A0A060WP24_ONCMY Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession A0A060WP24, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene TIMM8B, Length 89 aa.

						>A0A060WP24_ONCMY|A0A060WP24|TIMM8B
MDGFDLNSSEKADASELQRMIAIEQQKAQFQAQVHNFTDVCWDKCMEGSPSSKMDSRTETCLVNCVDRFIDTTLSITNRFTQMVQKGAH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.2	Very low	64	Low	228 Å²	228	124.1 Å²	124.1	100%	1.123	67%	0.672	S	S	*	*				0	79.9	0	-89.9	-136.4	-174.6	0	0	103.8
2	D	53.1	Low	65	Low	154 Å²	154	118.1 Å²	118.1	82%	0.824	65%	0.652	S	S	*	*			trans	-150.8	70.1	-166.4	-56.6	-82.8	0	0	0	108.7
3	G	54.8	Low	66.6	Low	78 Å²	78	116.2 Å²	116.2	80%	0.804	64%	0.64	S	S	*	*			trans	-139.9	6.6	-173.6	0	0	0	0	0	115.1
4	F	58.6	Low	68.2	Low	169 Å²	169	112 Å²	112	74%	0.741	63%	0.628	S	S	*	*	S	Bend	trans	-115.1	-17.3	-173.6	-165.2	-103.4	0	0	0	114.3
5	D	60.2	Low	69.7	Low	115 Å²	115	109.3 Å²	109.3	62%	0.615	62%	0.62	S	S	*	*	H	α-helix	trans	-83.6	-17.8	-171.8	-62.5	-62.7	0	0	0	115.6	S8 S9	D5-S8 PolarHBondContact O-OG 3Å; D5-S9 PolarHBondContact O-N 3.3Å
6	L	59.4	Low	71.1	Confident	140 Å²	140	109.8 Å²	109.8	73%	0.733	62%	0.615	S	S	*	*	H	α-helix	trans	-70.5	-35.3	178.3	-66.9	171.4	0	0	0	112.1	S9 E10	L6-S9 PolarHBondContact O-N 3.27Å; L6-E10 WeakPolarHBondContact O-CG 3.46Å; L6-E10 PolarHBondContact O-N 3.43Å; L6-E10 VanDerWaalsContact O-N 3.08Å
7	N	70.1	Confident	72.4	Confident	83 Å²	83	108.8 Å²	108.8	44%	0.444	61%	0.608	S	S	.	*	H	α-helix	trans	-73	-33	-175.4	-165.9	-45.4	0	0	0	112.4	K11	N7-K11 WeakPolarHBondContact O-CB 3.38Å; N7-K11 WeakPolarHBondContact O-CD 3.33Å; N7-K11 VanDerWaalsContact O-CG 3.24Å; N7-K11 WeakPolarHBondContact O-CG 3.3Å; N7-K11 PolarHBondContact O-N 3.4Å; N7-K11 WeakPolarHBondContact OD1-CD 3.43Å; N7-K11 WeakPolarHBondContact OD1-CE 3.44Å; N7-K11 PolarHBondContact OD1-NZ 2.98Å
8	S	70.8	Confident	73.6	Confident	59 Å²	59	110.7 Å²	110.7	41%	0.413	61%	0.611	S	S	.	*	H	α-helix	trans	-72.5	-39.9	176.1	22.5	0	0	0	0	112.1	D5 A12	D5-S8 PolarHBondContact O-OG 3Å; S8-A12 PolarHBondContact O-N 3.35Å
9	S	72.9	Confident	74.7	Confident	67 Å²	67	114.5 Å²	114.5	47%	0.469	62%	0.615	S	S	.	*	H	α-helix	trans	-66	-47.7	175.7	-163.4	0	0	0	0	111.6	D5 L6 K11 A12 D13	D5-S9 PolarHBondContact O-N 3.3Å; L6-S9 PolarHBondContact O-N 3.27Å; S9-K11 VanDerWaalsContact C-N 3.28Å; S9-K11 PolarHBondContact O-N 3.16Å; S9-A12 WeakPolarHBondContact O-CB 3.28Å; S9-A12 PolarHBondContact O-N 3.05Å; S9-A12 VanDerWaalsContact O-N 3.11Å; S9-D13 PolarHBondContact O-N 3.33Å
10	E	76.9	Confident	75.8	Confident	135 Å²	135	113.6 Å²	113.6	63%	0.631	61%	0.608	S	S	*	*	H	α-helix	trans	-60.8	-35.9	177.6	-73.8	177.7	135.2	0	0	112.6	L6 A14	L6-E10 WeakPolarHBondContact O-CG 3.46Å; L6-E10 PolarHBondContact O-N 3.43Å; L6-E10 VanDerWaalsContact O-N 3.08Å; E10-A14 VanDerWaalsContact O-CB 3.26Å; E10-A14 WeakPolarHBondContact O-CB 3.4Å; E10-A14 PolarHBondContact O-N 3.39Å
11	K	77.8	Confident	76.8	Confident	137 Å²	137	112 Å²	112	60%	0.596	60%	0.599	S	S	*	*	H	α-helix	trans	-68.4	-39.7	174.2	-80.2	171.7	175	156.1	0	112.8	N7 S9 S15	N7-K11 WeakPolarHBondContact O-CB 3.38Å; N7-K11 WeakPolarHBondContact O-CD 3.33Å; N7-K11 VanDerWaalsContact O-CG 3.24Å; N7-K11 WeakPolarHBondContact O-CG 3.3Å; N7-K11 PolarHBondContact O-N 3.4Å; N7-K11 WeakPolarHBondContact OD1-CD 3.43Å; N7-K11 WeakPolarHBondContact OD1-CE 3.44Å; N7-K11 PolarHBondContact OD1-NZ 2.98Å; S9-K11 VanDerWaalsContact C-N 3.28Å; S9-K11 PolarHBondContact O-N 3.16Å; K11-S15 WeakPolarHBondContact O-CB 3.49Å; K11-S15 PolarHBondContact O-N 3.02Å
12	A	76.5	Confident	79	Confident	52 Å²	52	103.3 Å²	103.3	43%	0.43	56%	0.563	S	S	.	*	H	α-helix	trans	-63.1	-47.4	175.9	0	0	0	0	0	110.4	S8 S9 A14 S15 E16	S8-A12 PolarHBondContact O-N 3.35Å; S9-A12 WeakPolarHBondContact O-CB 3.28Å; S9-A12 PolarHBondContact O-N 3.05Å; S9-A12 VanDerWaalsContact O-N 3.11Å; A12-A14 PolarHBondContact O-N 3Å; A12-S15 PolarHBondContact O-N 2.91Å; A12-S15 PolarHBondContact O-OG 3.36Å; A12-E16 PolarHBondContact O-N 2.87Å
13	D	85.5	Confident	81.2	Confident	94 Å²	94	99 Å²	99	50%	0.503	54%	0.54	S	S	.	.	H	α-helix	trans	-63	-41.8	177.6	-67.5	-22.3	0	0	0	112.2	S9 S15 E16 L17	S9-D13 PolarHBondContact O-N 3.33Å; D13-S15 VanDerWaalsContact C-N 3.32Å; D13-S15 PolarHBondContact O-N 3.41Å; D13-E16 PolarHBondContact O-N 3.1Å; D13-L17 WeakPolarHBondContact O-CB 3.3Å; D13-L17 PolarHBondContact O-N 3.44Å
14	A	88.6	Confident	83.2	Confident	57 Å²	57	100.2 Å²	100.2	47%	0.471	52%	0.524	S	S	.	.	H	α-helix	trans	-62.3	-38.6	175.4	0	0	0	0	0	112.3	E10 A12 L17 Q18	E10-A14 VanDerWaalsContact O-CB 3.26Å; E10-A14 WeakPolarHBondContact O-CB 3.4Å; E10-A14 PolarHBondContact O-N 3.39Å; A12-A14 PolarHBondContact O-N 3Å; A14-L17 PolarHBondContact O-N 3.4Å; A14-Q18 WeakPolarHBondContact O-CB 3.27Å; A14-Q18 PolarHBondContact O-N 3.01Å
15	S	90.4	Very high	85.1	Confident	72 Å²	72	97.6 Å²	97.6	50%	0.503	51%	0.514	S	S	.	.	H	α-helix	trans	-68.2	-37.9	177.8	78.2	0	0	0	0	112.5	K11 A12 D13 Q18 R19	K11-S15 WeakPolarHBondContact O-CB 3.49Å; K11-S15 PolarHBondContact O-N 3.02Å; A12-S15 PolarHBondContact O-N 2.91Å; A12-S15 PolarHBondContact O-OG 3.36Å; D13-S15 VanDerWaalsContact C-N 3.32Å; D13-S15 PolarHBondContact O-N 3.41Å; S15-Q18 PolarHBondContact O-N 2.94Å; S15-R19 PolarHBondContact O-N 3.32Å; S15-R19 VanDerWaalsContact O-N 3.08Å
16	E	91.9	Very high	86.9	Confident	117 Å²	117	98.6 Å²	98.6	55%	0.547	52%	0.515	S	S	.	.	H	α-helix	trans	-67.9	-44.3	175	-178.2	168.2	-172.1	0	0	111.2	A12 D13 Q18 R19 M20	A12-E16 PolarHBondContact O-N 2.87Å; D13-E16 PolarHBondContact O-N 3.1Å; E16-Q18 VanDerWaalsContact C-N 3.33Å; E16-Q18 PolarHBondContact O-N 3.49Å; E16-R19 WeakPolarHBondContact O-CB 3.29Å; E16-R19 PolarHBondContact O-N 3.48Å; E16-R19 VanDerWaalsContact O-N 3.16Å; E16-M20 HydrophobicContact CG-CE 4.47Å; E16-M20 WeakPolarHBondContact O-CG 3.46Å; E16-M20 PolarHBondContact O-N 3.48Å
17	L	93.2	Very high	88.7	Confident	93 Å²	93	97 Å²	97	49%	0.487	50%	0.503	S	S	.	.	H	α-helix	trans	-58.8	-44.8	174.5	179.1	61.1	0	0	0	111.8	D13 A14 R19 M20 I21	D13-L17 WeakPolarHBondContact O-CB 3.3Å; D13-L17 PolarHBondContact O-N 3.44Å; A14-L17 PolarHBondContact O-N 3.4Å; L17-R19 VanDerWaalsContact C-N 3.28Å; L17-R19 PolarHBondContact O-N 2.87Å; L17-M20 HydrophobicContact CB-CE 4.46Å; L17-M20 HydrophobicContact CD1-CE 4.02Å; L17-M20 PolarHBondContact O-N 2.87Å; L17-M20 VanDerWaalsContact O-N 3.16Å; L17-I21 HydrophobicContact CD1-CD1 4.2Å; L17-I21 HydrophobicContact CD1-CG1 4.32Å; L17-I21 HydrophobicContact CG-CD1 3.96Å; L17-I21 WeakPolarHBondContact O-CG1 3.49Å; L17-I21 PolarHBondContact O-N 3.27Å
18	Q	94.2	Very high	90.1	Very high	143 Å²	143	96 Å²	96	67%	0.668	51%	0.506	S	S	*	.	H	α-helix	trans	-61.6	-38.4	177.6	-171.6	172.2	-6.1	0	0	111.8	A14 S15 E16 I21 A22	A14-Q18 WeakPolarHBondContact O-CB 3.27Å; A14-Q18 PolarHBondContact O-N 3.01Å; S15-Q18 PolarHBondContact O-N 2.94Å; E16-Q18 VanDerWaalsContact C-N 3.33Å; E16-Q18 PolarHBondContact O-N 3.49Å; Q18-I21 PolarHBondContact O-N 3.49Å; Q18-A22 PolarHBondContact O-N 3.24Å
19	R	95.4	Very high	91.3	Very high	183 Å²	183	99.1 Å²	99.1	69%	0.691	51%	0.514	S	S	*	.	H	α-helix	trans	-64.1	-44.7	173.1	177.5	179.4	175.2	160.7	-0.8	111.9	S15 E16 L17 A22 I23	S15-R19 PolarHBondContact O-N 3.32Å; S15-R19 VanDerWaalsContact O-N 3.08Å; E16-R19 WeakPolarHBondContact O-CB 3.29Å; E16-R19 PolarHBondContact O-N 3.48Å; E16-R19 VanDerWaalsContact O-N 3.16Å; L17-R19 VanDerWaalsContact C-N 3.28Å; L17-R19 PolarHBondContact O-N 2.87Å; R19-A22 PolarHBondContact O-N 2.92Å; R19-I23 HydrophobicContact CG-CD1 4.11Å; R19-I23 WeakPolarHBondContact O-CG1 3.27Å; R19-I23 PolarHBondContact O-N 2.75Å; R19-I23 VanDerWaalsContact O-N 3.09Å
20	M	95.7	Very high	92.5	Very high	95 Å²	95	101.6 Å²	101.6	47%	0.468	52%	0.516	S	S	.	.	H	α-helix	trans	-61	-45	176.8	-70.7	-167.7	-69.8	0	0	111.3	E16 L17 A22 I23 E24	E16-M20 HydrophobicContact CG-CE 4.47Å; E16-M20 WeakPolarHBondContact O-CG 3.46Å; E16-M20 PolarHBondContact O-N 3.48Å; L17-M20 HydrophobicContact CB-CE 4.46Å; L17-M20 HydrophobicContact CD1-CE 4.02Å; L17-M20 PolarHBondContact O-N 2.87Å; L17-M20 VanDerWaalsContact O-N 3.16Å; M20-A22 VanDerWaalsContact C-N 3.32Å; M20-A22 PolarHBondContact O-N 2.8Å; M20-I23 PolarHBondContact O-N 2.75Å; M20-E24 WeakPolarHBondContact O-CG 3.24Å; M20-E24 PolarHBondContact O-N 2.68Å
21	I	97.1	Very high	93.5	Very high	80 Å²	80	99.7 Å²	99.7	41%	0.41	51%	0.508	S	S	.	.	H	α-helix	trans	-58.3	-45.1	176.4	-69.3	167.5	0	0	0	110.7	L17 Q18 I23 E24 Q25	L17-I21 HydrophobicContact CD1-CD1 4.2Å; L17-I21 HydrophobicContact CD1-CG1 4.32Å; L17-I21 HydrophobicContact CG-CD1 3.96Å; L17-I21 WeakPolarHBondContact O-CG1 3.49Å; L17-I21 PolarHBondContact O-N 3.27Å; Q18-I21 PolarHBondContact O-N 3.49Å; I21-I23 VanDerWaalsContact C-N 3.32Å; I21-I23 PolarHBondContact O-N 3.37Å; I21-E24 PolarHBondContact O-N 2.94Å; I21-Q25 HydrophobicContact CG2-CG 4.24Å; I21-Q25 WeakPolarHBondContact O-CB 3.47Å; I21-Q25 VanDerWaalsContact O-CG 3.26Å; I21-Q25 WeakPolarHBondContact O-CG 3.42Å; I21-Q25 PolarHBondContact O-N 2.98Å
22	A	96.5	Very high	94.5	Very high	46 Å²	46	95.9 Å²	95.9	38%	0.38	50%	0.502	S	S	.	.	H	α-helix	trans	-61	-41	178.6	0	0	0	0	0	112.3	Q18 R19 M20 Q25 Q26	Q18-A22 PolarHBondContact O-N 3.24Å; R19-A22 PolarHBondContact O-N 2.92Å; M20-A22 VanDerWaalsContact C-N 3.32Å; M20-A22 PolarHBondContact O-N 2.8Å; A22-Q25 PolarHBondContact O-N 3.37Å; A22-Q26 WeakPolarHBondContact O-CG 3.45Å; A22-Q26 PolarHBondContact O-N 3.39Å
23	I	97.6	Very high	95.5	Very high	65 Å²	65	98.2 Å²	98.2	33%	0.333	50%	0.503	S	S	.	.	H	α-helix	trans	-64.9	-47	176.7	-68.6	166	0	0	0	110.8	R19 M20 I21 Q25 Q26 K27	R19-I23 HydrophobicContact CG-CD1 4.11Å; R19-I23 WeakPolarHBondContact O-CG1 3.27Å; R19-I23 PolarHBondContact O-N 2.75Å; R19-I23 VanDerWaalsContact O-N 3.09Å; M20-I23 PolarHBondContact O-N 2.75Å; I21-I23 VanDerWaalsContact C-N 3.32Å; I21-I23 PolarHBondContact O-N 3.37Å; I23-Q25 VanDerWaalsContact C-N 3.32Å; I23-Q25 PolarHBondContact O-N 2.93Å; I23-Q26 PolarHBondContact O-N 3.03Å; I23-K27 HydrophobicContact CG2-CD 4.37Å; I23-K27 WeakPolarHBondContact O-CG 3.31Å; I23-K27 PolarHBondContact O-N 3.4Å
24	E	97.7	Very high	96.1	Very high	102 Å²	102	96 Å²	96	48%	0.477	49%	0.494	S	S	.	.	H	α-helix	trans	-66.8	-34.6	179.8	-66.7	-51.6	136	0	0	112.1	M20 I21 K27 A28	M20-E24 WeakPolarHBondContact O-CG 3.24Å; M20-E24 PolarHBondContact O-N 2.68Å; I21-E24 PolarHBondContact O-N 2.94Å; E24-K27 PolarHBondContact O-N 2.95Å; E24-K27 IonicContact OE1-NZ 2.72Å; E24-K27 PolarHBondContact OE1-NZ 3.25Å; E24-K27 WeakPolarHBondContact OE2-CD 3.07Å; E24-K27 IonicContact OE2-NZ 3.81Å; E24-A28 WeakPolarHBondContact O-CB 3.45Å; E24-A28 PolarHBondContact O-N 2.87Å
25	Q	97.8	Very high	96.6	Very high	114 Å²	114	98.9 Å²	98.9	53%	0.533	50%	0.497	S	S	.	.	H	α-helix	trans	-62.6	-44.5	171.7	-76.6	177.3	-2.9	0	0	112	I21 A22 I23 K27 A28 Q29	I21-Q25 HydrophobicContact CG2-CG 4.24Å; I21-Q25 WeakPolarHBondContact O-CB 3.47Å; I21-Q25 VanDerWaalsContact O-CG 3.26Å; I21-Q25 WeakPolarHBondContact O-CG 3.42Å; I21-Q25 PolarHBondContact O-N 2.98Å; A22-Q25 PolarHBondContact O-N 3.37Å; I23-Q25 VanDerWaalsContact C-N 3.32Å; I23-Q25 PolarHBondContact O-N 2.93Å; Q25-K27 VanDerWaalsContact C-N 3.34Å; Q25-K27 PolarHBondContact O-N 2.92Å; Q25-A28 PolarHBondContact O-N 3.48Å; Q25-Q29 WeakPolarHBondContact O-CG 3.37Å; Q25-Q29 PolarHBondContact O-N 3.25Å
26	Q	97.9	Very high	96.9	Very high	137 Å²	137	98.9 Å²	98.9	64%	0.64	49%	0.491	S	S	*	.	H	α-helix	trans	-61.3	-42.5	175.4	-75.6	-177.6	-26	0	0	111.8	A22 I23 Q29 F30	A22-Q26 WeakPolarHBondContact O-CG 3.45Å; A22-Q26 PolarHBondContact O-N 3.39Å; I23-Q26 PolarHBondContact O-N 3.03Å; Q26-Q29 PolarHBondContact O-N 3.45Å; Q26-F30 PolarHBondContact O-N 3.07Å
27	K	98.3	Very high	97.2	Very high	106 Å²	106	94.9 Å²	94.9	46%	0.461	47%	0.472	S	S	.	.	H	α-helix	trans	-61.3	-46.3	174.8	-71.2	173.9	-176.9	171.2	0	111.5	I23 E24 Q25 Q29 F30 Q31	I23-K27 HydrophobicContact CG2-CD 4.37Å; I23-K27 WeakPolarHBondContact O-CG 3.31Å; I23-K27 PolarHBondContact O-N 3.4Å; E24-K27 PolarHBondContact O-N 2.95Å; E24-K27 IonicContact OE1-NZ 2.72Å; E24-K27 PolarHBondContact OE1-NZ 3.25Å; E24-K27 WeakPolarHBondContact OE2-CD 3.07Å; E24-K27 IonicContact OE2-NZ 3.81Å; Q25-K27 VanDerWaalsContact C-N 3.34Å; Q25-K27 PolarHBondContact O-N 2.92Å; K27-Q29 VanDerWaalsContact C-N 3.33Å; K27-Q29 PolarHBondContact O-N 3.16Å; K27-F30 WeakPolarHBondContact O-CB 3.2Å; K27-F30 PolarHBondContact O-N 2.99Å; K27-Q31 WeakPolarHBondContact O-CG 3.5Å; K27-Q31 PolarHBondContact O-N 3.47Å
28	A	98.4	Very high	97.5	Very high	62 Å²	62	93.9 Å²	93.9	51%	0.512	47%	0.47	S	S	.	.	H	α-helix	trans	-61	-41.9	178.8	0	0	0	0	0	111.9	E24 Q25 Q31 A32	E24-A28 WeakPolarHBondContact O-CB 3.45Å; E24-A28 PolarHBondContact O-N 2.87Å; Q25-A28 PolarHBondContact O-N 3.48Å; A28-Q31 PolarHBondContact O-N 3.31Å; A28-A32 WeakPolarHBondContact O-CB 3.48Å; A28-A32 PolarHBondContact O-N 3.2Å
29	Q	98	Very high	97.6	Very high	124 Å²	124	92.1 Å²	92.1	58%	0.579	47%	0.465	S	S	*	.	H	α-helix	trans	-64.4	-38.7	175.2	-72.5	175.1	2.1	0	0	112.6	Q25 Q26 K27 Q33	Q25-Q29 WeakPolarHBondContact O-CG 3.37Å; Q25-Q29 PolarHBondContact O-N 3.25Å; Q26-Q29 PolarHBondContact O-N 3.45Å; K27-Q29 VanDerWaalsContact C-N 3.33Å; K27-Q29 PolarHBondContact O-N 3.16Å; Q29-Q33 WeakPolarHBondContact O-CG 3.32Å; Q29-Q33 PolarHBondContact O-N 2.95Å; Q29-Q33 VanDerWaalsContact O-N 3.16Å; Q29-Q33 PolarHBondContact O-NE2 3.37Å
30	F	97.6	Very high	97.7	Very high	120 Å²	120	85.7 Å²	85.7	53%	0.526	45%	0.446	S	S	.	.	H	α-helix	trans	-64.6	-46.6	174.3	174.7	-99.7	0	0	0	111.4	Q26 K27 A32 Q33 V34	Q26-F30 PolarHBondContact O-N 3.07Å; K27-F30 WeakPolarHBondContact O-CB 3.2Å; K27-F30 PolarHBondContact O-N 2.99Å; F30-A32 VanDerWaalsContact C-N 3.31Å; F30-A32 PolarHBondContact O-N 2.98Å; F30-Q33 WeakPolarHBondContact O-CB 3.21Å; F30-Q33 PolarHBondContact O-N 3.24Å; F30-Q33 VanDerWaalsContact O-N 3.07Å; F30-V34 HydrophobicContact CD1-CG2 4.14Å; F30-V34 HydrophobicContact CE1-CG2 3.64Å; F30-V34 HydrophobicContact CE2-CG2 4.24Å; F30-V34 HydrophobicContact CZ-CG2 3.7Å; F30-V34 WeakPolarHBondContact O-CG2 3.34Å; F30-V34 PolarHBondContact O-N 3.49Å
31	Q	98.4	Very high	97.8	Very high	95 Å²	95	81.3 Å²	81.3	44%	0.444	43%	0.425	S	S	.	.	H	α-helix	trans	-61.4	-40.1	177.7	-67.2	-60.8	-18.8	0	0	111.9	K27 A28 Q33 V34 H35	K27-Q31 WeakPolarHBondContact O-CG 3.5Å; K27-Q31 PolarHBondContact O-N 3.47Å; A28-Q31 PolarHBondContact O-N 3.31Å; Q31-Q33 VanDerWaalsContact C-N 3.28Å; Q31-Q33 PolarHBondContact O-N 3.05Å; Q31-V34 WeakPolarHBondContact O-CB 3.46Å; Q31-V34 PolarHBondContact O-N 2.85Å; Q31-H35 PolarHBondContact O-CD2 3.03Å; Q31-H35 PolarHBondContact O-N 3.3Å
32	A	98.3	Very high	97.8	Very high	57 Å²	57	83 Å²	83	47%	0.471	43%	0.426	S	S	.	.	H	α-helix	trans	-59.5	-38.8	173.9	0	0	0	0	0	112.4	A28 F30 H35 N36	A28-A32 WeakPolarHBondContact O-CB 3.48Å; A28-A32 PolarHBondContact O-N 3.2Å; F30-A32 VanDerWaalsContact C-N 3.31Å; F30-A32 PolarHBondContact O-N 2.98Å; A32-H35 PolarHBondContact O-N 3.43Å; A32-N36 WeakPolarHBondContact O-CB 3.48Å; A32-N36 PolarHBondContact O-N 3.4Å
33	Q	97.4	Very high	97.8	Very high	100 Å²	100	87 Å²	87	47%	0.467	44%	0.441	S	S	.	.	H	α-helix	trans	-67.7	-41.4	174.5	-73.3	173.7	79.5	0	0	112	Q29 F30 Q31 H35 N36 F37	Q29-Q33 WeakPolarHBondContact O-CG 3.32Å; Q29-Q33 PolarHBondContact O-N 2.95Å; Q29-Q33 VanDerWaalsContact O-N 3.16Å; Q29-Q33 PolarHBondContact O-NE2 3.37Å; F30-Q33 WeakPolarHBondContact O-CB 3.21Å; F30-Q33 PolarHBondContact O-N 3.24Å; F30-Q33 VanDerWaalsContact O-N 3.07Å; Q31-Q33 VanDerWaalsContact C-N 3.28Å; Q31-Q33 PolarHBondContact O-N 3.05Å; Q33-H35 VanDerWaalsContact C-N 3.32Å; Q33-H35 PolarHBondContact O-N 3.47Å; Q33-N36 PolarHBondContact O-N 3.29Å; Q33-F37 HydrophobicContact CB-CE2 4.28Å; Q33-F37 HydrophobicContact CB-CZ 4.35Å; Q33-F37 WeakPolarHBondContact O-CD2 3.21Å; Q33-F37 WeakPolarHBondContact O-CG 3.37Å; Q33-F37 PolarHBondContact O-N 3.46Å
34	V	98.1	Very high	97.7	Very high	49 Å²	49	90.9 Å²	90.9	30%	0.297	46%	0.456	S	S	.	.	H	α-helix	trans	-58.6	-44.9	174.6	172.4	0	0	0	0	110.9	F30 Q31 F37 T38	F30-V34 HydrophobicContact CD1-CG2 4.14Å; F30-V34 HydrophobicContact CE1-CG2 3.64Å; F30-V34 HydrophobicContact CE2-CG2 4.24Å; F30-V34 HydrophobicContact CZ-CG2 3.7Å; F30-V34 WeakPolarHBondContact O-CG2 3.34Å; F30-V34 PolarHBondContact O-N 3.49Å; Q31-V34 WeakPolarHBondContact O-CB 3.46Å; Q31-V34 PolarHBondContact O-N 2.85Å; V34-F37 PolarHBondContact O-N 3.48Å; V34-T38 WeakPolarHBondContact O-CB 3.26Å; V34-T38 PolarHBondContact O-N 2.95Å; V34-T38 PolarHBondContact O-OG1 3.4Å
35	H	98.4	Very high	97.7	Very high	116 Å²	116	86.4 Å²	86.4	54%	0.537	44%	0.435	S	S	.	.	H	α-helix	trans	-61.5	-47.3	175.3	-71.1	-53.6	0	0	0	112	Q31 A32 Q33 F37 T38 D39	Q31-H35 PolarHBondContact O-CD2 3.03Å; Q31-H35 PolarHBondContact O-N 3.3Å; A32-H35 PolarHBondContact O-N 3.43Å; Q33-H35 VanDerWaalsContact C-N 3.32Å; Q33-H35 PolarHBondContact O-N 3.47Å; H35-F37 VanDerWaalsContact C-N 3.34Å; H35-F37 PolarHBondContact O-N 3.42Å; H35-T38 WeakPolarHBondContact O-CB 3.38Å; H35-T38 PolarHBondContact O-N 3.16Å; H35-T38 VanDerWaalsContact O-N 3.11Å; H35-D39 PolarHBondContact O-N 3.38Å
36	N	98	Very high	97.5	Very high	73 Å²	73	82.9 Å²	82.9	39%	0.39	42%	0.419	S	S	.	.	H	α-helix	trans	-59.6	-43.2	177.3	176	70	0	0	0	112.6	A32 Q33 T38 D39 V40	A32-N36 WeakPolarHBondContact O-CB 3.48Å; A32-N36 PolarHBondContact O-N 3.4Å; Q33-N36 PolarHBondContact O-N 3.29Å; N36-T38 VanDerWaalsContact C-N 3.32Å; N36-D39 PolarHBondContact O-N 3.41Å; N36-V40 WeakPolarHBondContact O-CB 3.4Å; N36-V40 WeakPolarHBondContact O-CG2 3.26Å; N36-V40 PolarHBondContact O-N 3.31Å
37	F	98.3	Very high	97	Very high	33 Å²	33	84.6 Å²	84.6	15%	0.145	43%	0.427	C	S	.	.	H	α-helix	trans	-64.9	-38.6	175.5	-62	-24.2	0	0	0	111.9	Q33 V34 H35 C41 V66 F69 I70	Q33-F37 HydrophobicContact CB-CE2 4.28Å; Q33-F37 HydrophobicContact CB-CZ 4.35Å; Q33-F37 WeakPolarHBondContact O-CD2 3.21Å; Q33-F37 WeakPolarHBondContact O-CG 3.37Å; Q33-F37 PolarHBondContact O-N 3.46Å; V34-F37 PolarHBondContact O-N 3.48Å; H35-F37 VanDerWaalsContact C-N 3.34Å; H35-F37 PolarHBondContact O-N 3.42Å; F37-C41 WeakPolarHBondContact O-CB 3.33Å; F37-C41 PolarHBondContact O-N 3.04Å; F37-C41 PolarHBondContact O-SG 3.49Å; F37-V66 HydrophobicContact CB-CG2 4.29Å; F37-V66 HydrophobicContact CD2-CG1 4.09Å; F37-F69 AromaticContact CD1-CD1 3.94Å; F37-F69 HydrophobicContact CD1-CD1 3.94Å; F37-F69 HydrophobicContact CD1-CE1 4.2Å; F37-F69 HydrophobicContact CD1-CG 4.36Å; F37-F69 AromaticContact CE1-CD1 3.4Å; F37-F69 HydrophobicContact CE1-CD1 3.4Å; F37-F69 AromaticContact CE1-CE1 3.58Å; F37-F69 HydrophobicContact CE1-CE1 3.58Å; F37-F69 HydrophobicContact CE1-CG 4.23Å; F37-F69 HydrophobicContact CE1-CZ 4.49Å; F37-F69 HydrophobicContact CZ-CD1 4.3Å; F37-I70 HydrophobicContact CE2-CD1 4.33Å; F37-I70 HydrophobicContact CE2-CG1 4.38Å; F37-I70 HydrophobicContact CZ-CG1 4.1Å
38	T	97.6	Very high	96.3	Very high	72 Å²	72	82.9 Å²	82.9	44%	0.442	44%	0.439	S	S	.	.	H	α-helix	trans	-58.4	-52.2	174.8	-56.9	0	0	0	0	110	V34 H35 N36 V40 W42	V34-T38 WeakPolarHBondContact O-CB 3.26Å; V34-T38 PolarHBondContact O-N 2.95Å; V34-T38 PolarHBondContact O-OG1 3.4Å; H35-T38 WeakPolarHBondContact O-CB 3.38Å; H35-T38 PolarHBondContact O-N 3.16Å; H35-T38 VanDerWaalsContact O-N 3.11Å; N36-T38 VanDerWaalsContact C-N 3.32Å; T38-V40 PolarHBondContact O-N 3.42Å; T38-W42 WeakPolarHBondContact O-CA 3.35Å; T38-W42 WeakPolarHBondContact O-CB 3.48Å; T38-W42 PolarHBondContact O-N 3.5Å
39	D	97.6	Very high	95.6	Very high	106 Å²	106	85.5 Å²	85.5	57%	0.567	45%	0.454	S	S	*	.	H	α-helix	trans	-60.2	-50.7	-178.5	-65.4	-22.7	0	0	0	111.7	H35 N36 D43	H35-D39 PolarHBondContact O-N 3.38Å; N36-D39 PolarHBondContact O-N 3.41Å; D39-D43 PolarHBondContact O-N 2.88Å
40	V	97.7	Very high	95	Very high	48 Å²	48	83.8 Å²	83.8	29%	0.291	45%	0.454	S	S	.	.	H	α-helix	trans	-64.3	-45.9	-177.7	171.4	0	0	0	0	111.9	N36 T38 K44 F69	N36-V40 WeakPolarHBondContact O-CB 3.4Å; N36-V40 WeakPolarHBondContact O-CG2 3.26Å; N36-V40 PolarHBondContact O-N 3.31Å; T38-V40 PolarHBondContact O-N 3.42Å; V40-K44 WeakPolarHBondContact O-CG 3.4Å; V40-K44 PolarHBondContact O-N 3.19Å; V40-F69 HydrophobicContact CG1-CD2 4.24Å; V40-F69 HydrophobicContact CG1-CE2 4.31Å
41	C	98.1	Very high	94.4	Very high	2 Å²	2	82.6 Å²	82.6	1%	0.014	46%	0.46	C	S	.	.	H	α-helix	trans	-78.4	-27.8	-176	-67.9	0	0	0	0	112.4	F37 K44 C45 L62 C65	F37-C41 WeakPolarHBondContact O-CB 3.33Å; F37-C41 PolarHBondContact O-N 3.04Å; F37-C41 PolarHBondContact O-SG 3.49Å; C41-K44 PolarHBondContact O-N 2.93Å; C41-C45 VanDerWaalsContact O-CB 3.3Å; C41-C45 WeakPolarHBondContact O-CB 3.4Å; C41-C45 PolarHBondContact O-N 3.05Å; C41-L62 HydrophobicContact CB-CD2 3.91Å; C41-C65 WeakPolarHBondContact CA-SG 3.46Å; C41-C65 HydrophobicContact CB-CB 3.74Å; C41-C65 WeakPolarHBondContact CB-SG 3.39Å; C41-C65 VanDerWaalsContact SG-C 3.59Å; C41-C65 WeakPolarHBondContact SG-CB 3.42Å; C41-C65 CovalentContact SG-SG 2.05Å; C41-C65 PolarHBondContact SG-SG 3.41Å
42	W	96.3	Very high	94	Very high	117 Å²	117	83.8 Å²	83.8	44%	0.443	48%	0.479	S	S	.	.	H	α-helix	trans	-59.3	-52.4	171.3	-171.5	-92.2	0	0	0	110.5	T38 K44 C45 M46 P50	T38-W42 WeakPolarHBondContact O-CA 3.35Å; T38-W42 WeakPolarHBondContact O-CB 3.48Å; T38-W42 PolarHBondContact O-N 3.5Å; W42-K44 PolarHBondContact O-N 3.11Å; W42-K44 VanDerWaalsContact O-N 3.09Å; W42-C45 PolarHBondContact O-N 3.31Å; W42-M46 HydrophobicContact CD2-CB 4.24Å; W42-M46 HydrophobicContact CD2-CG 3.51Å; W42-M46 HydrophobicContact CE3-CG 3.53Å; W42-M46 HydrophobicContact CE3-SD 4.34Å; W42-M46 HydrophobicContact CG-CB 4.48Å; W42-M46 HydrophobicContact CG-CG 4.09Å; W42-M46 HydrophobicContact CH2-CE 3.79Å; W42-M46 HydrophobicContact CH2-CG 3.9Å; W42-M46 HydrophobicContact CH2-SD 4.07Å; W42-M46 HydrophobicContact CZ2-CB 4.44Å; W42-M46 HydrophobicContact CZ2-CE 4.02Å; W42-M46 HydrophobicContact CZ2-CG 3.88Å; W42-M46 HydrophobicContact CZ3-CE 4.31Å; W42-M46 HydrophobicContact CZ3-CG 3.73Å; W42-M46 HydrophobicContact CZ3-SD 3.98Å; W42-M46 VanDerWaalsContact O-CB 3.31Å; W42-M46 WeakPolarHBondContact O-CB 3.42Å; W42-M46 PolarHBondContact O-N 3.47Å; W42-P50 HydrophobicContact CH2-CG 4.3Å; W42-P50 HydrophobicContact CZ2-CG 4.13Å
43	D	95.8	Very high	93.7	Very high	130 Å²	130	89.1 Å²	89.1	70%	0.695	49%	0.492	S	S	*	.	H	α-helix	trans	-62	-20.6	178.2	-75.6	-8.9	0	0	0	114.1	D39	D39-D43 PolarHBondContact O-N 2.88Å
44	K	96.3	Very high	93.3	Very high	146 Å²	146	89.2 Å²	89.2	64%	0.635	49%	0.493	S	S	*	.	H	α-helix	trans	-95	-34.9	-177.2	-72.9	-79.2	165	-71	0	113.4	V40 C41 W42	V40-K44 WeakPolarHBondContact O-CG 3.4Å; V40-K44 PolarHBondContact O-N 3.19Å; C41-K44 PolarHBondContact O-N 2.93Å; W42-K44 PolarHBondContact O-N 3.11Å; W42-K44 VanDerWaalsContact O-N 3.09Å
45	C	96.9	Very high	93	Very high	8 Å²	8	90.8 Å²	90.8	5%	0.054	50%	0.5	C	S	.	.	H	α-helix	trans	-112.3	-23.4	-168.3	-70.2	0	0	0	0	113.9	C41 W42 E47 C61 L62	C41-C45 VanDerWaalsContact O-CB 3.3Å; C41-C45 WeakPolarHBondContact O-CB 3.4Å; C41-C45 PolarHBondContact O-N 3.05Å; W42-C45 PolarHBondContact O-N 3.31Å; C45-E47 PolarHBondContact O-N 3.08Å; C45-C61 WeakPolarHBondContact CA-SG 3.34Å; C45-C61 HydrophobicContact CB-CB 3.62Å; C45-C61 WeakPolarHBondContact CB-SG 3.34Å; C45-C61 WeakPolarHBondContact SG-CB 3.16Å; C45-C61 PolarHBondContact SG-O 3.21Å; C45-C61 CovalentContact SG-SG 2.04Å; C45-C61 PolarHBondContact SG-SG 2.91Å; C45-L62 HydrophobicContact CB-CD2 3.83Å; C45-L62 HydrophobicContact CB-CG 4.09Å
46	M	93.3	Very high	92.8	Very high	40 Å²	40	89.7 Å²	89.7	20%	0.197	51%	0.505	C	S	.	.			trans	-85.3	108.7	178.6	-69.2	-62.8	-58	0	0	110.4	W42 P50 T58	W42-M46 HydrophobicContact CD2-CB 4.24Å; W42-M46 HydrophobicContact CD2-CG 3.51Å; W42-M46 HydrophobicContact CE3-CG 3.53Å; W42-M46 HydrophobicContact CE3-SD 4.34Å; W42-M46 HydrophobicContact CG-CB 4.48Å; W42-M46 HydrophobicContact CG-CG 4.09Å; W42-M46 HydrophobicContact CH2-CE 3.79Å; W42-M46 HydrophobicContact CH2-CG 3.9Å; W42-M46 HydrophobicContact CH2-SD 4.07Å; W42-M46 HydrophobicContact CZ2-CB 4.44Å; W42-M46 HydrophobicContact CZ2-CE 4.02Å; W42-M46 HydrophobicContact CZ2-CG 3.88Å; W42-M46 HydrophobicContact CZ3-CE 4.31Å; W42-M46 HydrophobicContact CZ3-CG 3.73Å; W42-M46 HydrophobicContact CZ3-SD 3.98Å; W42-M46 VanDerWaalsContact O-CB 3.31Å; W42-M46 WeakPolarHBondContact O-CB 3.42Å; W42-M46 PolarHBondContact O-N 3.47Å; M46-P50 HydrophobicContact CE-CB 4.07Å; M46-P50 HydrophobicContact CE-CG 3.88Å; M46-T58 HydrophobicContact SD-CG2 3.36Å; M46-T58 WeakPolarHBondContact SD-CG2 3.25Å
47	E	88.1	Confident	92.7	Very high	173 Å²	173	95.7 Å²	95.7	81%	0.808	52%	0.523	S	S	*	.			trans	-104.6	121.9	173.3	-65.8	-179.7	-176.9	0	0	110.1	C45	C45-E47 PolarHBondContact O-N 3.08Å
48	G	83.2	Confident	92.5	Very high	69 Å²	69	94.9 Å²	94.9	71%	0.711	52%	0.52	S	S	*	.	S	Bend	trans	75.6	-162.7	177.7	0	0	0	0	0	114.4
49	S	84.6	Confident	92.4	Very high	118 Å²	118	96.9 Å²	96.9	83%	0.825	53%	0.525	S	S	*	.	S	Bend	trans	-78.8	132.4	-177.6	-62.6	0	0	0	0	111.2	S51	S49-S51 PolarHBondContact O-N 3.49Å
50	P	84.1	Confident	92.4	Very high	87 Å²	87	95.6 Å²	95.6	57%	0.565	52%	0.521	S	S	*	.			trans	-57.8	134.8	175.5	-21.4	30.7	0	0	0	111.9	W42 M46	W42-P50 HydrophobicContact CH2-CG 4.3Å; W42-P50 HydrophobicContact CZ2-CG 4.13Å; M46-P50 HydrophobicContact CE-CB 4.07Å; M46-P50 HydrophobicContact CE-CG 3.88Å
51	S	85.1	Confident	92.4	Very high	95 Å²	95	95.5 Å²	95.5	66%	0.664	52%	0.522	S	S	*	.			trans	-84.2	174.3	169.1	-178.5	0	0	0	0	110.6	S49 K53	S49-S51 PolarHBondContact O-N 3.49Å; S51-K53 PolarHBondContact O-N 3.47Å; S51-K53 VanDerWaalsContact O-N 3.16Å
52	S	91.6	Very high	92.4	Very high	121 Å²	121	97.2 Å²	97.2	85%	0.846	53%	0.53	S	S	*	.	S	Bend	trans	-63.4	-16.1	174.2	60.5	0	0	0	0	113.6
53	K	90.4	Very high	92.5	Very high	169 Å²	169	95.3 Å²	95.3	74%	0.735	53%	0.532	S	S	*	.	S	Bend	trans	-138.7	143.5	173.4	-62.6	-174.4	-179.6	-176.3	0	109.5	S51	S51-K53 PolarHBondContact O-N 3.47Å; S51-K53 VanDerWaalsContact O-N 3.16Å
54	M	90.1	Very high	92.6	Very high	101 Å²	101	93 Å²	93	50%	0.498	52%	0.519	S	S	.	.			trans	-69.4	131.8	170.1	-166.7	140.3	59.8	0	0	109.3	T58 E59 L62	M54-T58 HydrophobicContact CG-CG2 3.67Å; M54-T58 HydrophobicContact SD-CG2 3.58Å; M54-T58 VanDerWaalsContact SD-CG2 3.58Å; M54-E59 HydrophobicContact CE-CB 4.49Å; M54-E59 HydrophobicContact CG-CB 4.32Å; M54-L62 HydrophobicContact CE-CD1 3.7Å; M54-L62 HydrophobicContact SD-CD1 3.44Å; M54-L62 WeakPolarHBondContact SD-CD1 3.16Å
55	D	91.5	Very high	92.7	Very high	83 Å²	83	87.2 Å²	87.2	44%	0.444	50%	0.497	S	S	.	.			trans	-75.2	160.3	171.7	70.2	76.9	0	0	0	110.6	R57 T58 E59	D55-R57 VanDerWaalsContact C-N 3.25Å; D55-R57 PolarHBondContact O-N 3.15Å; D55-R57 WeakPolarHBondContact OD1-CA 3.46Å; D55-R57 VanDerWaalsContact OD1-CB 3.25Å; D55-R57 WeakPolarHBondContact OD1-CB 3.45Å; D55-R57 PolarHBondContact OD1-N 3.09Å; D55-T58 VanDerWaalsContact CG-OG1 3.32Å; D55-T58 PolarHBondContact O-N 3.05Å; D55-T58 PolarHBondContact OD1-N 2.69Å; D55-T58 PolarHBondContact OD1-OG1 3.4Å; D55-T58 PolarHBondContact OD2-OG1 3.17Å; D55-E59 PolarHBondContact O-N 2.95Å
56	S	94.9	Very high	92.8	Very high	92 Å²	92	88.9 Å²	88.9	64%	0.643	51%	0.507	S	S	*	.	H	α-helix	trans	-65.1	-26.4	-175.1	57.9	0	0	0	0	113.9	T60	S56-T60 VanDerWaalsContact O-CB 3.28Å; S56-T60 WeakPolarHBondContact O-CB 3Å; S56-T60 PolarHBondContact O-N 3.39Å; S56-T60 PolarHBondContact O-OG1 2.93Å
57	R	94.4	Very high	93.1	Very high	199 Å²	199	91 Å²	91	75%	0.751	52%	0.519	S	S	*	.	H	α-helix	trans	-72.3	-45.6	177.7	-179.7	-174.1	-67.4	-178.6	-1.2	109.7	D55 T60 C61	D55-R57 VanDerWaalsContact C-N 3.25Å; D55-R57 PolarHBondContact O-N 3.15Å; D55-R57 WeakPolarHBondContact OD1-CA 3.46Å; D55-R57 VanDerWaalsContact OD1-CB 3.25Å; D55-R57 WeakPolarHBondContact OD1-CB 3.45Å; D55-R57 PolarHBondContact OD1-N 3.09Å; R57-T60 PolarHBondContact O-N 3.08Å; R57-C61 WeakPolarHBondContact O-CB 3.49Å; R57-C61 PolarHBondContact O-N 3.25Å
58	T	95	Very high	93.6	Very high	16 Å²	16	91.4 Å²	91.4	10%	0.098	51%	0.513	C	S	.	.	H	α-helix	trans	-62.6	-45	176.7	-59.2	0	0	0	0	111	M46 M54 D55 T60 C61 L62	M46-T58 HydrophobicContact SD-CG2 3.36Å; M46-T58 WeakPolarHBondContact SD-CG2 3.25Å; M54-T58 HydrophobicContact CG-CG2 3.67Å; M54-T58 HydrophobicContact SD-CG2 3.58Å; M54-T58 VanDerWaalsContact SD-CG2 3.58Å; D55-T58 VanDerWaalsContact CG-OG1 3.32Å; D55-T58 PolarHBondContact O-N 3.05Å; D55-T58 PolarHBondContact OD1-N 2.69Å; D55-T58 PolarHBondContact OD1-OG1 3.4Å; D55-T58 PolarHBondContact OD2-OG1 3.17Å; T58-T60 PolarHBondContact O-N 3.29Å; T58-C61 WeakPolarHBondContact O-CB 3.3Å; T58-C61 PolarHBondContact O-N 3.05Å; T58-L62 WeakPolarHBondContact O-CG 3.45Å; T58-L62 PolarHBondContact O-N 3.09Å
59	E	95.6	Very high	94.3	Very high	114 Å²	114	91.5 Å²	91.5	53%	0.533	49%	0.494	S	S	.	.	H	α-helix	trans	-58.9	-48.9	175.1	-175.2	179.2	179.5	0	0	111.8	M54 D55 C61 L62 V63	M54-E59 HydrophobicContact CE-CB 4.49Å; M54-E59 HydrophobicContact CG-CB 4.32Å; D55-E59 PolarHBondContact O-N 2.95Å; E59-C61 VanDerWaalsContact C-N 3.28Å; E59-C61 PolarHBondContact O-N 3.09Å; E59-L62 PolarHBondContact O-N 3.25Å; E59-V63 WeakPolarHBondContact O-CG2 3.31Å; E59-V63 PolarHBondContact O-N 2.89Å; E59-V63 VanDerWaalsContact O-N 3.13Å
60	T	97.9	Very high	94.9	Very high	80 Å²	80	89.6 Å²	89.6	49%	0.491	47%	0.474	S	S	.	.	H	α-helix	trans	-61.2	-37.6	176.8	-59.5	0	0	0	0	111.7	S56 R57 T58 N64	S56-T60 VanDerWaalsContact O-CB 3.28Å; S56-T60 WeakPolarHBondContact O-CB 3Å; S56-T60 PolarHBondContact O-N 3.39Å; S56-T60 PolarHBondContact O-OG1 2.93Å; R57-T60 PolarHBondContact O-N 3.08Å; T58-T60 PolarHBondContact O-N 3.29Å; T60-N64 WeakPolarHBondContact CG2-ND2 3.47Å; T60-N64 WeakPolarHBondContact O-CB 3.49Å; T60-N64 PolarHBondContact O-N 3.49Å; T60-N64 VanDerWaalsContact O-N 3.13Å; T60-N64 PolarHBondContact O-ND2 3.11Å
61	C	97.9	Very high	95.6	Very high	45 Å²	45	90.4 Å²	90.4	30%	0.304	47%	0.473	S	S	.	.	H	α-helix	trans	-63.5	-47.7	176.6	-174.7	0	0	0	0	111.3	C45 R57 T58 E59 V63 N64 C65	C45-C61 WeakPolarHBondContact CA-SG 3.34Å; C45-C61 HydrophobicContact CB-CB 3.62Å; C45-C61 WeakPolarHBondContact CB-SG 3.34Å; C45-C61 WeakPolarHBondContact SG-CB 3.16Å; C45-C61 PolarHBondContact SG-O 3.21Å; C45-C61 CovalentContact SG-SG 2.04Å; C45-C61 PolarHBondContact SG-SG 2.91Å; R57-C61 WeakPolarHBondContact O-CB 3.49Å; R57-C61 PolarHBondContact O-N 3.25Å; T58-C61 WeakPolarHBondContact O-CB 3.3Å; T58-C61 PolarHBondContact O-N 3.05Å; E59-C61 VanDerWaalsContact C-N 3.28Å; E59-C61 PolarHBondContact O-N 3.09Å; C61-V63 PolarHBondContact O-N 3.37Å; C61-N64 PolarHBondContact O-N 2.92Å; C61-C65 VanDerWaalsContact O-CB 3.29Å; C61-C65 WeakPolarHBondContact O-CB 3.34Å; C61-C65 PolarHBondContact O-N 2.9Å
62	L	97.6	Very high	96.1	Very high	38 Å²	38	89.5 Å²	89.5	20%	0.199	46%	0.464	C	S	.	.	H	α-helix	trans	-60.8	-45.6	-179	-72.1	171.7	0	0	0	111.9	C41 C45 M54 T58 E59 C65 V66	C41-L62 HydrophobicContact CB-CD2 3.91Å; C45-L62 HydrophobicContact CB-CD2 3.83Å; C45-L62 HydrophobicContact CB-CG 4.09Å; M54-L62 HydrophobicContact CE-CD1 3.7Å; M54-L62 HydrophobicContact SD-CD1 3.44Å; M54-L62 WeakPolarHBondContact SD-CD1 3.16Å; T58-L62 WeakPolarHBondContact O-CG 3.45Å; T58-L62 PolarHBondContact O-N 3.09Å; E59-L62 PolarHBondContact O-N 3.25Å; L62-C65 PolarHBondContact O-N 2.98Å; L62-V66 PolarHBondContact O-N 2.83Å; L62-V66 VanDerWaalsContact O-N 3.13Å
63	V	98.2	Very high	96.4	Very high	78 Å²	78	86.8 Å²	86.8	47%	0.473	44%	0.442	S	S	.	.	H	α-helix	trans	-56.7	-53.4	175.7	173.2	0	0	0	0	110.4	E59 C61 C65 V66 D67	E59-V63 WeakPolarHBondContact O-CG2 3.31Å; E59-V63 PolarHBondContact O-N 2.89Å; E59-V63 VanDerWaalsContact O-N 3.13Å; C61-V63 PolarHBondContact O-N 3.37Å; V63-C65 VanDerWaalsContact C-N 3.29Å; V63-C65 PolarHBondContact O-N 3.45Å; V63-V66 PolarHBondContact O-N 2.91Å; V63-D67 PolarHBondContact O-N 2.77Å; V63-D67 VanDerWaalsContact O-N 3.11Å
64	N	98.6	Very high	96.7	Very high	81 Å²	81	83.3 Å²	83.3	43%	0.433	43%	0.431	S	S	.	.	H	α-helix	trans	-62.9	-35.1	179.3	-73.7	-50.5	0	0	0	112.6	T60 C61 R68	T60-N64 WeakPolarHBondContact CG2-ND2 3.47Å; T60-N64 WeakPolarHBondContact O-CB 3.49Å; T60-N64 PolarHBondContact O-N 3.49Å; T60-N64 VanDerWaalsContact O-N 3.13Å; T60-N64 PolarHBondContact O-ND2 3.11Å; C61-N64 PolarHBondContact O-N 2.92Å; N64-R68 VanDerWaalsContact O-CB 3.25Å; N64-R68 WeakPolarHBondContact O-CB 3.46Å; N64-R68 WeakPolarHBondContact O-CG 3.46Å; N64-R68 PolarHBondContact O-N 3.18Å
65	C	98.7	Very high	97.1	Very high	24 Å²	24	82.3 Å²	82.3	16%	0.162	43%	0.434	C	S	.	.	H	α-helix	trans	-62.8	-48	-180	175.5	0	0	0	0	111.1	C41 C61 L62 V63 F69	C41-C65 WeakPolarHBondContact CA-SG 3.46Å; C41-C65 HydrophobicContact CB-CB 3.74Å; C41-C65 WeakPolarHBondContact CB-SG 3.39Å; C41-C65 VanDerWaalsContact SG-C 3.59Å; C41-C65 WeakPolarHBondContact SG-CB 3.42Å; C41-C65 CovalentContact SG-SG 2.05Å; C41-C65 PolarHBondContact SG-SG 3.41Å; C61-C65 VanDerWaalsContact O-CB 3.29Å; C61-C65 WeakPolarHBondContact O-CB 3.34Å; C61-C65 PolarHBondContact O-N 2.9Å; L62-C65 PolarHBondContact O-N 2.98Å; V63-C65 VanDerWaalsContact C-N 3.29Å; V63-C65 PolarHBondContact O-N 3.45Å; C65-F69 WeakPolarHBondContact O-CB 3.4Å; C65-F69 PolarHBondContact O-N 3.38Å
66	V	98.6	Very high	97.4	Very high	44 Å²	44	83.7 Å²	83.7	27%	0.267	44%	0.44	S	S	.	.	H	α-helix	trans	-64.2	-49	178.7	178	0	0	0	0	110.8	F37 L62 V63 R68 F69 I70	F37-V66 HydrophobicContact CB-CG2 4.29Å; F37-V66 HydrophobicContact CD2-CG1 4.09Å; L62-V66 PolarHBondContact O-N 2.83Å; L62-V66 VanDerWaalsContact O-N 3.13Å; V63-V66 PolarHBondContact O-N 2.91Å; V66-R68 VanDerWaalsContact C-N 3.35Å; V66-R68 PolarHBondContact O-N 2.95Å; V66-F69 WeakPolarHBondContact O-CB 3.41Å; V66-F69 PolarHBondContact O-N 3.39Å; V66-F69 VanDerWaalsContact O-N 3.17Å; V66-I70 HydrophobicContact CG1-CD1 3.94Å; V66-I70 WeakPolarHBondContact O-CG1 3.5Å; V66-I70 PolarHBondContact O-N 3.36Å
67	D	98.6	Very high	97.5	Very high	83 Å²	83	82.7 Å²	82.7	44%	0.444	43%	0.431	S	S	.	.	H	α-helix	trans	-57.3	-48.3	179.5	-72.3	-18.8	0	0	0	111.1	V63 F69 I70 D71	V63-D67 PolarHBondContact O-N 2.77Å; V63-D67 VanDerWaalsContact O-N 3.11Å; D67-F69 VanDerWaalsContact C-N 3.33Å; D67-F69 PolarHBondContact O-N 2.93Å; D67-I70 PolarHBondContact O-N 2.9Å; D67-D71 WeakPolarHBondContact O-CB 3.47Å; D67-D71 PolarHBondContact O-N 2.87Å
68	R	98.4	Very high	97.7	Very high	182 Å²	182	76.9 Å²	76.9	69%	0.687	42%	0.415	S	S	*	.	H	α-helix	trans	-67.7	-32.2	179.7	-67.4	-166.6	98	169.6	10.5	112.9	N64 V66 T72	N64-R68 VanDerWaalsContact O-CB 3.25Å; N64-R68 WeakPolarHBondContact O-CB 3.46Å; N64-R68 WeakPolarHBondContact O-CG 3.46Å; N64-R68 PolarHBondContact O-N 3.18Å; V66-R68 VanDerWaalsContact C-N 3.35Å; V66-R68 PolarHBondContact O-N 2.95Å; R68-T72 WeakPolarHBondContact O-CB 3Å; R68-T72 PolarHBondContact O-N 3.35Å; R68-T72 PolarHBondContact O-OG1 3.16Å
69	F	98.1	Very high	97.7	Very high	71 Å²	71	83.8 Å²	83.8	31%	0.311	44%	0.439	S	S	.	.	H	α-helix	trans	-64	-47	175.1	-170.3	-78.1	0	0	0	110.7	F37 V40 C65 V66 D67 T73	F37-F69 AromaticContact CD1-CD1 3.94Å; F37-F69 HydrophobicContact CD1-CD1 3.94Å; F37-F69 HydrophobicContact CD1-CE1 4.2Å; F37-F69 HydrophobicContact CD1-CG 4.36Å; F37-F69 AromaticContact CE1-CD1 3.4Å; F37-F69 HydrophobicContact CE1-CD1 3.4Å; F37-F69 AromaticContact CE1-CE1 3.58Å; F37-F69 HydrophobicContact CE1-CE1 3.58Å; F37-F69 HydrophobicContact CE1-CG 4.23Å; F37-F69 HydrophobicContact CE1-CZ 4.49Å; F37-F69 HydrophobicContact CZ-CD1 4.3Å; V40-F69 HydrophobicContact CG1-CD2 4.24Å; V40-F69 HydrophobicContact CG1-CE2 4.31Å; C65-F69 WeakPolarHBondContact O-CB 3.4Å; C65-F69 PolarHBondContact O-N 3.38Å; V66-F69 WeakPolarHBondContact O-CB 3.41Å; V66-F69 PolarHBondContact O-N 3.39Å; V66-F69 VanDerWaalsContact O-N 3.17Å; D67-F69 VanDerWaalsContact C-N 3.33Å; D67-F69 PolarHBondContact O-N 2.93Å; F69-T73 WeakPolarHBondContact CE1-OG1 3Å; F69-T73 VanDerWaalsContact O-CB 3.31Å; F69-T73 WeakPolarHBondContact O-CB 3.48Å; F69-T73 PolarHBondContact O-N 2.91Å; F69-T73 PolarHBondContact O-OG1 2.95Å
70	I	97.8	Very high	97.8	Very high	78 Å²	78	84.5 Å²	84.5	40%	0.4	44%	0.44	S	S	.	.	H	α-helix	trans	-63.5	-50.1	178.9	-65.6	169.5	0	0	0	110.2	F37 V66 D67 T72 T73 L74	F37-I70 HydrophobicContact CE2-CD1 4.33Å; F37-I70 HydrophobicContact CE2-CG1 4.38Å; F37-I70 HydrophobicContact CZ-CG1 4.1Å; V66-I70 HydrophobicContact CG1-CD1 3.94Å; V66-I70 WeakPolarHBondContact O-CG1 3.5Å; V66-I70 PolarHBondContact O-N 3.36Å; D67-I70 PolarHBondContact O-N 2.9Å; I70-T72 VanDerWaalsContact C-N 3.33Å; I70-T72 PolarHBondContact O-N 2.93Å; I70-T73 PolarHBondContact O-N 3.33Å; I70-L74 WeakPolarHBondContact O-CB 3.46Å; I70-L74 PolarHBondContact O-N 2.04Å
71	D	98.1	Very high	97.7	Very high	104 Å²	104	83.6 Å²	83.6	56%	0.556	44%	0.435	S	S	*	.	H	α-helix	trans	-57.3	-45.9	179.4	-76.9	-17.7	0	0	0	112	D67 L74 S75	D67-D71 WeakPolarHBondContact O-CB 3.47Å; D67-D71 PolarHBondContact O-N 2.87Å; D71-L74 PolarHBondContact O-N 2.05Å; D71-S75 VanDerWaalsContact O-CB 3.27Å; D71-S75 WeakPolarHBondContact O-CB 3.03Å; D71-S75 PolarHBondContact O-N 3.13Å
72	T	97.5	Very high	97.6	Very high	76 Å²	76	86.1 Å²	86.1	47%	0.466	44%	0.442	S	S	.	.	H	α-helix	trans	-66.7	-43.7	-179.4	-57.3	0	0	0	0	110.8	R68 I70 L74 S75 I76	R68-T72 WeakPolarHBondContact O-CB 3Å; R68-T72 PolarHBondContact O-N 3.35Å; R68-T72 PolarHBondContact O-OG1 3.16Å; I70-T72 VanDerWaalsContact C-N 3.33Å; I70-T72 PolarHBondContact O-N 2.93Å; T72-L74 PolarHBondContact O-N 3.19Å; T72-S75 PolarHBondContact O-N 2.9Å; T72-I76 HydrophobicContact CG2-CD1 3.79Å; T72-I76 HydrophobicContact CG2-CG1 4.41Å; T72-I76 VanDerWaalsContact O-CG1 3.29Å; T72-I76 WeakPolarHBondContact O-CG1 3.08Å; T72-I76 PolarHBondContact O-N 3.32Å
73	T	96.9	Very high	97.5	Very high	64 Å²	64	88.9 Å²	88.9	39%	0.393	46%	0.455	S	S	.	.	H	α-helix	trans	-60.9	-45.5	178.2	-59.9	0	0	0	0	111.2	F69 I70 I76 T77	F69-T73 WeakPolarHBondContact CE1-OG1 3Å; F69-T73 VanDerWaalsContact O-CB 3.31Å; F69-T73 WeakPolarHBondContact O-CB 3.48Å; F69-T73 PolarHBondContact O-N 2.91Å; F69-T73 PolarHBondContact O-OG1 2.95Å; I70-T73 PolarHBondContact O-N 3.33Å; T73-I76 PolarHBondContact O-N 2.98Å; T73-T77 VanDerWaalsContact O-CB 3.3Å; T73-T77 WeakPolarHBondContact O-CB 3.44Å; T73-T77 PolarHBondContact O-N 2.82Å; T73-T77 PolarHBondContact O-OG1 3.46Å
74	L	97.6	Very high	97.3	Very high	97 Å²	97	89.1 Å²	89.1	51%	0.508	46%	0.456	S	S	.	.	H	α-helix	trans	-64.8	-43.7	177.7	-178.8	59.5	0	0	0	111.4	I70 D71 T72 I76 T77 N78	I70-L74 WeakPolarHBondContact O-CB 3.46Å; I70-L74 PolarHBondContact O-N 2.04Å; D71-L74 PolarHBondContact O-N 2.05Å; T72-L74 PolarHBondContact O-N 3.19Å; L74-I76 PolarHBondContact O-N 2.77Å; L74-T77 PolarHBondContact O-N 3.3Å; L74-N78 WeakPolarHBondContact CD1-ND2 3.36Å; L74-N78 WeakPolarHBondContact CG-ND2 3.44Å; L74-N78 VanDerWaalsContact O-CB 3.27Å; L74-N78 WeakPolarHBondContact O-CB 3.29Å; L74-N78 PolarHBondContact O-N 3.11Å; L74-N78 PolarHBondContact O-ND2 3.23Å
75	S	97.8	Very high	97	Very high	80 Å²	80	91.1 Å²	91.1	56%	0.559	46%	0.463	S	S	*	.	H	α-helix	trans	-59.1	-47.6	177.4	-176.2	0	0	0	0	112.1	D71 T72 R79	D71-S75 VanDerWaalsContact O-CB 3.27Å; D71-S75 WeakPolarHBondContact O-CB 3.03Å; D71-S75 PolarHBondContact O-N 3.13Å; T72-S75 PolarHBondContact O-N 2.9Å; S75-R79 WeakPolarHBondContact O-CB 3.4Å; S75-R79 PolarHBondContact O-N 3.39Å
76	I	97.5	Very high	96.4	Very high	111 Å²	111	97.4 Å²	97.4	57%	0.569	49%	0.488	S	S	*	.	H	α-helix	trans	-63.5	-47.5	177.3	-67.8	169.7	0	0	0	110.7	T72 T73 L74 N78 R79 F80	T72-I76 HydrophobicContact CG2-CD1 3.79Å; T72-I76 HydrophobicContact CG2-CG1 4.41Å; T72-I76 VanDerWaalsContact O-CG1 3.29Å; T72-I76 WeakPolarHBondContact O-CG1 3.08Å; T72-I76 PolarHBondContact O-N 3.32Å; T73-I76 PolarHBondContact O-N 2.98Å; L74-I76 PolarHBondContact O-N 2.77Å; I76-N78 PolarHBondContact O-N 3.35Å; I76-R79 PolarHBondContact O-N 3.32Å; I76-F80 WeakPolarHBondContact O-CB 3.45Å; I76-F80 PolarHBondContact O-N 3.25Å
77	T	97.6	Very high	95.3	Very high	72 Å²	72	98.3 Å²	98.3	44%	0.442	51%	0.506	S	S	.	.	H	α-helix	trans	-61.9	-43	-178.8	-58.4	0	0	0	0	111.8	T73 L74 F80 T81	T73-T77 VanDerWaalsContact O-CB 3.3Å; T73-T77 WeakPolarHBondContact O-CB 3.44Å; T73-T77 PolarHBondContact O-N 2.82Å; T73-T77 PolarHBondContact O-OG1 3.46Å; L74-T77 PolarHBondContact O-N 3.3Å; T77-F80 PolarHBondContact O-N 3.48Å; T77-T81 WeakPolarHBondContact O-CB 3.37Å; T77-T81 PolarHBondContact O-N 2.74Å; T77-T81 PolarHBondContact O-OG1 3.13Å
78	N	97.1	Very high	93.6	Very high	77 Å²	77	98.4 Å²	98.4	41%	0.412	52%	0.518	S	S	.	.	H	α-helix	trans	-64.2	-44.4	177	-74.9	-23.3	0	0	0	111.3	L74 I76 F80 T81 Q82	L74-N78 WeakPolarHBondContact CD1-ND2 3.36Å; L74-N78 WeakPolarHBondContact CG-ND2 3.44Å; L74-N78 VanDerWaalsContact O-CB 3.27Å; L74-N78 WeakPolarHBondContact O-CB 3.29Å; L74-N78 PolarHBondContact O-N 3.11Å; L74-N78 PolarHBondContact O-ND2 3.23Å; I76-N78 PolarHBondContact O-N 3.35Å; N78-F80 VanDerWaalsContact C-N 3.34Å; N78-F80 PolarHBondContact O-N 3.19Å; N78-T81 PolarHBondContact O-N 3.39Å; N78-Q82 VanDerWaalsContact O-CG 3.3Å; N78-Q82 WeakPolarHBondContact O-CG 3.47Å; N78-Q82 PolarHBondContact O-N 3.13Å
79	R	96.4	Very high	91.3	Very high	160 Å²	160	100.5 Å²	100.5	60%	0.604	54%	0.535	S	S	*	.	H	α-helix	trans	-62	-43.2	176.6	178.9	56.7	177	-94.6	-0.2	111.4	S75 I76 Q82 M83	S75-R79 WeakPolarHBondContact O-CB 3.4Å; S75-R79 PolarHBondContact O-N 3.39Å; I76-R79 PolarHBondContact O-N 3.32Å; R79-Q82 PolarHBondContact O-N 2.72Å; R79-M83 HydrophobicContact CG-CE 4.38Å; R79-M83 WeakPolarHBondContact O-CG 3.28Å; R79-M83 PolarHBondContact O-N 2.97Å; R79-M83 VanDerWaalsContact O-N 3.1Å
80	F	97.1	Very high	91	Very high	130 Å²	130	102 Å²	102	57%	0.57	55%	0.547	S	S	*	.	H	α-helix	trans	-62.6	-47.7	177.8	-174.3	-101.3	0	0	0	111.7	I76 T77 N78 Q82 M83 V84	I76-F80 WeakPolarHBondContact O-CB 3.45Å; I76-F80 PolarHBondContact O-N 3.25Å; T77-F80 PolarHBondContact O-N 3.48Å; N78-F80 VanDerWaalsContact C-N 3.34Å; N78-F80 PolarHBondContact O-N 3.19Å; F80-Q82 VanDerWaalsContact C-N 3.31Å; F80-Q82 PolarHBondContact O-N 2.86Å; F80-M83 HydrophobicContact CD2-CE 4.14Å; F80-M83 PolarHBondContact O-N 3.36Å; F80-V84 HydrophobicContact CD1-CG2 4.07Å; F80-V84 HydrophobicContact CE1-CG2 3.64Å; F80-V84 HydrophobicContact CE2-CG2 4.38Å; F80-V84 HydrophobicContact CZ-CG2 3.82Å; F80-V84 WeakPolarHBondContact O-CG2 3.44Å; F80-V84 PolarHBondContact O-N 3.26Å
81	T	96.4	Very high	90.6	Very high	60 Å²	60	103.2 Å²	103.2	37%	0.368	55%	0.554	S	S	.	*	H	α-helix	trans	-55.2	-45.4	175.8	-59	0	0	0	0	111.8	T77 N78 M83 V84 Q85	T77-T81 WeakPolarHBondContact O-CB 3.37Å; T77-T81 PolarHBondContact O-N 2.74Å; T77-T81 PolarHBondContact O-OG1 3.13Å; N78-T81 PolarHBondContact O-N 3.39Å; T81-M83 VanDerWaalsContact C-N 3.32Å; T81-M83 PolarHBondContact O-N 3.02Å; T81-V84 PolarHBondContact O-N 2.86Å; T81-Q85 WeakPolarHBondContact O-CG 3.47Å; T81-Q85 PolarHBondContact O-N 3.27Å
82	Q	94.8	Very high	90.2	Very high	99 Å²	99	103.2 Å²	103.2	46%	0.463	55%	0.554	S	S	.	*	H	α-helix	trans	-62.4	-36.8	176.9	-71.4	172.6	26.6	0	0	113	N78 R79 F80 K86	N78-Q82 VanDerWaalsContact O-CG 3.3Å; N78-Q82 WeakPolarHBondContact O-CG 3.47Å; N78-Q82 PolarHBondContact O-N 3.13Å; R79-Q82 PolarHBondContact O-N 2.72Å; F80-Q82 VanDerWaalsContact C-N 3.31Å; F80-Q82 PolarHBondContact O-N 2.86Å; Q82-K86 WeakPolarHBondContact O-CB 3.25Å; Q82-K86 VanDerWaalsContact O-CG 3.28Å; Q82-K86 WeakPolarHBondContact O-CG 3.37Å; Q82-K86 PolarHBondContact O-N 3.01Å; Q82-K86 VanDerWaalsContact O-N 3.16Å
83	M	95.1	Very high	89.8	Confident	96 Å²	96	104.8 Å²	104.8	47%	0.473	56%	0.559	S	S	.	*	H	α-helix	trans	-69.4	-43.1	177.4	-69.3	-173.7	-57.7	0	0	111.6	R79 F80 T81 K86 G87	R79-M83 HydrophobicContact CG-CE 4.38Å; R79-M83 WeakPolarHBondContact O-CG 3.28Å; R79-M83 PolarHBondContact O-N 2.97Å; R79-M83 VanDerWaalsContact O-N 3.1Å; F80-M83 HydrophobicContact CD2-CE 4.14Å; F80-M83 PolarHBondContact O-N 3.36Å; T81-M83 VanDerWaalsContact C-N 3.32Å; T81-M83 PolarHBondContact O-N 3.02Å; M83-K86 PolarHBondContact O-N 3.43Å; M83-G87 PolarHBondContact O-N 2.77Å
84	V	95.3	Very high	89.3	Confident	82 Å²	82	107.3 Å²	107.3	50%	0.497	57%	0.57	S	S	.	*	H	α-helix	trans	-61.7	-44.4	176.9	172.8	0	0	0	0	111.1	F80 T81 K86 G87 A88	F80-V84 HydrophobicContact CD1-CG2 4.07Å; F80-V84 HydrophobicContact CE1-CG2 3.64Å; F80-V84 HydrophobicContact CE2-CG2 4.38Å; F80-V84 HydrophobicContact CZ-CG2 3.82Å; F80-V84 WeakPolarHBondContact O-CG2 3.44Å; F80-V84 PolarHBondContact O-N 3.26Å; T81-V84 PolarHBondContact O-N 2.86Å; V84-K86 VanDerWaalsContact C-N 3.33Å; V84-K86 PolarHBondContact O-N 3.27Å; V84-G87 PolarHBondContact O-N 2.9Å; V84-A88 PolarHBondContact O-N 3.16Å
85	Q	91.8	Very high	88.8	Confident	123 Å²	123	108 Å²	108	58%	0.575	57%	0.574	S	S	*	*	H	α-helix	trans	-63.1	-37.9	177.5	-72.7	173.2	-6.8	0	0	112.7	T81	T81-Q85 WeakPolarHBondContact O-CG 3.47Å; T81-Q85 PolarHBondContact O-N 3.27Å
86	K	85.6	Confident	88.1	Confident	156 Å²	156	110 Å²	110	68%	0.678	58%	0.575	S	S	*	*	H	α-helix	trans	-74.4	-31.3	179	-74.9	175.7	-179.7	-179.5	0	113.7	Q82 M83 V84 A88	Q82-K86 WeakPolarHBondContact O-CB 3.25Å; Q82-K86 VanDerWaalsContact O-CG 3.28Å; Q82-K86 WeakPolarHBondContact O-CG 3.37Å; Q82-K86 PolarHBondContact O-N 3.01Å; Q82-K86 VanDerWaalsContact O-N 3.16Å; M83-K86 PolarHBondContact O-N 3.43Å; V84-K86 VanDerWaalsContact C-N 3.33Å; V84-K86 PolarHBondContact O-N 3.27Å; K86-A88 VanDerWaalsContact C-N 3.33Å
87	G	75	Confident	87.4	Confident	64 Å²	64	109.9 Å²	109.9	66%	0.66	58%	0.575	S	S	*	*	H	α-helix	trans	-83.4	-5.2	177.5	0	0	0	0	0	114.7	M83 V84 H89	M83-G87 PolarHBondContact O-N 2.77Å; V84-G87 PolarHBondContact O-N 2.9Å; G87-H89 VanDerWaalsContact C-N 3.25Å
88	A	63.8	Low	86.6	Confident	84 Å²	84	113.1 Å²	113.1	69%	0.694	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.3	3.3	172.6	0	0	0	0	0	113.2	V84 K86	V84-A88 PolarHBondContact O-N 3.16Å; K86-A88 VanDerWaalsContact C-N 3.33Å
89	H	50.3	Low	85.6	Confident	226 Å²	226	116.4 Å²	116.4	100%	1.046	60%	0.603	S	S	*	*			trans	-116.9	0	170.1	-70.5	-61.7	0	0	0	109.6	G87	G87-H89 VanDerWaalsContact C-N 3.25Å

Retrieved 89 of 89 residues in 70.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).