact O-CG 3.32Å; L20-L24 WeakPolarHBondContact O-CG 3.36Å; L20-L24 PolarHBondContact O-N 2.96Å
21	G	96.7	Very high	94	Very high	29 Å²	29	100.7 Å²	100.7	30%	0.299	51%	0.509	S	S	.	.	H	α-helix	trans	-56.4	-50.4	175	0	0	0	0	0	111.9	T17 R18 Y23 L24 D25	T17-G21 PolarHBondContact O-N 3.16Å; R18-G21 PolarHBondContact O-N 2.84Å; G21-Y23 PolarHBondContact O-N 3.25Å; G21-L24 PolarHBondContact O-N 2.86Å; G21-D25 WeakPolarHBondContact O-CB 3.47Å; G21-D25 VanDerWaalsContact O-CG 3.29Å; G21-D25 PolarHBondContact O-N 2.91Å
22	H	96.7	Very high	93.6	Very high	121 Å²	121	96.5 Å²	96.5	56%	0.56	49%	0.494	S	S	*	.	H	α-helix	trans	-63.3	-39	177.3	-75.4	-50.7	0	0	0	113.4	R18 L20 N26	R18-H22 PolarHBondContact O-CD2 3.17Å; R18-H22 PolarHBondContact O-N 3.4Å; L20-H22 PolarHBondContact O-N 2.85Å; H22-N26 VanDerWaalsContact O-CB 3.28Å; H22-N26 WeakPolarHBondContact O-CB 3.35Å; H22-N26 PolarHBondContact O-N 3.37Å; H22-N26 PolarHBondContact O-ND2 3.16Å; H22-N26 VanDerWaalsContact O-ND2 3.12Å
23	Y	96.2	Very high	92.9	Very high	152 Å²	152	98.5 Å²	98.5	60%	0.596	50%	0.499	S	S	*	.	H	α-helix	trans	-62.7	-48.4	176.3	174.8	-99.2	0	0	0	111.5	A19 L20 G21 N26 W27	A19-Y23 WeakPolarHBondContact O-CB 3.46Å; A19-Y23 PolarHBondContact O-N 2.99Å; L20-Y23 PolarHBondContact O-N 3.26Å; G21-Y23 PolarHBondContact O-N 3.25Å; Y23-N26 PolarHBondContact O-N 2.91Å; Y23-W27 VanDerWaalsContact O-CB 3.3Å; Y23-W27 WeakPolarHBondContact O-CB 3.34Å; Y23-W27 PolarHBondContact O-N 3.41Å
24	L	95.7	Very high	92.2	Very high	97 Å²	97	95.9 Å²	95.9	51%	0.508	50%	0.498	S	S	.	.	H	α-helix	trans	-66	-40.6	179.9	-69.7	174.2	0	0	0	112	L20 G21 W27 S28	L20-L24 WeakPolarHBondContact O-CB 3.27Å; L20-L24 VanDerWaalsContact O-CG 3.32Å; L20-L24 WeakPolarHBondContact O-CG 3.36Å; L20-L24 PolarHBondContact O-N 2.96Å; G21-L24 PolarHBondContact O-N 2.86Å; L24-W27 PolarHBondContact O-N 3.29Å; L24-S28 VanDerWaalsContact O-CB 3.26Å; L24-S28 WeakPolarHBondContact O-CB 3.21Å; L24-S28 PolarHBondContact O-N 3.11Å
25	D	95.4	Very high	91.3	Very high	86 Å²	86	97.7 Å²	97.7	46%	0.46	50%	0.503	S	S	.	.	H	α-helix	trans	-62.8	-44.4	176.2	-77.9	-15.6	0	0	0	111.7	G21 S28 R29	G21-D25 WeakPolarHBondContact O-CB 3.47Å; G21-D25 VanDerWaalsContact O-CG 3.29Å; G21-D25 PolarHBondContact O-N 2.91Å; D25-S28 PolarHBondContact O-N 2.88Å; D25-R29 WeakPolarHBondContact O-CB 3.48Å; D25-R29 VanDerWaalsContact O-CG 3.27Å; D25-R29 WeakPolarHBondContact O-CG 3.44Å; D25-R29 PolarHBondContact O-N 2.98Å
26	N	94.9	Very high	90.6	Very high	99 Å²	99	100.4 Å²	100.4	53%	0.529	51%	0.509	S	S	.	.	H	α-helix	trans	-67	-41.2	177.9	-73.2	-24.3	0	0	0	111.5	H22 Y23 N30	H22-N26 VanDerWaalsContact O-CB 3.28Å; H22-N26 WeakPolarHBondContact O-CB 3.35Å; H22-N26 PolarHBondContact O-N 3.37Å; H22-N26 PolarHBondContact O-ND2 3.16Å; H22-N26 VanDerWaalsContact O-ND2 3.12Å; Y23-N26 PolarHBondContact O-N 2.91Å; N26-N30 WeakPolarHBondContact O-CB 3.36Å; N26-N30 PolarHBondContact O-N 2.83Å
27	W	93.4	Very high	89.7	Confident	158 Å²	158	98.3 Å²	98.3	60%	0.598	51%	0.506	S	S	*	.	H	α-helix	trans	-61.8	-47.9	175.4	176.3	81.4	0	0	0	111.4	Y23 L24 R29 N30 S31	Y23-W27 VanDerWaalsContact O-CB 3.3Å; Y23-W27 WeakPolarHBondContact O-CB 3.34Å; Y23-W27 PolarHBondContact O-N 3.41Å; L24-W27 PolarHBondContact O-N 3.29Å; W27-R29 PolarHBondContact O-N 3.49Å; W27-N30 PolarHBondContact O-N 3.38Å; W27-N30 VanDerWaalsContact O-N 3.17Å; W27-S31 WeakPolarHBondContact O-CB 3.26Å; W27-S31 PolarHBondContact O-N 3.12Å
28	S	91.7	Very high	88.8	Confident	58 Å²	58	98.6 Å²	98.6	41%	0.406	50%	0.504	S	S	.	.	H	α-helix	trans	-58	-50.3	177.5	175.3	0	0	0	0	111.3	L24 D25 N30 S31 S32	L24-S28 VanDerWaalsContact O-CB 3.26Å; L24-S28 WeakPolarHBondContact O-CB 3.21Å; L24-S28 PolarHBondContact O-N 3.11Å; D25-S28 PolarHBondContact O-N 2.88Å; S28-N30 VanDerWaalsContact C-N 3.28Å; S28-N30 PolarHBondContact O-N 3.4Å; S28-S31 PolarHBondContact O-N 2.98Å; S28-S31 VanDerWaalsContact O-N 3.16Å; S28-S32 PolarHBondContact O-N 3.47Å; S28-S32 PolarHBondContact O-OG 3.48Å; S28-S32 VanDerWaalsContact O-OG 3.11Å
29	R	88.6	Confident	87.6	Confident	168 Å²	168	95.8 Å²	95.8	63%	0.634	50%	0.5	S	S	*	.	H	α-helix	trans	-61.2	-34.4	177.2	-71.7	173.7	-176.8	-178.6	2.9	113.1	D25 W27 K33	D25-R29 WeakPolarHBondContact O-CB 3.48Å; D25-R29 VanDerWaalsContact O-CG 3.27Å; D25-R29 WeakPolarHBondContact O-CG 3.44Å; D25-R29 PolarHBondContact O-N 2.98Å; W27-R29 PolarHBondContact O-N 3.49Å; R29-K33 WeakPolarHBondContact O-CG 3.3Å; R29-K33 PolarHBondContact O-N 3.12Å
30	N	87.1	Confident	86.6	Confident	115 Å²	115	99 Å²	99	62%	0.615	51%	0.51	S	S	*	.	H	α-helix	trans	-71.2	-44.2	175.8	-166.6	-4.9	0	0	0	111	N26 W27 S28 S32 K33 A34	N26-N30 WeakPolarHBondContact O-CB 3.36Å; N26-N30 PolarHBondContact O-N 2.83Å; W27-N30 PolarHBondContact O-N 3.38Å; W27-N30 VanDerWaalsContact O-N 3.17Å; S28-N30 VanDerWaalsContact C-N 3.28Å; S28-N30 PolarHBondContact O-N 3.4Å; N30-S32 PolarHBondContact O-N 3.37Å; N30-K33 PolarHBondContact O-N 3.02Å; N30-A34 PolarHBondContact O-N 3.48Å
31	S	84.4	Confident	85.5	Confident	37 Å²	37	98.1 Å²	98.1	26%	0.259	51%	0.508	S	S	.	.	H	α-helix	trans	-60.1	-45.8	175.8	-163	0	0	0	0	111.7	W27 S28 K33 A34 E35	W27-S31 WeakPolarHBondContact O-CB 3.26Å; W27-S31 PolarHBondContact O-N 3.12Å; S28-S31 PolarHBondContact O-N 2.98Å; S28-S31 VanDerWaalsContact O-N 3.16Å; S31-K33 VanDerWaalsContact C-N 3.27Å; S31-K33 PolarHBondContact O-N 3.37Å; S31-A34 WeakPolarHBondContact O-CB 3.27Å; S31-A34 PolarHBondContact O-N 3.33Å; S31-E35 WeakPolarHBondContact O-CG 3.44Å; S31-E35 PolarHBondContact O-N 2.83Å
32	S	83.6	Confident	84.2	Confident	45 Å²	45	98.8 Å²	98.8	32%	0.315	51%	0.505	S	S	.	.	H	α-helix	trans	-62.5	-31.4	178.9	-58.8	0	0	0	0	113.3	S28 N30 Q36	S28-S32 PolarHBondContact O-N 3.47Å; S28-S32 PolarHBondContact O-OG 3.48Å; S28-S32 VanDerWaalsContact O-OG 3.11Å; N30-S32 PolarHBondContact O-N 3.37Å; S32-Q36 WeakPolarHBondContact O-CB 3.28Å; S32-Q36 WeakPolarHBondContact O-CG 3.34Å; S32-Q36 PolarHBondContact O-N 2.89Å
33	K	79.7	Confident	82.7	Confident	146 Å²	146	95.8 Å²	95.8	64%	0.635	50%	0.501	S	S	*	.	H	α-helix	trans	-69.4	-39.1	174	-74	177.8	-179.2	-177.4	0	111.9	R29 N30 S31 A37	R29-K33 WeakPolarHBondContact O-CG 3.3Å; R29-K33 PolarHBondContact O-N 3.12Å; N30-K33 PolarHBondContact O-N 3.02Å; S31-K33 VanDerWaalsContact C-N 3.27Å; S31-K33 PolarHBondContact O-N 3.37Å; K33-A37 PolarHBondContact O-N 3.34Å; K33-A37 VanDerWaalsContact O-N 3.09Å
34	A	79.2	Confident	81.2	Confident	63 Å²	63	96.6 Å²	96.6	52%	0.521	51%	0.51	S	S	.	.	H	α-helix	trans	-67.1	-41.4	175.7	0	0	0	0	0	111.3	N30 S31 A37 L38	N30-A34 PolarHBondContact O-N 3.48Å; S31-A34 WeakPolarHBondContact O-CB 3.27Å; S31-A34 PolarHBondContact O-N 3.33Å; A34-A37 PolarHBondContact O-N 3.41Å; A34-L38 WeakPolarHBondContact O-CB 3.39Å; A34-L38 PolarHBondContact O-N 3.26Å
35	E	76.7	Confident	79.8	Confident	108 Å²	108	97.1 Å²	97.1	51%	0.505	51%	0.51	S	S	.	.	H	α-helix	trans	-61.5	-47	173.5	-73.4	172.5	179.4	0	0	111.6	S31 A37 L38 D39	S31-E35 WeakPolarHBondContact O-CG 3.44Å; S31-E35 PolarHBondContact O-N 2.83Å; E35-A37 VanDerWaalsContact C-N 3.31Å; E35-A37 PolarHBondContact O-N 3Å; E35-L38 CarbonylContact O-C 3.56Å; E35-L38 WeakPolarHBondContact O-CB 3.41Å; E35-L38 PolarHBondContact O-N 3.48Å; E35-L38 VanDerWaalsContact O-N 3.12Å; E35-D39 WeakPolarHBondContact O-CB 3.25Å; E35-D39 PolarHBondContact O-N 3.39Å
36	Q	78.4	Confident	78.3	Confident	122 Å²	122	98.2 Å²	98.2	57%	0.57	52%	0.516	S	S	*	.	H	α-helix	trans	-60.7	-38.2	176.7	-76.2	172.2	3.4	0	0	113.1	S32 L38 N40	S32-Q36 WeakPolarHBondContact O-CB 3.28Å; S32-Q36 WeakPolarHBondContact O-CG 3.34Å; S32-Q36 PolarHBondContact O-N 2.89Å; Q36-L38 VanDerWaalsContact C-N 3.34Å; Q36-N40 WeakPolarHBondContact O-CB 3.29Å; Q36-N40 VanDerWaalsContact O-CG 3.3Å; Q36-N40 PolarHBondContact O-N 2.83Å
37	A	78.8	Confident	76.9	Confident	58 Å²	58	102 Å²	102	48%	0.479	53%	0.528	S	S	.	.	H	α-helix	trans	-66.7	-37.8	175.8	0	0	0	0	0	111.8	K33 A34 E35 T41	K33-A37 PolarHBondContact O-N 3.34Å; K33-A37 VanDerWaalsContact O-N 3.09Å; A34-A37 PolarHBondContact O-N 3.41Å; E35-A37 VanDerWaalsContact C-N 3.31Å; E35-A37 PolarHBondContact O-N 3Å; A37-T41 WeakPolarHBondContact O-CG2 3.32Å; A37-T41 PolarHBondContact O-N 3.22Å
38	L	77.1	Confident	75.6	Confident	96 Å²	96	101.2 Å²	101.2	50%	0.503	53%	0.525	S	S	.	.	H	α-helix	trans	-71.9	-40.6	175.3	-175.6	66.4	0	0	0	112	A34 E35 Q36 N40 T41 L42	A34-L38 WeakPolarHBondContact O-CB 3.39Å; A34-L38 PolarHBondContact O-N 3.26Å; E35-L38 CarbonylContact O-C 3.56Å; E35-L38 WeakPolarHBondContact O-CB 3.41Å; E35-L38 PolarHBondContact O-N 3.48Å; E35-L38 VanDerWaalsContact O-N 3.12Å; Q36-L38 VanDerWaalsContact C-N 3.34Å; L38-N40 VanDerWaalsContact C-N 3.31Å; L38-N40 PolarHBondContact O-N 2.89Å; L38-T41 PolarHBondContact O-N 3.42Å; L38-T41 VanDerWaalsContact O-N 3.17Å; L38-T41 PolarHBondContact O-OG1 2.98Å; L38-L42 HydrophobicContact CD1-CD1 4.19Å; L38-L42 HydrophobicContact CD1-CG 4.26Å; L38-L42 HydrophobicContact CD2-CD1 4.27Å; L38-L42 HydrophobicContact CG-CD1 3.77Å; L38-L42 HydrophobicContact CG-CG 4.23Å; L38-L42 WeakPolarHBondContact O-CB 3.44Å; L38-L42 VanDerWaalsContact O-CG 3.25Å; L38-L42 WeakPolarHBondContact O-CG 3.37Å; L38-L42 PolarHBondContact O-N 2.95Å
39	D	72.8	Confident	74.7	Confident	92 Å²	92	103 Å²	103	49%	0.492	53%	0.529	S	S	.	.	H	α-helix	trans	-63.1	-39.2	176.7	-83.8	-9.8	0	0	0	111.2	E35 T41 L42 A43	E35-D39 WeakPolarHBondContact O-CB 3.25Å; E35-D39 PolarHBondContact O-N 3.39Å; D39-T41 VanDerWaalsContact C-N 3.3Å; D39-T41 PolarHBondContact O-N 2.93Å; D39-L42 PolarHBondContact O-N 3.5Å; D39-A43 WeakPolarHBondContact O-CB 3.4Å; D39-A43 PolarHBondContact O-N 2.93Å
40	N	74.6	Confident	74.3	Confident	127 Å²	127	99 Å²	99	68%	0.679	52%	0.524	S	S	*	.	H	α-helix	trans	-62.9	-35.1	174.6	-77.3	-13.8	0	0	0	112.7	Q36 L38	Q36-N40 WeakPolarHBondContact O-CB 3.29Å; Q36-N40 VanDerWaalsContact O-CG 3.3Å; Q36-N40 PolarHBondContact O-N 2.83Å; L38-N40 VanDerWaalsContact C-N 3.31Å; L38-N40 PolarHBondContact O-N 2.89Å
41	T	73.3	Confident	74.1	Confident	84 Å²	84	98.3 Å²	98.3	52%	0.515	52%	0.519	S	S	.	.	H	α-helix	trans	-78	-34.6	176	60.1	0	0	0	0	112	A37 L38 D39 E44	A37-T41 WeakPolarHBondContact O-CG2 3.32Å; A37-T41 PolarHBondContact O-N 3.22Å; L38-T41 PolarHBondContact O-N 3.42Å; L38-T41 VanDerWaalsContact O-N 3.17Å; L38-T41 PolarHBondContact O-OG1 2.98Å; D39-T41 VanDerWaalsContact C-N 3.3Å; D39-T41 PolarHBondContact O-N 2.93Å; T41-E44 WeakPolarHBondContact O-CB 3.35Å
42	L	69.9	Low	74.2	Confident	43 Å²	43	104.1 Å²	104.1	23%	0.225	54%	0.535	C	S	.	.	H	α-helix	trans	-78.4	-26.4	178.8	-68.2	176.9	0	0	0	113.5	L38 D39 E44 E45 N46	L38-L42 HydrophobicContact CD1-CD1 4.19Å; L38-L42 HydrophobicContact CD1-CG 4.26Å; L38-L42 HydrophobicContact CD2-CD1 4.27Å; L38-L42 HydrophobicContact CG-CD1 3.77Å; L38-L42 HydrophobicContact CG-CG 4.23Å; L38-L42 WeakPolarHBondContact O-CB 3.44Å; L38-L42 VanDerWaalsContact O-CG 3.25Å; L38-L42 WeakPolarHBondContact O-CG 3.37Å; L38-L42 PolarHBondContact O-N 2.95Å; D39-L42 PolarHBondContact O-N 3.5Å; L42-E44 PolarHBondContact O-N 3.46Å; L42-E45 CarbonylContact O-C 3.54Å; L42-E45 WeakPolarHBondContact O-CA 3.35Å; L42-E45 PolarHBondContact O-N 3.29Å; L42-N46 PolarHBondContact O-N 2.68Å
43	A	65.4	Low	74.4	Confident	57 Å²	57	109.4 Å²	109.4	47%	0.471	55%	0.55	S	S	.	.	H	α-helix	trans	-62.1	-27.2	172.1	0	0	0	0	0	112	D39 E45 N46	D39-A43 WeakPolarHBondContact O-CB 3.4Å; D39-A43 PolarHBondContact O-N 2.93Å; A43-E45 VanDerWaalsContact C-N 3.31Å; A43-N46 PolarHBondContact O-ND2 2.91Å
44	E	65.4	Low	74.9	Confident	169 Å²	169	106.1 Å²	106.1	79%	0.79	54%	0.539	S	S	*	.	H	α-helix	trans	-69.6	-30	170.4	-165.2	64.5	-158.7	0	0	111.5	T41 L42	T41-E44 WeakPolarHBondContact O-CB 3.35Å; L42-E44 PolarHBondContact O-N 3.46Å
45	E	64.8	Low	75.6	Confident	108 Å²	108	107.6 Å²	107.6	51%	0.505	54%	0.537	S	S	.	.	H	α-helix	trans	-99.4	-4.6	-173.9	-68.1	-162	163.7	0	0	116	L42 A43 F47 R48	L42-E45 CarbonylContact O-C 3.54Å; L42-E45 WeakPolarHBondContact O-CA 3.35Å; L42-E45 PolarHBondContact O-N 3.29Å; A43-E45 VanDerWaalsContact C-N 3.31Å; E45-F47 PolarHBondContact O-N 2.9Å; E45-R48 IonicContact OE2-NE 2.87Å
46	N	64.4	Low	76.4	Confident	110 Å²	110	107 Å²	107	59%	0.588	54%	0.54	S	S	*	.	T	Hydrogen-bonded Turn	trans	31	-43.8	174.8	-84.3	-68.9	0	0	0	121.1	L42 A43	L42-N46 PolarHBondContact O-N 2.68Å; A43-N46 PolarHBondContact O-ND2 2.91Å
47	F	65.1	Low	77.1	Confident	178 Å²	178	105.6 Å²	105.6	78%	0.781	54%	0.535	S	S	*	.	H	α-helix	trans	-70.5	-30.9	-176.7	-60.1	-74.1	0	0	0	114.3	E45	E45-F47 PolarHBondContact O-N 2.9Å
48	R	66.3	Low	77.9	Confident	142 Å²	142	107.6 Å²	107.6	54%	0.536	54%	0.536	S	S	.	.	H	α-helix	trans	-72.2	-34	-176.9	-169.6	179.9	-63	-84.4	-0.3	113.1	E45 I51 W52	E45-R48 IonicContact OE2-NE 2.87Å; R48-I51 PolarHBondContact O-N 3.31Å; R48-W52 PolarHBondContact O-N 3.14Å
49	N	73.4	Confident	78.8	Confident	94 Å²	94	104.9 Å²	104.9	50%	0.503	53%	0.531	S	S	.	.	H	α-helix	trans	-66.6	-41.8	-178.1	-166.2	-13.3	0	0	0	111.5	I51 W52 Y53	N49-I51 VanDerWaalsContact C-N 3.28Å; N49-I51 PolarHBondContact O-N 2.97Å; N49-W52 PolarHBondContact O-N 3.45Å; N49-Y53 PolarHBondContact O-N 3.39Å
50	V	79	Confident	80	Confident	86 Å²	86	106.6 Å²	106.6	52%	0.521	54%	0.538	S	S	.	.	H	α-helix	trans	-59.9	-38.1	178.4	-178.3	0	0	0	0	112.1	L54	V50-L54 HydrophobicContact CG1-CD1 4.14Å; V50-L54 PolarHBondContact O-N 2.88Å
51	I	84.3	Confident	81	Confident	99 Å²	99	107.6 Å²	107.6	51%	0.508	54%	0.537	S	S	.	.	H	α-helix	trans	-68.3	-45.2	179.9	-64.1	162.4	0	0	0	110.8	R48 N49 Y53 L54 I55	R48-I51 PolarHBondContact O-N 3.31Å; N49-I51 VanDerWaalsContact C-N 3.28Å; N49-I51 PolarHBondContact O-N 2.97Å; I51-Y53 VanDerWaalsContact C-N 3.35Å; I51-Y53 PolarHBondContact O-N 3.4Å; I51-L54 PolarHBondContact O-N 3.06Å; I51-I55 HydrophobicContact CG2-CD1 3.9Å; I51-I55 WeakPolarHBondContact O-CG1 3.21Å; I51-I55 PolarHBondContact O-N 3.5Å
52	W	86.3	Confident	82.1	Confident	159 Å²	159	105.8 Å²	105.8	60%	0.602	53%	0.531	S	S	*	.	H	α-helix	trans	-62	-42.9	176.1	-81.9	114.3	0	0	0	112.2	R48 N49 L54 I55 V56	R48-W52 PolarHBondContact O-N 3.14Å; N49-W52 PolarHBondContact O-N 3.45Å; W52-L54 PolarHBondContact O-N 2.89Å; W52-I55 PolarHBondContact O-N 2.91Å; W52-V56 WeakPolarHBondContact O-CG2 3.44Å; W52-V56 PolarHBondContact O-N 2.81Å
53	Y	87.2	Confident	83.5	Confident	157 Å²	157	111.1 Å²	111.1	62%	0.616	55%	0.552	S	S	*	*	H	α-helix	trans	-57.6	-47	175	177.2	-98.4	0	0	0	112.1	N49 I51 V56 M57	N49-Y53 PolarHBondContact O-N 3.39Å; I51-Y53 VanDerWaalsContact C-N 3.35Å; I51-Y53 PolarHBondContact O-N 3.4Å; Y53-V56 PolarHBondContact O-N 2.79Å; Y53-M57 HydrophobicContact CE1-SD 4.32Å; Y53-M57 VanDerWaalsContact O-CB 3.27Å; Y53-M57 WeakPolarHBondContact O-CB 3.5Å; Y53-M57 PolarHBondContact O-N 3.48Å
54	L	89.9	Confident	84.9	Confident	77 Å²	77	112 Å²	112	40%	0.403	55%	0.548	S	S	.	.	H	α-helix	trans	-62.8	-43.8	177.4	-87.4	158.5	0	0	0	112.7	V50 I51 W52 M57 I58	V50-L54 HydrophobicContact CG1-CD1 4.14Å; V50-L54 PolarHBondContact O-N 2.88Å; I51-L54 PolarHBondContact O-N 3.06Å; W52-L54 PolarHBondContact O-N 2.89Å; L54-M57 HydrophobicContact CD2-CE 4.06Å; L54-M57 PolarHBondContact O-N 3.48Å; L54-I58 HydrophobicContact CD2-CD1 4.38Å; L54-I58 WeakPolarHBondContact O-CB 3.29Å; L54-I58 VanDerWaalsContact O-CG1 3.26Å; L54-I58 WeakPolarHBondContact O-CG1 3.31Å; L54-I58 PolarHBondContact O-N 2.92Å
55	I	93.9	Very high	86.4	Confident	93 Å²	93	107.6 Å²	107.6	48%	0.477	53%	0.533	S	S	.	.	H	α-helix	trans	-61	-46	177.9	-69.8	168.1	0	0	0	110.6	I51 W52 G59	I51-I55 HydrophobicContact CG2-CD1 3.9Å; I51-I55 WeakPolarHBondContact O-CG1 3.21Å; I51-I55 PolarHBondContact O-N 3.5Å; W52-I55 PolarHBondContact O-N 2.91Å; I55-G59 WeakPolarHBondContact O-CA 3.32Å; I55-G59 PolarHBondContact O-N 3.35Å
56	V	94.3	Very high	88	Confident	95 Å²	95	106.4 Å²	106.4	58%	0.576	53%	0.532	S	S	*	.	H	α-helix	trans	-67.1	-44.4	179.9	173.1	0	0	0	0	111	W52 Y53 G59 M60	W52-V56 WeakPolarHBondContact O-CG2 3.44Å; W52-V56 PolarHBondContact O-N 2.81Å; Y53-V56 PolarHBondContact O-N 2.79Å; V56-G59 PolarHBondContact O-N 2.74Å; V56-M60 WeakPolarHBondContact O-CB 3.35Å; V56-M60 PolarHBondContact O-N 3.43Å
57	M	93	Very high	89.4	Confident	94 Å²	94	103 Å²	103	46%	0.463	52%	0.519	S	S	.	.	H	α-helix	trans	-59.1	-50	178.4	-175.5	-167.2	76.1	0	0	111.4	Y53 L54 F61	Y53-M57 HydrophobicContact CE1-SD 4.32Å; Y53-M57 VanDerWaalsContact O-CB 3.27Å; Y53-M57 WeakPolarHBondContact O-CB 3.5Å; Y53-M57 PolarHBondContact O-N 3.48Å; L54-M57 HydrophobicContact CD2-CE 4.06Å; L54-M57 PolarHBondContact O-N 3.48Å; M57-F61 WeakPolarHBondContact O-CB 3.39Å; M57-F61 PolarHBondContact O-N 3.45Å; M57-F61 VanDerWaalsContact O-N 3.16Å
58	I	95.9	Very high	90.9	Very high	99 Å²	99	99.2 Å²	99.2	51%	0.508	51%	0.507	S	S	.	.	H	α-helix	trans	-68.4	-41	179.9	-65.4	166.9	0	0	0	110.4	L54 F61 A62	L54-I58 HydrophobicContact CD2-CD1 4.38Å; L54-I58 WeakPolarHBondContact O-CB 3.29Å; L54-I58 VanDerWaalsContact O-CG1 3.26Å; L54-I58 WeakPolarHBondContact O-CG1 3.31Å; L54-I58 PolarHBondContact O-N 2.92Å; I58-F61 PolarHBondContact O-N 2.87Å; I58-A62 WeakPolarHBondContact O-CB 3.04Å; I58-A62 PolarHBondContact O-N 3.33Å
59	G	96.4	Very high	92.2	Very high	39 Å²	39	97.4 Å²	97.4	40%	0.402	51%	0.507	S	S	.	.	H	α-helix	trans	-62.1	-47.2	179.2	0	0	0	0	0	112.7	I55 V56 F63	I55-G59 WeakPolarHBondContact O-CA 3.32Å; I55-G59 PolarHBondContact O-N 3.35Å; V56-G59 PolarHBondContact O-N 2.74Å; G59-F63 WeakPolarHBondContact O-CB 3.44Å; G59-F63 PolarHBondContact O-N 2.88Å
60	M	96.1	Very high	93.1	Very high	128 Å²	128	96.5 Å²	96.5	63%	0.631	51%	0.505	S	S	*	.	H	α-helix	trans	-63.5	-43.8	177.6	-168	-160.8	-167.8	0	0	111.1	V56 F63 I64	V56-M60 WeakPolarHBondContact O-CB 3.35Å; V56-M60 PolarHBondContact O-N 3.43Å; M60-F63 PolarHBondContact O-N 3.01Å; M60-I64 HydrophobicContact CE-CD1 4.23Å; M60-I64 HydrophobicContact CG-CD1 4.04Å; M60-I64 VanDerWaalsContact O-CG1 3.29Å; M60-I64 WeakPolarHBondContact O-CG1 3.25Å; M60-I64 PolarHBondContact O-N 2.99Å; M60-I64 HydrophobicContact SD-CD1 4.44Å
61	F	96.6	Very high	93.7	Very high	148 Å²	148	96 Å²	96	65%	0.649	51%	0.505	S	S	*	.	H	α-helix	trans	-61.9	-50.6	178.5	179.6	-102.2	0	0	0	112	M57 I58 F63 I64 V65	M57-F61 WeakPolarHBondContact O-CB 3.39Å; M57-F61 PolarHBondContact O-N 3.45Å; M57-F61 VanDerWaalsContact O-N 3.16Å; I58-F61 PolarHBondContact O-N 2.87Å; F61-F63 VanDerWaalsContact C-N 3.31Å; F61-F63 PolarHBondContact O-N 3.48Å; F61-I64 PolarHBondContact O-N 2.89Å; F61-V65 HydrophobicContact CE1-CG2 4.21Å; F61-V65 HydrophobicContact CE2-CG2 4.39Å; F61-V65 HydrophobicContact CZ-CG2 4.11Å; F61-V65 WeakPolarHBondContact O-CG2 3.35Å; F61-V65 PolarHBondContact O-N 2.99Å; F61-V65 VanDerWaalsContact O-N 3.12Å
62	A	97.2	Very high	93.9	Very high	47 Å²	47	95 Å²	95	39%	0.388	50%	0.503	S	S	.	.	H	α-helix	trans	-61	-41.2	177.9	0	0	0	0	0	111.8	I58 V65 V66	I58-A62 WeakPolarHBondContact O-CB 3.04Å; I58-A62 PolarHBondContact O-N 3.33Å; A62-V65 PolarHBondContact O-N 3.41Å; A62-V66 WeakPolarHBondContact O-CG2 3.25Å; A62-V66 PolarHBondContact O-N 3.12Å
63	F	97.6	Very high	93.9	Very high	154 Å²	154	92 Å²	92	68%	0.675	50%	0.502	S	S	*	.	H	α-helix	trans	-61	-46.2	177.8	-179.1	-100.6	0	0	0	112.1	G59 M60 F61 V65 V66 A67	G59-F63 WeakPolarHBondContact O-CB 3.44Å; G59-F63 PolarHBondContact O-N 2.88Å; M60-F63 PolarHBondContact O-N 3.01Å; F61-F63 VanDerWaalsContact C-N 3.31Å; F61-F63 PolarHBondContact O-N 3.48Å; F63-V65 PolarHBondContact O-N 2.87Å; F63-V66 PolarHBondContact O-N 3.03Å; F63-A67 VanDerWaalsContact O-CB 3.25Å; F63-A67 WeakPolarHBondContact O-CB 3.49Å; F63-A67 PolarHBondContact O-N 3.05Å
64	I	96.6	Very high	93.5	Very high	77 Å²	77	90.4 Å²	90.4	40%	0.395	50%	0.499	S	S	.	.	H	α-helix	trans	-61.6	-45.6	178.2	-68.5	165.7	0	0	0	110.8	M60 F61 V66 A67 I68	M60-I64 HydrophobicContact CE-CD1 4.23Å; M60-I64 HydrophobicContact CG-CD1 4.04Å; M60-I64 VanDerWaalsContact O-CG1 3.29Å; M60-I64 WeakPolarHBondContact O-CG1 3.25Å; M60-I64 PolarHBondContact O-N 2.99Å; M60-I64 HydrophobicContact SD-CD1 4.44Å; F61-I64 PolarHBondContact O-N 2.89Å; I64-V66 PolarHBondContact O-N 2.99Å; I64-A67 PolarHBondContact O-N 3.04Å; I64-I68 HydrophobicContact CG2-CD1 3.76Å; I64-I68 HydrophobicContact CG2-CG1 4.42Å; I64-I68 WeakPolarHBondContact O-CG1 3.32Å; I64-I68 PolarHBondContact O-N 3.31Å
65	V	96.8	Very high	92.8	Very high	76 Å²	76	91.4 Å²	91.4	46%	0.461	51%	0.512	S	S	.	.	H	α-helix	trans	-60.3	-47.3	179.1	173.1	0	0	0	0	110.9	F61 A62 F63 I68 L69	F61-V65 HydrophobicContact CE1-CG2 4.21Å; F61-V65 HydrophobicContact CE2-CG2 4.39Å; F61-V65 HydrophobicContact CZ-CG2 4.11Å; F61-V65 WeakPolarHBondContact O-CG2 3.35Å; F61-V65 PolarHBondContact O-N 2.99Å; F61-V65 VanDerWaalsContact O-N 3.12Å; A62-V65 PolarHBondContact O-N 3.41Å; F63-V65 PolarHBondContact O-N 2.87Å; V65-I68 PolarHBondContact O-N 3.08Å; V65-L69 WeakPolarHBondContact O-CB 3.21Å; V65-L69 PolarHBondContact O-N 3.48Å
66	V	96.8	Very high	91.5	Very high	82 Å²	82	95.9 Å²	95.9	50%	0.497	53%	0.528	S	S	.	.	H	α-helix	trans	-65.2	-41	177.9	173.1	0	0	0	0	111.3	A62 F63 I64 I68 L69 V70	A62-V66 WeakPolarHBondContact O-CG2 3.25Å; A62-V66 PolarHBondContact O-N 3.12Å; F63-V66 PolarHBondContact O-N 3.03Å; I64-V66 PolarHBondContact O-N 2.99Å; V66-I68 PolarHBondContact O-N 2.87Å; V66-L69 PolarHBondContact O-N 3.49Å; V66-V70 HydrophobicContact CG1-CG2 4.18Å; V66-V70 WeakPolarHBondContact O-CB 3.38Å; V66-V70 WeakPolarHBondContact O-CG2 3.41Å; V66-V70 PolarHBondContact O-N 3.35Å
67	A	95.6	Very high	90.2	Very high	38 Å²	38	100.8 Å²	100.8	31%	0.314	54%	0.537	S	S	.	.	H	α-helix	trans	-61.8	-45	178.3	0	0	0	0	0	111.8	F63 I64 S71	F63-A67 VanDerWaalsContact O-CB 3.25Å; F63-A67 WeakPolarHBondContact O-CB 3.49Å; F63-A67 PolarHBondContact O-N 3.05Å; I64-A67 PolarHBondContact O-N 3.04Å; A67-S71 WeakPolarHBondContact O-CB 3.39Å; A67-S71 PolarHBondContact O-N 3.42Å; A67-S71 PolarHBondContact O-OG 3.08Å
68	I	94.8	Very high	88.8	Confident	100 Å²	100	106.4 Å²	106.4	51%	0.513	55%	0.552	S	S	.	*	H	α-helix	trans	-63.9	-43.2	174.5	-66.5	169.2	0	0	0	110.1	I64 V65 V66 S71 T72	I64-I68 HydrophobicContact CG2-CD1 3.76Å; I64-I68 HydrophobicContact CG2-CG1 4.42Å; I64-I68 WeakPolarHBondContact O-CG1 3.32Å; I64-I68 PolarHBondContact O-N 3.31Å; V65-I68 PolarHBondContact O-N 3.08Å; V66-I68 PolarHBondContact O-N 2.87Å; I68-S71 PolarHBondContact O-N 2.9Å; I68-T72 HydrophobicContact CG2-CG2 4.11Å; I68-T72 WeakPolarHBondContact O-CB 3.43Å; I68-T72 VanDerWaalsContact O-CG2 3.25Å; I68-T72 WeakPolarHBondContact O-CG2 3.47Å; I68-T72 PolarHBondContact O-N 2.91Å; I68-T72 PolarHBondContact O-OG1 3.3Å
69	L	94.8	Very high	87.2	Confident	104 Å²	104	109 Å²	109	55%	0.545	56%	0.562	S	S	.	*	H	α-helix	trans	-62	-48.6	179.3	-172.9	69.3	0	0	0	111.9	V65 V66 S71 T72 V73	V65-L69 WeakPolarHBondContact O-CB 3.21Å; V65-L69 PolarHBondContact O-N 3.48Å; V66-L69 PolarHBondContact O-N 3.49Å; L69-S71 VanDerWaalsContact C-N 3.32Å; L69-S71 PolarHBondContact O-N 3.28Å; L69-T72 WeakPolarHBondContact CA-OG1 3.24Å; L69-T72 PolarHBondContact O-N 3.43Å; L69-T72 PolarHBondContact O-OG1 3.07Å; L69-V73 WeakPolarHBondContact O-CB 3.4Å; L69-V73 VanDerWaalsContact O-CG2 3.25Å; L69-V73 WeakPolarHBondContact O-CG2 3.42Å; L69-V73 PolarHBondContact O-N 2.9Å
70	V	92.6	Very high	85.5	Confident	75 Å²	75	115 Å²	115	46%	0.455	58%	0.58	S	S	.	*	H	α-helix	trans	-63.3	-41.7	177.3	172.9	0	0	0	0	110.4	V66 V73 K74	V66-V70 HydrophobicContact CG1-CG2 4.18Å; V66-V70 WeakPolarHBondContact O-CB 3.38Å; V66-V70 WeakPolarHBondContact O-CG2 3.41Å; V66-V70 PolarHBondContact O-N 3.35Å; V70-V73 PolarHBondContact O-N 3.46Å; V70-K74 HydrophobicContact CG1-CD 4.12Å; V70-K74 HydrophobicContact CG1-CG 4.33Å; V70-K74 WeakPolarHBondContact O-CB 3.23Å; V70-K74 WeakPolarHBondContact O-CG 3.26Å; V70-K74 PolarHBondContact O-N 3.45Å
71	S	90.4	Very high	83.8	Confident	75 Å²	75	114.5 Å²	114.5	52%	0.524	59%	0.589	S	S	.	*	H	α-helix	trans	-63.7	-42.4	177.9	-60.1	0	0	0	0	111.9	A67 I68 L69 S75	A67-S71 WeakPolarHBondContact O-CB 3.39Å; A67-S71 PolarHBondContact O-N 3.42Å; A67-S71 PolarHBondContact O-OG 3.08Å; I68-S71 PolarHBondContact O-N 2.9Å; L69-S71 VanDerWaalsContact C-N 3.32Å; L69-S71 PolarHBondContact O-N 3.28Å; S71-S75 WeakPolarHBondContact O-CA 3.31Å; S71-S75 WeakPolarHBondContact O-CB 3.3Å; S71-S75 PolarHBondContact O-N 3.45Å
72	T	88.4	Confident	82.2	Confident	77 Å²	77	114.9 Å²	114.9	47%	0.472	60%	0.597	S	S	.	*	H	α-helix	trans	-71.1	-39.4	178.7	52.6	0	0	0	0	112.2	I68 L69 K76	I68-T72 HydrophobicContact CG2-CG2 4.11Å; I68-T72 WeakPolarHBondContact O-CB 3.43Å; I68-T72 VanDerWaalsContact O-CG2 3.25Å; I68-T72 WeakPolarHBondContact O-CG2 3.47Å; I68-T72 PolarHBondContact O-N 2.91Å; I68-T72 PolarHBondContact O-OG1 3.3Å; L69-T72 WeakPolarHBondContact CA-OG1 3.24Å; L69-T72 PolarHBondContact O-N 3.43Å; L69-T72 PolarHBondContact O-OG1 3.07Å; T72-K76 PolarHBondContact O-N 3.3Å; T72-K76 VanDerWaalsContact O-N 3.08Å
73	V	87.3	Confident	80.9	Confident	97 Å²	97	117.1 Å²	117.1	59%	0.588	60%	0.603	S	S	*	*	H	α-helix	trans	-64.3	-46.8	174.4	170.3	0	0	0	0	111.2	L69 V70 K76 R77	L69-V73 WeakPolarHBondContact O-CB 3.4Å; L69-V73 VanDerWaalsContact O-CG2 3.25Å; L69-V73 WeakPolarHBondContact O-CG2 3.42Å; L69-V73 PolarHBondContact O-N 2.9Å; V70-V73 PolarHBondContact O-N 3.46Å; V73-K76 PolarHBondContact O-N 3.07Å; V73-R77 PolarHBondContact O-N 3.46Å
74	K	79.3	Confident	79.6	Confident	123 Å²	123	113.8 Å²	113.8	54%	0.535	60%	0.597	S	S	.	*	H	α-helix	trans	-68.2	-39.8	176.6	-68.4	-170.2	90.1	-167	0	111.8	V70 K76 R77	V70-K74 HydrophobicContact CG1-CD 4.12Å; V70-K74 HydrophobicContact CG1-CG 4.33Å; V70-K74 WeakPolarHBondContact O-CB 3.23Å; V70-K74 WeakPolarHBondContact O-CG 3.26Å; V70-K74 PolarHBondContact O-N 3.45Å; K74-K76 VanDerWaalsContact C-N 3.27Å; K74-K76 PolarHBondContact O-N 2.96Å; K74-R77 CarbonylContact O-C 3.53Å; K74-R77 WeakPolarHBondContact O-CA 3.43Å; K74-R77 VanDerWaalsContact O-CB 3.3Å; K74-R77 WeakPolarHBondContact O-CB 3.28Å; K74-R77 PolarHBondContact O-N 3.24Å; K74-R77 VanDerWaalsContact O-O 3.1Å
75	S	75.4	Confident	77.9	Confident	99 Å²	99	118.1 Å²	118.1	69%	0.692	61%	0.609	S	S	*	*	H	α-helix	trans	-61.2	-35.2	177.8	175.7	0	0	0	0	112.5	S71 R77	S71-S75 WeakPolarHBondContact O-CA 3.31Å; S71-S75 WeakPolarHBondContact O-CB 3.3Å; S71-S75 PolarHBondContact O-N 3.45Å; S75-R77 VanDerWaalsContact C-N 3.26Å; S75-R77 PolarHBondContact O-N 3.47Å
76	K	66.3	Low	76.4	Confident	187 Å²	187	120 Å²	120	81%	0.813	61%	0.613	S	S	*	*	H	α-helix	trans	-70.3	-24.4	175.6	-156.9	175	-173	-172.8	0	112.6	T72 V73 K74 R78	T72-K76 PolarHBondContact O-N 3.3Å; T72-K76 VanDerWaalsContact O-N 3.08Å; V73-K76 PolarHBondContact O-N 3.07Å; K74-K76 VanDerWaalsContact C-N 3.27Å; K74-K76 PolarHBondContact O-N 2.96Å; K76-R78 VanDerWaalsContact C-N 3.35Å; K76-R78 PolarHBondContact O-N 3.17Å; K76-R78 VanDerWaalsContact O-N 3.08Å
77	R	67.4	Low	74.8	Confident	198 Å²	198	123.7 Å²	123.7	75%	0.747	62%	0.622	S	S	*	*	S	Bend	trans	-79	84.6	171.3	-167.2	-179.9	-171.8	-173	0.9	107.9	V73 K74 S75 E79	V73-R77 PolarHBondContact O-N 3.46Å; K74-R77 CarbonylContact O-C 3.53Å; K74-R77 WeakPolarHBondContact O-CA 3.43Å; K74-R77 VanDerWaalsContact O-CB 3.3Å; K74-R77 WeakPolarHBondContact O-CB 3.28Å; K74-R77 PolarHBondContact O-N 3.24Å; K74-R77 VanDerWaalsContact O-O 3.1Å; S75-R77 VanDerWaalsContact C-N 3.26Å; S75-R77 PolarHBondContact O-N 3.47Å; R77-E79 PolarHBondContact O-N 3.36Å
78	R	63.4	Low	73.1	Confident	211 Å²	211	129.5 Å²	129.5	80%	0.796	64%	0.637	S	S	*	*			trans	-49.1	106.6	175.1	-69.1	-176.8	175.6	152.2	-1.3	109.3	K76 H80	K76-R78 VanDerWaalsContact C-N 3.35Å; K76-R78 PolarHBondContact O-N 3.17Å; K76-R78 VanDerWaalsContact O-N 3.08Å; R78-H80 PolarHBondContact O-CE1 3.26Å; R78-H80 VanDerWaalsContact O-CE1 3.25Å; R78-H80 PolarHBondContact O-N 3.36Å; R78-H80 PolarHBondContact O-ND1 2.81Å
79	E	62.6	Low	71.6	Confident	153 Å²	153	129 Å²	129	72%	0.715	63%	0.634	S	S	*	*			trans	-72.4	112.6	170.6	-67.6	-178.8	178.3	0	0	105.6	R77 S81	R77-E79 PolarHBondContact O-N 3.36Å; E79-S81 PolarHBondContact O-N 3.43Å
80	H	59.1	Low	70.1	Confident	167 Å²	167	130.1 Å²	130.1	77%	0.773	64%	0.637	S	S	*	*			trans	-74.8	117.8	-175.6	-63.6	62.5	0	0	0	106.8	R78 N82	R78-H80 PolarHBondContact O-CE1 3.26Å; R78-H80 VanDerWaalsContact O-CE1 3.25Å; R78-H80 PolarHBondContact O-N 3.36Å; R78-H80 PolarHBondContact O-ND1 2.81Å; H80-N82 PolarHBondContact O-N 3.25Å
81	S	61.3	Low	68.5	Low	116 Å²	116	133.2 Å²	133.2	81%	0.811	65%	0.647	S	S	*	*	S	Bend	trans	-60.4	15.9	-173.7	-173.2	0	0	0	0	116.3	E79	E79-S81 PolarHBondContact O-N 3.43Å
82	N	62	Low	67	Low	156 Å²	156	134.1 Å²	134.1	83%	0.834	65%	0.645	S	S	*	*			trans	-102.1	62	176.9	-90.8	-12.1	0	0	0	109.8	H80 P84	H80-N82 PolarHBondContact O-N 3.25Å; N82-P84 WeakPolarHBondContact O-CD 3.36Å
83	D	70.9	Confident	65.8	Low	95 Å²	95	138.2 Å²	138.2	51%	0.508	65%	0.652	S	S	.	*			trans	-84.4	116.8	168.1	84.1	-73.1	0	0	0	109.1	Y85	D83-Y85 PolarHBondContact O-N 3.28Å; D83-Y85 VanDerWaalsContact O-N 3.13Å
84	P	70.3	Confident	64.5	Low	84 Å²	84	138.1 Å²	138.1	55%	0.545	65%	0.652	S	S	.	*	T	Hydrogen-bonded Turn	trans	-71.9	-2.7	-177.7	27.8	-32.9	0	0	0	113	N82	N82-P84 WeakPolarHBondContact O-CD 3.36Å
85	Y	61.5	Low	63.7	Low	167 Å²	167	134.2 Å²	134.2	66%	0.655	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.7	-20.4	-173.8	-67.1	-79.3	0	0	0	113.6	D83 K87 Y88	D83-Y85 PolarHBondContact O-N 3.28Å; D83-Y85 VanDerWaalsContact O-N 3.13Å; Y85-K87 PolarHBondContact O-N 2.8Å; Y85-K87 VanDerWaalsContact O-N 3.14Å; Y85-Y88 PolarHBondContact O-N 3.2Å
86	H	63.9	Low	63.1	Low	116 Å²	116	134.6 Å²	134.6	54%	0.537	63%	0.634	S	S	.	*	H	α-helix	trans	-55.9	-30.9	175.3	-164.8	64.9	0	0	0	112.9	Y88 I89	H86-Y88 VanDerWaalsContact C-N 3.29Å; H86-Y88 PolarHBondContact O-N 3.3Å; H86-I89 PolarHBondContact O-N 3.13Å
87	K	64.3	Low	62.8	Low	160 Å²	160	130.8 Å²	130.8	70%	0.696	62%	0.622	S	S	*	*	H	α-helix	trans	-67	-23.7	-178	-69.2	-169.9	175.1	-173.5	0	114.8	Y85	Y85-K87 PolarHBondContact O-N 2.8Å; Y85-K87 VanDerWaalsContact O-N 3.14Å
88	Y	60.1	Low	62.5	Low	159 Å²	159	128.2 Å²	128.2	62%	0.624	62%	0.618	S	S	*	*	H	α-helix	trans	-92	-12.6	-177.4	-56.2	-71.4	0	0	0	113	Y85 H86	Y85-Y88 PolarHBondContact O-N 3.2Å; H86-Y88 VanDerWaalsContact C-N 3.29Å; H86-Y88 PolarHBondContact O-N 3.3Å
89	I	63.1	Low	62.4	Low	89 Å²	89	124.7 Å²	124.7	46%	0.456	61%	0.611	S	S	.	*	H	α-helix	trans	-78.1	-30.4	-179.7	-56.4	174.1	0	0	0	110.7	H86 W93	H86-I89 PolarHBondContact O-N 3.13Å; I89-W93 HydrophobicContact CG2-CH2 3.91Å; I89-W93 HydrophobicContact CG2-CZ2 3.6Å
90	E	61.7	Low	62.2	Low	128 Å²	128	123.3 Å²	123.3	60%	0.598	60%	0.604	S	S	*	*	H	α-helix	trans	-73	-33.5	179.9	-65.5	-175.4	174.7	0	0	113.3
91	E	59.1	Low	62.2	Low	141 Å²	141	117.9 Å²	117.9	66%	0.659	59%	0.585	S	S	*	*	H	α-helix	trans	-80.2	-33.2	-174.5	-69.1	-170.4	165.3	0	0	113.1	W93 T94	E91-W93 PolarHBondContact O-N 3.14Å; E91-T94 PolarHBondContact O-N 3.19Å; E91-T94 PolarHBondContact O-OG1 3.5Å
92	D	60	Low	62.1	Low	93 Å²	93	119.4 Å²	119.4	50%	0.497	58%	0.577	S	S	.	*	H	α-helix	trans	-75.7	-24.2	-166.5	-147.4	20.2	0	0	0	114.3	A95 Q96	D92-A95 PolarHBondContact O-N 2.87Å; D92-Q96 PolarHBondContact O-N 3.44Å
93	W	62	Low	61.9	Low	163 Å²	163	117 Å²	117	62%	0.617	57%	0.568	S	S	*	*	H	α-helix	trans	-67.7	-37.5	176.7	-62	-35.1	0	0	0	112.6	I89 E91 L97	I89-W93 HydrophobicContact CG2-CH2 3.91Å; I89-W93 HydrophobicContact CG2-CZ2 3.6Å; E91-W93 PolarHBondContact O-N 3.14Å; W93-L97 WeakPolarHBondContact O-CD1 3.43Å; W93-L97 WeakPolarHBondContact O-CG 3.47Å; W93-L97 PolarHBondContact O-N 3.01Å; W93-L97 VanDerWaalsContact O-N 3.12Å
94	T	61.4	Low	61.2	Low	95 Å²	95	118.2 Å²	118.2	58%	0.583	57%	0.573	S	S	*	*	H	α-helix	trans	-70.1	-36.2	180	56.2	0	0	0	0	111.8	E91 Q98	E91-T94 PolarHBondContact O-N 3.19Å; E91-T94 PolarHBondContact O-OG1 3.5Å; T94-Q98 WeakPolarHBondContact O-CB 3.34Å; T94-Q98 PolarHBondContact O-N 3.4Å; T94-Q98 VanDerWaalsContact O-N 3.09Å
95	A	62.9	Low	60.5	Low	41 Å²	41	120.4 Å²	120.4	34%	0.339	58%	0.58	S	S	.	*	H	α-helix	trans	-65.6	-42.6	174.7	0	0	0	0	0	112.7	D92 Q98 Q99	D92-A95 PolarHBondContact O-N 2.87Å; A95-Q98 PolarHBondContact O-N 2.98Å; A95-Q99 PolarHBondContact O-N 3.28Å
96	Q	61.5	Low	60.2	Low	107 Å²	107	115.4 Å²	115.4	50%	0.5	57%	0.565	S	S	.	*	H	α-helix	trans	-66.4	-40	177.3	-73.5	177.2	22.5	0	0	112.7	D92 Q98 Q99 Q100	D92-Q96 PolarHBondContact O-N 3.44Å; Q96-Q98 VanDerWaalsContact C-N 3.3Å; Q96-Q98 PolarHBondContact O-N 3.09Å; Q96-Q99 PolarHBondContact O-N 3.12Å; Q96-Q100 WeakPolarHBondContact O-CB 3.42Å; Q96-Q100 PolarHBondContact O-N 3.47Å
97	L	61.3	Low	59.8	Low	108 Å²	108	115.7 Å²	115.7	57%	0.565	58%	0.577	S	S	*	*	H	α-helix	trans	-63.4	-35.9	173.6	-79.8	159.5	0	0	0	112.2	W93 Q100 S101	W93-L97 WeakPolarHBondContact O-CD1 3.43Å; W93-L97 WeakPolarHBondContact O-CG 3.47Å; W93-L97 PolarHBondContact O-N 3.01Å; W93-L97 VanDerWaalsContact O-N 3.12Å; L97-Q100 PolarHBondContact O-N 3.2Å; L97-S101 WeakPolarHBondContact O-CB 3.44Å; L97-S101 PolarHBondContact O-N 3.4Å; L97-S101 PolarHBondContact O-OG 3.14Å
98	Q	60.9	Low	59.5	Low	144 Å²	144	113.5 Å²	113.5	67%	0.673	58%	0.577	S	S	*	*	H	α-helix	trans	-71.5	-37.3	177.3	-149.9	170.8	16.6	0	0	111.9	T94 A95 Q96 S101 F102	T94-Q98 WeakPolarHBondContact O-CB 3.34Å; T94-Q98 PolarHBondContact O-N 3.4Å; T94-Q98 VanDerWaalsContact O-N 3.09Å; A95-Q98 PolarHBondContact O-N 2.98Å; Q96-Q98 VanDerWaalsContact C-N 3.3Å; Q96-Q98 PolarHBondContact O-N 3.09Å; Q98-S101 WeakPolarHBondContact CA-OG 3.35Å; Q98-S101 PolarHBondContact O-OG 3.36Å; Q98-F102 WeakPolarHBondContact O-CB 3.33Å; Q98-F102 PolarHBondContact O-N 2.94Å
99	Q	61.1	Low	59.1	Low	137 Å²	137	110 Å²	110	64%	0.64	58%	0.581	S	S	*	*	H	α-helix	trans	-65.8	-42.8	170.4	-76.5	179.1	-22.9	0	0	112.4	A95 Q96 S101 F102 V103	A95-Q99 PolarHBondContact O-N 3.28Å; Q96-Q99 PolarHBondContact O-N 3.12Å; Q99-S101 PolarHBondContact O-N 2.97Å; Q99-F102 PolarHBondContact O-N 3.02Å; Q99-V103 WeakPolarHBondContact O-CG2 3.44Å; Q99-V103 PolarHBondContact O-N 3.13Å; Q99-V103 VanDerWaalsContact O-N 3.07Å
100	Q	58.3	Low	58.2	Low	123 Å²	123	117.2 Å²	117.2	58%	0.575	62%	0.621	S	S	*	*	H	α-helix	trans	-65.4	-39.9	179.3	-167.6	175.5	14.7	0	0	111.9	Q96 L97 I104	Q96-Q100 WeakPolarHBondContact O-CB 3.42Å; Q96-Q100 PolarHBondContact O-N 3.47Å; L97-Q100 PolarHBondContact O-N 3.2Å; Q100-I104 HydrophobicContact CG-CD1 4.28Å; Q100-I104 WeakPolarHBondContact O-CD1 3.5Å; Q100-I104 VanDerWaalsContact O-CG1 3.28Å; Q100-I104 WeakPolarHBondContact O-CG1 3.27Å; Q100-I104 PolarHBondContact O-N 2.92Å
101	S	57.9	Low	58.1	Low	53 Å²	53	116.7 Å²	116.7	37%	0.371	62%	0.622	S	S	.	*	H	α-helix	trans	-70	-32.7	174.5	57	0	0	0	0	113.1	L97 Q98 Q99 I104 N105	L97-S101 WeakPolarHBondContact O-CB 3.44Å; L97-S101 PolarHBondContact O-N 3.4Å; L97-S101 PolarHBondContact O-OG 3.14Å; Q98-S101 WeakPolarHBondContact CA-OG 3.35Å; Q98-S101 PolarHBondContact O-OG 3.36Å; Q99-S101 PolarHBondContact O-N 2.97Å; S101-I104 PolarHBondContact O-N 3.44Å; S101-N105 WeakPolarHBondContact O-CB 3.42Å; S101-N105 PolarHBondContact O-N 3.07Å; S101-N105 VanDerWaalsContact O-N 3.14Å; S101-N105 PolarHBondContact O-ND2 2.86Å
102	F	59.4	Low	58	Low	148 Å²	148	115.4 Å²	115.4	65%	0.649	62%	0.62	S	S	*	*	H	α-helix	trans	-65.2	-41.3	173.9	-179.2	-101.1	0	0	0	112.6	Q98 Q99 N105 N106	Q98-F102 WeakPolarHBondContact O-CB 3.33Å; Q98-F102 PolarHBondContact O-N 2.94Å; Q99-F102 PolarHBondContact O-N 3.02Å; F102-N105 PolarHBondContact O-N 3.49Å; F102-N106 PolarHBondContact O-N 3.4Å
103	V	57.6	Low	57.9	Low	105 Å²	105	116.7 Å²	116.7	64%	0.636	63%	0.627	S	S	*	*	H	α-helix	trans	-66.7	-36.9	176.9	173.8	0	0	0	0	111.9	Q99	Q99-V103 WeakPolarHBondContact O-CG2 3.44Å; Q99-V103 PolarHBondContact O-N 3.13Å; Q99-V103 VanDerWaalsContact O-N 3.07Å
104	I	57	Low	57.7	Low	121 Å²	121	113.9 Å²	113.9	62%	0.621	63%	0.627	S	S	*	*	H	α-helix	trans	-72.1	-31.4	179.3	-66.3	166.7	0	0	0	111.9	Q100 S101	Q100-I104 HydrophobicContact CG-CD1 4.28Å; Q100-I104 WeakPolarHBondContact O-CD1 3.5Å; Q100-I104 VanDerWaalsContact O-CG1 3.28Å; Q100-I104 WeakPolarHBondContact O-CG1 3.27Å; Q100-I104 PolarHBondContact O-N 2.92Å; S101-I104 PolarHBondContact O-N 3.44Å
105	N	56.2	Low	57.4	Low	130 Å²	130	115.1 Å²	115.1	70%	0.695	63%	0.63	S	S	*	*	H	α-helix	trans	-86.8	-7	-177.1	-67.6	-26	0	0	0	114.3	S101 F102	S101-N105 WeakPolarHBondContact O-CB 3.42Å; S101-N105 PolarHBondContact O-N 3.07Å; S101-N105 VanDerWaalsContact O-N 3.14Å; S101-N105 PolarHBondContact O-ND2 2.86Å; F102-N105 PolarHBondContact O-N 3.49Å
106	N	55.7	Low	57.1	Low	63 Å²	63	120.1 Å²	120.1	34%	0.337	65%	0.649	S	S	.	*			trans	-120.3	89.8	174.1	-174.4	31	0	0	0	111.2	F102 T108	F102-N106 PolarHBondContact O-N 3.4Å; N106-T108 PolarHBondContact ND2-O 3.35Å; N106-T108 VanDerWaalsContact ND2-O 3.12Å; N106-T108 PolarHBondContact O-N 3.38Å; N106-T108 PolarHBondContact OD1-OG1 3.42Å
107	P	55.4	Low	56.8	Low	122 Å²	122	121 Å²	121	79%	0.792	66%	0.66	S	S	*	*	S	Bend	trans	-71.2	6.9	178.6	28.3	-33.2	0	0	0	114.4
108	T	57.5	Low	56.4	Low	114 Å²	114	122 Å²	122	70%	0.699	67%	0.667	S	S	*	*			trans	-131.3	79.3	175.4	44.1	0	0	0	0	110.8	N106	N106-T108 PolarHBondContact ND2-O 3.35Å; N106-T108 VanDerWaalsContact ND2-O 3.12Å; N106-T108 PolarHBondContact O-N 3.38Å; N106-T108 PolarHBondContact OD1-OG1 3.42Å
109	A	51.9	Low	56	Low	84 Å²	84	120.2 Å²	120.2	69%	0.694	67%	0.667	S	S	*	*			trans	-141.7	77.2	155.6	0	0	0	0	0	107.3
110	N	44.5	Very low	55.6	Low	242 Å²	242	118.6 Å²	118.6	100%	1.294	67%	0.669	S	S	*	*			trans	-87.4	0	157.6	-74.8	-22.1	0	0	0	108.1

Retrieved 110 of 110 residues in 45.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).