A0A060WQB5_ONCMY Loading...

Transmembrane protein 240

AlphaFold DB , UniProt , Accession A0A060WQB5, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110494371, Length 175 aa.

						>A0A060WQB5_ONCMY|A0A060WQB5|LOC110494371
MQMATTTMIFMILGASLVMAVACLTDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHVHYVIPYDGDQSLVDSAENYFVSDSVTKQELDLMLGLLLGFLLSWLLLWLDGALHAALRAWRAKQHHDVFSWSWVPRFCNLRDLGRRVHLRKLEDSSGNMVHIKQKLYHNGHPSPRNL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.5	Very low	60	Low	219 Å²	219	114.3 Å²	114.3	100%	1.079	60%	0.596	S	S	*	*				0	-30.5	0	-78.7	171.2	152.6	0	0	114	M3 A4	M1-M3 VanDerWaalsContact C-N 3.33Å; M1-M3 PolarHBondContact O-N 3.07Å; M1-A4 PolarHBondContact O-N 3.46Å
2	Q	49.6	Very low	60.9	Low	166 Å²	166	113.7 Å²	113.7	78%	0.776	59%	0.592	S	S	*	*	H	α-helix	trans	-65.8	-25.1	-178	-137.1	165.2	-10.9	0	0	115.8	T5 T6	Q2-T5 PolarHBondContact O-OG1 3.23Å; Q2-T5 VanDerWaalsContact O-OG1 3.12Å; Q2-T6 WeakPolarHBondContact O-CG2 3.48Å; Q2-T6 PolarHBondContact O-N 2.96Å; Q2-T6 PolarHBondContact O-OG1 3.3Å
3	M	53.3	Low	61.7	Low	135 Å²	135	113.2 Å²	113.2	67%	0.665	59%	0.59	S	S	*	*	H	α-helix	trans	-76	-24.6	175.9	-65.3	-75	-103.1	0	0	112.9	M1 T6 T7	M1-M3 VanDerWaalsContact C-N 3.33Å; M1-M3 PolarHBondContact O-N 3.07Å; M3-T6 WeakPolarHBondContact CA-OG1 3.27Å; M3-T6 PolarHBondContact O-OG1 2.97Å; M3-T6 VanDerWaalsContact O-OG1 3.12Å; M3-T7 VanDerWaalsContact O-CG2 3.3Å; M3-T7 WeakPolarHBondContact O-CG2 3.32Å; M3-T7 PolarHBondContact O-N 3.24Å; M3-T7 PolarHBondContact O-OG1 3.19Å
4	A	57	Low	62.4	Low	58 Å²	58	107.4 Å²	107.4	48%	0.479	57%	0.572	S	S	.	*	H	α-helix	trans	-84.4	-32.6	-179.7	0	0	0	0	0	112	M1 T7 M8	M1-A4 PolarHBondContact O-N 3.46Å; A4-T7 PolarHBondContact O-OG1 2.79Å; A4-M8 WeakPolarHBondContact O-CB 3.42Å; A4-M8 WeakPolarHBondContact O-CG 3.42Å; A4-M8 PolarHBondContact O-N 3.35Å; A4-M8 VanDerWaalsContact O-N 3.1Å
5	T	60.2	Low	62.5	Low	75 Å²	75	104.2 Å²	104.2	46%	0.46	57%	0.566	S	S	.	*	H	α-helix	trans	-72	-38.3	175.5	43.3	0	0	0	0	111.8	Q2 M8 I9	Q2-T5 PolarHBondContact O-OG1 3.23Å; Q2-T5 VanDerWaalsContact O-OG1 3.12Å; T5-M8 PolarHBondContact O-N 3.25Å; T5-I9 WeakPolarHBondContact O-CB 3.13Å; T5-I9 WeakPolarHBondContact O-CD1 3.45Å; T5-I9 WeakPolarHBondContact O-CG1 3.44Å; T5-I9 PolarHBondContact O-N 3.48Å
6	T	59.7	Low	62.9	Low	61 Å²	61	102.3 Å²	102.3	37%	0.374	56%	0.563	S	S	.	*	H	α-helix	trans	-65.2	-44.6	175.9	43	0	0	0	0	111.7	Q2 M3 M8 I9 F10	Q2-T6 WeakPolarHBondContact O-CG2 3.48Å; Q2-T6 PolarHBondContact O-N 2.96Å; Q2-T6 PolarHBondContact O-OG1 3.3Å; M3-T6 WeakPolarHBondContact CA-OG1 3.27Å; M3-T6 PolarHBondContact O-OG1 2.97Å; M3-T6 VanDerWaalsContact O-OG1 3.12Å; T6-M8 PolarHBondContact O-N 2.9Å; T6-I9 PolarHBondContact O-N 3.41Å; T6-F10 WeakPolarHBondContact O-CD2 3.18Å; T6-F10 PolarHBondContact O-N 3.39Å
7	T	60.6	Low	63.4	Low	79 Å²	79	102.9 Å²	102.9	49%	0.485	57%	0.565	S	S	.	*	H	α-helix	trans	-65.1	-38.8	175.9	54.3	0	0	0	0	112.8	M3 A4 F10 M11	M3-T7 VanDerWaalsContact O-CG2 3.3Å; M3-T7 WeakPolarHBondContact O-CG2 3.32Å; M3-T7 PolarHBondContact O-N 3.24Å; M3-T7 PolarHBondContact O-OG1 3.19Å; A4-T7 PolarHBondContact O-OG1 2.79Å; T7-F10 PolarHBondContact O-N 3.43Å; T7-M11 WeakPolarHBondContact O-CG 3.16Å; T7-M11 PolarHBondContact O-N 3.08Å
8	M	67	Low	63.5	Low	112 Å²	112	102.6 Å²	102.6	55%	0.552	57%	0.566	S	S	*	*	H	α-helix	trans	-62.4	-44.4	172.4	-83	-173.7	66.9	0	0	112.3	A4 T5 T6 F10 M11 I12	A4-M8 WeakPolarHBondContact O-CB 3.42Å; A4-M8 WeakPolarHBondContact O-CG 3.42Å; A4-M8 PolarHBondContact O-N 3.35Å; A4-M8 VanDerWaalsContact O-N 3.1Å; T5-M8 PolarHBondContact O-N 3.25Å; T6-M8 PolarHBondContact O-N 2.9Å; M8-F10 VanDerWaalsContact C-N 3.33Å; M8-F10 PolarHBondContact O-N 3.12Å; M8-M11 PolarHBondContact O-N 3.41Å; M8-I12 WeakPolarHBondContact O-CB 3.38Å; M8-I12 WeakPolarHBondContact O-CD1 3.36Å; M8-I12 WeakPolarHBondContact O-CG1 3.42Å; M8-I12 PolarHBondContact O-N 2.76Å
9	I	70.3	Confident	63.7	Low	93 Å²	93	103.5 Å²	103.5	48%	0.477	57%	0.567	S	S	.	*	H	α-helix	trans	-62.2	-42.3	177.8	-69.8	162.5	0	0	0	110.5	T5 T6 I12 L13	T5-I9 WeakPolarHBondContact O-CB 3.13Å; T5-I9 WeakPolarHBondContact O-CD1 3.45Å; T5-I9 WeakPolarHBondContact O-CG1 3.44Å; T5-I9 PolarHBondContact O-N 3.48Å; T6-I9 PolarHBondContact O-N 3.41Å; I9-I12 PolarHBondContact O-N 3.21Å; I9-L13 HydrophobicContact CG2-CD1 3.69Å; I9-L13 HydrophobicContact CG2-CG 4.29Å; I9-L13 WeakPolarHBondContact O-CB 3.23Å; I9-L13 VanDerWaalsContact O-CG 3.31Å; I9-L13 WeakPolarHBondContact O-CG 3.35Å; I9-L13 PolarHBondContact O-N 3.48Å
10	F	64.8	Low	63.8	Low	125 Å²	125	100.5 Å²	100.5	55%	0.548	56%	0.557	S	S	.	*	H	α-helix	trans	-65.3	-39.9	176.1	-84.9	-69	0	0	0	113	T6 T7 M8 G14	T6-F10 WeakPolarHBondContact O-CD2 3.18Å; T6-F10 PolarHBondContact O-N 3.39Å; T7-F10 PolarHBondContact O-N 3.43Å; M8-F10 VanDerWaalsContact C-N 3.33Å; M8-F10 PolarHBondContact O-N 3.12Å; F10-G14 PolarHBondContact O-N 2.78Å
11	M	67.8	Low	63.7	Low	134 Å²	134	99.4 Å²	99.4	66%	0.66	55%	0.552	S	S	*	*	H	α-helix	trans	-66	-39.1	175.3	-72.6	-158.4	-64	0	0	112	T7 M8 A15	T7-M11 WeakPolarHBondContact O-CG 3.16Å; T7-M11 PolarHBondContact O-N 3.08Å; M8-M11 PolarHBondContact O-N 3.41Å; M11-A15 WeakPolarHBondContact O-CB 3.27Å; M11-A15 PolarHBondContact O-N 3.41Å
12	I	71.3	Confident	64.1	Low	107 Å²	107	91.1 Å²	91.1	55%	0.549	52%	0.519	S	S	.	.	H	α-helix	trans	-68.6	-44.3	177.1	-66.7	164.2	0	0	0	110.8	M8 I9 A15 S16	M8-I12 WeakPolarHBondContact O-CB 3.38Å; M8-I12 WeakPolarHBondContact O-CD1 3.36Å; M8-I12 WeakPolarHBondContact O-CG1 3.42Å; M8-I12 PolarHBondContact O-N 2.76Å; I9-I12 PolarHBondContact O-N 3.21Å; I12-A15 PolarHBondContact O-N 2.91Å; I12-S16 WeakPolarHBondContact O-CB 3.08Å; I12-S16 PolarHBondContact O-N 3.38Å
13	L	71.3	Confident	64.4	Low	107 Å²	107	86.4 Å²	86.4	56%	0.56	50%	0.503	S	S	*	.	H	α-helix	trans	-65.6	-40.8	176.4	-75.1	170.7	0	0	0	111.6	I9 S16 L17	I9-L13 HydrophobicContact CG2-CD1 3.69Å; I9-L13 HydrophobicContact CG2-CG 4.29Å; I9-L13 WeakPolarHBondContact O-CB 3.23Å; I9-L13 VanDerWaalsContact O-CG 3.31Å; I9-L13 WeakPolarHBondContact O-CG 3.35Å; I9-L13 PolarHBondContact O-N 3.48Å; L13-S16 PolarHBondContact O-N 2.9Å; L13-L17 VanDerWaalsContact O-CB 3.25Å; L13-L17 WeakPolarHBondContact O-CB 3.17Å; L13-L17 PolarHBondContact O-N 3.28Å
14	G	70.8	Confident	64.7	Low	33 Å²	33	85.7 Å²	85.7	34%	0.34	50%	0.502	S	S	.	.	H	α-helix	trans	-64.2	-46.8	175.2	0	0	0	0	0	112.1	F10 L17 V18	F10-G14 PolarHBondContact O-N 2.78Å; G14-L17 PolarHBondContact O-N 3.02Å; G14-V18 WeakPolarHBondContact O-CB 3.42Å; G14-V18 VanDerWaalsContact O-CG2 3.29Å; G14-V18 WeakPolarHBondContact O-CG2 3.37Å; G14-V18 PolarHBondContact O-N 3.38Å
15	A	65.1	Low	64.8	Low	59 Å²	59	86 Å²	86	49%	0.488	50%	0.498	S	S	.	.	H	α-helix	trans	-63.7	-41.9	175.6	0	0	0	0	0	111.9	M11 I12 L17 V18 M19	M11-A15 WeakPolarHBondContact O-CB 3.27Å; M11-A15 PolarHBondContact O-N 3.41Å; I12-A15 PolarHBondContact O-N 2.91Å; A15-L17 VanDerWaalsContact C-N 3.35Å; A15-L17 PolarHBondContact O-N 2.78Å; A15-V18 PolarHBondContact O-N 3.35Å; A15-M19 VanDerWaalsContact O-CB 3.31Å; A15-M19 WeakPolarHBondContact O-CB 3.16Å; A15-M19 VanDerWaalsContact O-CG 3.27Å; A15-M19 WeakPolarHBondContact O-CG 3.22Å; A15-M19 PolarHBondContact O-N 3.23Å
16	S	68.7	Low	64.6	Low	74 Å²	74	87.1 Å²	87.1	52%	0.517	50%	0.501	S	S	.	.	H	α-helix	trans	-65.2	-37.1	176.3	-173.9	0	0	0	0	112.2	I12 L13 A20	I12-S16 WeakPolarHBondContact O-CB 3.08Å; I12-S16 PolarHBondContact O-N 3.38Å; L13-S16 PolarHBondContact O-N 2.9Å; S16-A20 WeakPolarHBondContact O-CB 3.28Å; S16-A20 PolarHBondContact O-N 2.86Å
17	L	71	Confident	64.1	Low	113 Å²	113	89.5 Å²	89.5	59%	0.592	51%	0.509	S	S	*	.	H	α-helix	trans	-70.2	-45	177.1	-175.1	72.7	0	0	0	111	L13 G14 A15 M19 A20 V21	L13-L17 VanDerWaalsContact O-CB 3.25Å; L13-L17 WeakPolarHBondContact O-CB 3.17Å; L13-L17 PolarHBondContact O-N 3.28Å; G14-L17 PolarHBondContact O-N 3.02Å; A15-L17 VanDerWaalsContact C-N 3.35Å; A15-L17 PolarHBondContact O-N 2.78Å; L17-M19 VanDerWaalsContact C-N 3.34Å; L17-A20 PolarHBondContact O-N 3Å; L17-V21 WeakPolarHBondContact O-CB 3.43Å; L17-V21 VanDerWaalsContact O-CG2 3.27Å; L17-V21 WeakPolarHBondContact O-CG2 3.32Å; L17-V21 PolarHBondContact O-N 2.79Å
18	V	64.5	Low	63.8	Low	96 Å²	96	91.2 Å²	91.2	58%	0.582	52%	0.515	S	S	*	.	H	α-helix	trans	-62.4	-43.2	176.3	171.7	0	0	0	0	110.7	G14 A15 V21 A22	G14-V18 WeakPolarHBondContact O-CB 3.42Å; G14-V18 VanDerWaalsContact O-CG2 3.29Å; G14-V18 WeakPolarHBondContact O-CG2 3.37Å; G14-V18 PolarHBondContact O-N 3.38Å; A15-V18 PolarHBondContact O-N 3.35Å; V18-V21 PolarHBondContact O-N 3.49Å; V18-A22 VanDerWaalsContact O-CB 3.27Å; V18-A22 WeakPolarHBondContact O-CB 3.49Å; V18-A22 PolarHBondContact O-N 3.43Å
19	M	67.4	Low	63	Low	121 Å²	121	87.9 Å²	87.9	60%	0.596	51%	0.506	S	S	*	.	H	α-helix	trans	-63.9	-42.4	173.6	-75.9	-63.6	-61.7	0	0	112	A15 L17 A22 C23	A15-M19 VanDerWaalsContact O-CB 3.31Å; A15-M19 WeakPolarHBondContact O-CB 3.16Å; A15-M19 VanDerWaalsContact O-CG 3.27Å; A15-M19 WeakPolarHBondContact O-CG 3.22Å; A15-M19 PolarHBondContact O-N 3.23Å; L17-M19 VanDerWaalsContact C-N 3.34Å; M19-A22 PolarHBondContact O-N 2.78Å; M19-C23 WeakPolarHBondContact O-CB 3.36Å; M19-C23 PolarHBondContact O-N 3.48Å; M19-C23 PolarHBondContact O-SG 3.3Å
20	A	65.4	Low	61.8	Low	43 Å²	43	86.6 Å²	86.6	36%	0.355	50%	0.5	S	S	.	.	H	α-helix	trans	-64.9	-41.3	177.5	0	0	0	0	0	111.9	S16 L17 C23 L24	S16-A20 WeakPolarHBondContact O-CB 3.28Å; S16-A20 PolarHBondContact O-N 2.86Å; L17-A20 PolarHBondContact O-N 3Å; A20-C23 PolarHBondContact O-N 3.36Å; A20-L24 VanDerWaalsContact O-CB 3.31Å; A20-L24 WeakPolarHBondContact O-CB 3.33Å; A20-L24 WeakPolarHBondContact O-CG 3.28Å; A20-L24 PolarHBondContact O-N 2.81Å
21	V	62.3	Low	61.2	Low	77 Å²	77	85 Å²	85	47%	0.467	50%	0.496	S	S	.	.	H	α-helix	trans	-65.4	-44.9	174.7	172.5	0	0	0	0	110.2	L17 V18 C23 L24 T25	L17-V21 WeakPolarHBondContact O-CB 3.43Å; L17-V21 VanDerWaalsContact O-CG2 3.27Å; L17-V21 WeakPolarHBondContact O-CG2 3.32Å; L17-V21 PolarHBondContact O-N 2.79Å; V18-V21 PolarHBondContact O-N 3.49Å; V21-C23 PolarHBondContact O-N 3.15Å; V21-L24 PolarHBondContact O-N 3.35Å; V21-T25 HydrophobicContact CG1-CG2 4.29Å; V21-T25 WeakPolarHBondContact O-CB 3.35Å; V21-T25 WeakPolarHBondContact O-CG2 3.23Å; V21-T25 PolarHBondContact O-N 3.15Å; V21-T25 PolarHBondContact O-OG1 2.89Å
22	A	57.6	Low	60.5	Low	46 Å²	46	82.9 Å²	82.9	38%	0.38	49%	0.488	S	S	.	.	H	α-helix	trans	-58.4	-46	175	0	0	0	0	0	111.8	V18 M19 T25 D26	V18-A22 VanDerWaalsContact O-CB 3.27Å; V18-A22 WeakPolarHBondContact O-CB 3.49Å; V18-A22 PolarHBondContact O-N 3.43Å; M19-A22 PolarHBondContact O-N 2.78Å; A22-T25 VanDerWaalsContact CA-OG1 3.31Å; A22-T25 WeakPolarHBondContact CA-OG1 3.39Å; A22-T25 PolarHBondContact O-N 3.44Å; A22-T25 PolarHBondContact O-OG1 3.43Å; A22-D26 VanDerWaalsContact O-CB 3.25Å; A22-D26 WeakPolarHBondContact O-CB 3.35Å; A22-D26 PolarHBondContact O-N 3.33Å
23	C	57.3	Low	59.4	Low	66 Å²	66	86.8 Å²	86.8	45%	0.446	50%	0.496	S	S	.	.	H	α-helix	trans	-65	-39.8	175.6	-69.7	0	0	0	0	112.4	M19 A20 V21 M27	M19-C23 WeakPolarHBondContact O-CB 3.36Å; M19-C23 PolarHBondContact O-N 3.48Å; M19-C23 PolarHBondContact O-SG 3.3Å; A20-C23 PolarHBondContact O-N 3.36Å; V21-C23 PolarHBondContact O-N 3.15Å; C23-M27 VanDerWaalsContact O-CB 3.32Å; C23-M27 WeakPolarHBondContact O-CB 3.23Å; C23-M27 WeakPolarHBondContact O-CG 3.36Å; C23-M27 PolarHBondContact O-N 2.82Å
24	L	58.6	Low	58.2	Low	120 Å²	120	86.8 Å²	86.8	63%	0.628	49%	0.491	S	S	*	.	H	α-helix	trans	-68.8	-37.3	176.2	-72.8	168.4	0	0	0	111.8	A20 V21 N28	A20-L24 VanDerWaalsContact O-CB 3.31Å; A20-L24 WeakPolarHBondContact O-CB 3.33Å; A20-L24 WeakPolarHBondContact O-CG 3.28Å; A20-L24 PolarHBondContact O-N 2.81Å; V21-L24 PolarHBondContact O-N 3.35Å; L24-N28 WeakPolarHBondContact O-CB 3.43Å; L24-N28 PolarHBondContact O-N 2.94Å
25	T	59.4	Low	57.1	Low	66 Å²	66	90.6 Å²	90.6	41%	0.405	50%	0.5	S	S	.	.	H	α-helix	trans	-70.7	-37.3	175.4	50.1	0	0	0	0	112.3	V21 A22 N28 A29	V21-T25 HydrophobicContact CG1-CG2 4.29Å; V21-T25 WeakPolarHBondContact O-CB 3.35Å; V21-T25 WeakPolarHBondContact O-CG2 3.23Å; V21-T25 PolarHBondContact O-N 3.15Å; V21-T25 PolarHBondContact O-OG1 2.89Å; A22-T25 VanDerWaalsContact CA-OG1 3.31Å; A22-T25 WeakPolarHBondContact CA-OG1 3.39Å; A22-T25 PolarHBondContact O-N 3.44Å; A22-T25 PolarHBondContact O-OG1 3.43Å; T25-N28 PolarHBondContact O-N 3.34Å; T25-A29 WeakPolarHBondContact O-CB 3.2Å; T25-A29 PolarHBondContact O-N 3.14Å
26	D	55.2	Low	56.3	Low	97 Å²	97	93.5 Å²	93.5	52%	0.519	51%	0.507	S	S	.	.	H	α-helix	trans	-67.9	-39.8	174.4	-169.9	41	0	0	0	110.7	A22 N28 A29 L30	A22-D26 VanDerWaalsContact O-CB 3.25Å; A22-D26 WeakPolarHBondContact O-CB 3.35Å; A22-D26 PolarHBondContact O-N 3.33Å; D26-N28 VanDerWaalsContact C-N 3.34Å; D26-N28 PolarHBondContact O-N 3.27Å; D26-A29 PolarHBondContact O-N 3.47Å; D26-L30 VanDerWaalsContact O-CB 3.3Å; D26-L30 WeakPolarHBondContact O-CB 3.32Å; D26-L30 WeakPolarHBondContact O-CG 3.07Å; D26-L30 PolarHBondContact O-N 2.87Å
27	M	49.3	Very low	55.1	Low	111 Å²	111	97.8 Å²	97.8	55%	0.547	51%	0.513	S	S	.	.	H	α-helix	trans	-66.5	-33.4	171.1	-70.2	-68.1	169.8	0	0	112.6	C23 L30 L31	C23-M27 VanDerWaalsContact O-CB 3.32Å; C23-M27 WeakPolarHBondContact O-CB 3.23Å; C23-M27 WeakPolarHBondContact O-CG 3.36Å; C23-M27 PolarHBondContact O-N 2.82Å; M27-L30 HydrophobicContact SD-CD1 4.37Å; M27-L31 VanDerWaalsContact O-CB 3.29Å; M27-L31 WeakPolarHBondContact O-CB 3.12Å; M27-L31 PolarHBondContact O-N 3.17Å
28	N	53.9	Low	53.6	Low	115 Å²	115	95.3 Å²	95.3	62%	0.615	50%	0.5	S	S	*	.	H	α-helix	trans	-72.1	-38.9	174.7	-114.7	19.2	0	0	0	112.1	L24 T25 D26 L30 L31 D32	L24-N28 WeakPolarHBondContact O-CB 3.43Å; L24-N28 PolarHBondContact O-N 2.94Å; T25-N28 PolarHBondContact O-N 3.34Å; D26-N28 VanDerWaalsContact C-N 3.34Å; D26-N28 PolarHBondContact O-N 3.27Å; N28-L30 VanDerWaalsContact C-N 3.34Å; N28-L31 PolarHBondContact O-N 3.33Å; N28-D32 VanDerWaalsContact O-CB 3.3Å; N28-D32 WeakPolarHBondContact O-CB 3.29Å; N28-D32 PolarHBondContact O-N 2.86Å
29	A	51.6	Low	52.6	Low	43 Å²	43	96.2 Å²	96.2	36%	0.355	50%	0.501	S	S	.	.	H	α-helix	trans	-67	-37.9	173	0	0	0	0	0	111	T25 D26 R33	T25-A29 WeakPolarHBondContact O-CB 3.2Å; T25-A29 PolarHBondContact O-N 3.14Å; D26-A29 PolarHBondContact O-N 3.47Å; A29-R33 VanDerWaalsContact O-CB 3.27Å; A29-R33 WeakPolarHBondContact O-CB 3.28Å; A29-R33 PolarHBondContact O-N 3.47Å
30	L	45.1	Very low	51.5	Low	66 Å²	66	94.6 Å²	94.6	35%	0.346	50%	0.5	S	S	.	.	H	α-helix	trans	-67.1	-41	170.4	-78.1	168.4	0	0	0	111.7	D26 M27 N28 D32 R33 F34	D26-L30 VanDerWaalsContact O-CB 3.3Å; D26-L30 WeakPolarHBondContact O-CB 3.32Å; D26-L30 WeakPolarHBondContact O-CG 3.07Å; D26-L30 PolarHBondContact O-N 2.87Å; M27-L30 HydrophobicContact SD-CD1 4.37Å; N28-L30 VanDerWaalsContact C-N 3.34Å; L30-D32 VanDerWaalsContact C-N 3.32Å; L30-D32 PolarHBondContact O-N 2.84Å; L30-R33 CarbonylContact O-C 3.51Å; L30-R33 PolarHBondContact O-N 3.41Å; L30-F34 HydrophobicContact CB-CD2 4.27Å; L30-F34 HydrophobicContact CB-CE2 4.26Å; L30-F34 HydrophobicContact CD2-CE2 4.47Å; L30-F34 VanDerWaalsContact O-CB 3.3Å; L30-F34 WeakPolarHBondContact O-CB 3.42Å; L30-F34 WeakPolarHBondContact O-CD2 3.44Å; L30-F34 WeakPolarHBondContact O-CG 3.14Å; L30-F34 PolarHBondContact O-N 2.9Å
31	L	52.1	Low	50.4	Low	91 Å²	91	99 Å²	99	48%	0.476	51%	0.513	S	S	.	.	H	α-helix	trans	-65	-37.9	176.4	-125.4	97.9	0	0	0	111.4	M27 N28 F34 H35	M27-L31 VanDerWaalsContact O-CB 3.29Å; M27-L31 WeakPolarHBondContact O-CB 3.12Å; M27-L31 PolarHBondContact O-N 3.17Å; N28-L31 PolarHBondContact O-N 3.33Å; L31-F34 CarbonylContact O-C 3.6Å; L31-F34 PolarHBondContact O-N 2.97Å; L31-H35 WeakPolarHBondContact O-CB 3.45Å; L31-H35 PolarHBondContact O-CD2 3.08Å; L31-H35 PolarHBondContact O-N 2.99Å
32	D	52.3	Low	49.2	Very low	89 Å²	89	102 Å²	102	48%	0.476	53%	0.525	S	S	.	.	H	α-helix	trans	-70.3	-38.3	176.5	-167.3	52.3	0	0	0	110.9	N28 L30 H35 N36	N28-D32 VanDerWaalsContact O-CB 3.3Å; N28-D32 WeakPolarHBondContact O-CB 3.29Å; N28-D32 PolarHBondContact O-N 2.86Å; L30-D32 VanDerWaalsContact C-N 3.32Å; L30-D32 PolarHBondContact O-N 2.84Å; D32-H35 PolarHBondContact O-N 3.34Å; D32-N36 WeakPolarHBondContact O-CB 3.35Å; D32-N36 PolarHBondContact O-N 3.38Å
33	R	49.4	Very low	48.5	Very low	190 Å²	190	110.4 Å²	110.4	72%	0.717	55%	0.547	S	S	*	.	H	α-helix	trans	-69.2	-33.1	171.3	-144.5	167.4	-165.8	160.7	3.4	112	A29 L30 Y37	A29-R33 VanDerWaalsContact O-CB 3.27Å; A29-R33 WeakPolarHBondContact O-CB 3.28Å; A29-R33 PolarHBondContact O-N 3.47Å; L30-R33 CarbonylContact O-C 3.51Å; L30-R33 PolarHBondContact O-N 3.41Å; R33-Y37 WeakPolarHBondContact O-CA 3.3Å; R33-Y37 WeakPolarHBondContact O-CB 3.42Å; R33-Y37 PolarHBondContact O-N 3.32Å
34	F	44.8	Very low	47.4	Very low	107 Å²	107	110.1 Å²	110.1	47%	0.469	56%	0.556	S	S	.	*	H	α-helix	trans	-73.2	-37.2	170.6	-77.1	-57.1	0	0	0	110.8	L30 L31 N36 Y37 I38	L30-F34 HydrophobicContact CB-CD2 4.27Å; L30-F34 HydrophobicContact CB-CE2 4.26Å; L30-F34 HydrophobicContact CD2-CE2 4.47Å; L30-F34 VanDerWaalsContact O-CB 3.3Å; L30-F34 WeakPolarHBondContact O-CB 3.42Å; L30-F34 WeakPolarHBondContact O-CD2 3.44Å; L30-F34 WeakPolarHBondContact O-CG 3.14Å; L30-F34 PolarHBondContact O-N 2.9Å; L31-F34 CarbonylContact O-C 3.6Å; L31-F34 PolarHBondContact O-N 2.97Å; F34-N36 VanDerWaalsContact C-N 3.31Å; F34-N36 PolarHBondContact O-N 3.17Å; F34-Y37 PolarHBondContact O-N 3.47Å; F34-I38 HydrophobicContact CB-CD1 4.33Å; F34-I38 HydrophobicContact CD1-CB 4.48Å; F34-I38 HydrophobicContact CD1-CD1 3.15Å; F34-I38 HydrophobicContact CD1-CG1 3.78Å; F34-I38 HydrophobicContact CE1-CD1 3.63Å; F34-I38 HydrophobicContact CE1-CG1 4.45Å; F34-I38 HydrophobicContact CG-CD1 4.05Å; F34-I38 VanDerWaalsContact O-CA 3.27Å; F34-I38 WeakPolarHBondContact O-CA 3.44Å; F34-I38 WeakPolarHBondContact O-CB 3.39Å; F34-I38 PolarHBondContact O-N 3.43Å
35	H	48.8	Very low	46.5	Very low	112 Å²	112	113.4 Å²	113.4	52%	0.519	57%	0.567	S	S	.	*	H	α-helix	trans	-65.1	-37.1	173	-88.3	-67.7	0	0	0	111.6	L31 D32 L39	L31-H35 WeakPolarHBondContact O-CB 3.45Å; L31-H35 PolarHBondContact O-CD2 3.08Å; L31-H35 PolarHBondContact O-N 2.99Å; D32-H35 PolarHBondContact O-N 3.34Å; H35-L39 HydrophobicContact CB-CD1 4.17Å; H35-L39 WeakPolarHBondContact ND1-CD1 3.37Å; H35-L39 WeakPolarHBondContact O-CB 3.3Å; H35-L39 WeakPolarHBondContact O-CD1 3.3Å
36	N	48.1	Very low	45.4	Very low	121 Å²	121	117 Å²	117	65%	0.647	58%	0.584	S	S	*	*	H	α-helix	trans	-79.1	-32.7	175.8	-101.1	-50	0	0	0	114.2	D32 F34 P40	D32-N36 WeakPolarHBondContact O-CB 3.35Å; D32-N36 PolarHBondContact O-N 3.38Å; F34-N36 VanDerWaalsContact C-N 3.31Å; F34-N36 PolarHBondContact O-N 3.17Å; N36-P40 VanDerWaalsContact O-CD 3.28Å; N36-P40 WeakPolarHBondContact O-CD 3.49Å; N36-P40 WeakPolarHBondContact O-CG 3.45Å
37	Y	42.3	Very low	44.9	Very low	163 Å²	163	124.1 Å²	124.1	64%	0.639	60%	0.604	S	S	*	*	H	α-helix	trans	-102.3	-30.3	-172.4	-152.5	-91.4	0	0	0	113.6	R33 F34 H41	R33-Y37 WeakPolarHBondContact O-CA 3.3Å; R33-Y37 WeakPolarHBondContact O-CB 3.42Å; R33-Y37 PolarHBondContact O-N 3.32Å; F34-Y37 PolarHBondContact O-N 3.47Å; Y37-H41 WeakPolarHBondContact O-CB 3.36Å
38	I	39.2	Very low	44.7	Very low	62 Å²	62	124.2 Å²	124.2	32%	0.318	61%	0.61	S	S	.	*	H	α-helix	trans	-90.7	-31.5	178.8	-86.2	178.8	0	0	0	113.3	F34 H41 L42	F34-I38 HydrophobicContact CB-CD1 4.33Å; F34-I38 HydrophobicContact CD1-CB 4.48Å; F34-I38 HydrophobicContact CD1-CD1 3.15Å; F34-I38 HydrophobicContact CD1-CG1 3.78Å; F34-I38 HydrophobicContact CE1-CD1 3.63Å; F34-I38 HydrophobicContact CE1-CG1 4.45Å; F34-I38 HydrophobicContact CG-CD1 4.05Å; F34-I38 VanDerWaalsContact O-CA 3.27Å; F34-I38 WeakPolarHBondContact O-CA 3.44Å; F34-I38 WeakPolarHBondContact O-CB 3.39Å; F34-I38 PolarHBondContact O-N 3.43Å; I38-H41 PolarHBondContact O-N 2.91Å; I38-L42 HydrophobicContact CD1-CD1 4.43Å; I38-L42 HydrophobicContact CG2-CB 4.2Å; I38-L42 HydrophobicContact CG2-CD1 3.38Å; I38-L42 HydrophobicContact CG2-CG 3.75Å; I38-L42 PolarHBondContact O-N 3.45Å
39	L	44.2	Very low	43.8	Very low	115 Å²	115	124.8 Å²	124.8	60%	0.602	62%	0.622	S	S	*	*	H	α-helix	trans	-58.7	-32.2	173.6	-95.5	95	0	0	0	113.3	H35	H35-L39 HydrophobicContact CB-CD1 4.17Å; H35-L39 WeakPolarHBondContact ND1-CD1 3.37Å; H35-L39 WeakPolarHBondContact O-CB 3.3Å; H35-L39 WeakPolarHBondContact O-CD1 3.3Å
40	P	44.7	Very low	43.2	Very low	87 Å²	87	131 Å²	131	57%	0.565	64%	0.643	S	S	*	*	H	α-helix	trans	-81	-27.8	170.6	-15.7	30.7	0	0	0	114.4	N36	N36-P40 VanDerWaalsContact O-CD 3.28Å; N36-P40 WeakPolarHBondContact O-CD 3.49Å; N36-P40 WeakPolarHBondContact O-CG 3.45Å
41	H	42.9	Very low	42.6	Very low	136 Å²	136	133.7 Å²	133.7	63%	0.63	67%	0.666	S	S	*	*	H	α-helix	trans	-97.8	-18.6	-171.2	-100.4	76.3	0	0	0	115.9	Y37 I38	Y37-H41 WeakPolarHBondContact O-CB 3.36Å; I38-H41 PolarHBondContact O-N 2.91Å
42	L	37.1	Very low	42.2	Very low	138 Å²	138	136.3 Å²	136.3	72%	0.723	68%	0.681	S	S	*	*	S	Bend	trans	-95.8	-0.8	173	-72	-177.3	0	0	0	113.4	I38 G44	I38-L42 HydrophobicContact CD1-CD1 4.43Å; I38-L42 HydrophobicContact CG2-CB 4.2Å; I38-L42 HydrophobicContact CG2-CD1 3.38Å; I38-L42 HydrophobicContact CG2-CG 3.75Å; I38-L42 PolarHBondContact O-N 3.45Å; L42-G44 VanDerWaalsContact C-N 3.26Å; L42-G44 PolarHBondContact O-N 2.91Å
43	R	43	Very low	41.8	Very low	223 Å²	223	137.1 Å²	137.1	84%	0.842	69%	0.692	S	S	*	*	S	Bend	trans	-86.4	81.1	161.9	-136.3	178	-168.1	129.6	0.5	107.3
44	G	32.6	Very low	41.5	Very low	61 Å²	61	131.6 Å²	131.6	63%	0.629	69%	0.694	S	S	*	*			trans	-44.5	141	-176.9	0	0	0	0	0	113.5	L42 D46	L42-G44 VanDerWaalsContact C-N 3.26Å; L42-G44 PolarHBondContact O-N 2.91Å; G44-D46 PolarHBondContact O-N 2.88Å
45	E	41.3	Very low	41.3	Very low	188 Å²	188	137.1 Å²	137.1	88%	0.879	71%	0.712	S	S	*	*	S	Bend	trans	-1.4	89.9	141.2	-152	165.6	153.6	0	0	114
46	D	35.7	Very low	41	Very low	142 Å²	142	139.2 Å²	139.2	76%	0.759	72%	0.722	S	S	*	*				-174	86.3	125.4	-87.2	-25	0	0	0	108.7	G44 V48	G44-D46 PolarHBondContact O-N 2.88Å; D46-V48 PolarHBondContact O-N 3.04Å
47	R	43.5	Very low	40.3	Very low	247 Å²	247	142 Å²	142	93%	0.932	73%	0.73	S	S	*	*			trans	-61.5	94.6	153.1	-60.2	178.7	-171	-168	1.9	106.2
48	V	46.9	Very low	40.5	Very low	112 Å²	112	139.5 Å²	139.5	68%	0.679	73%	0.732	S	S	*	*			trans	157.6	125	145.8	162.1	0	0	0	0	107.8	D46	D46-V48 PolarHBondContact O-N 3.04Å
49	C	33.9	Very low	40.2	Very low	128 Å²	128	145.3 Å²	145.3	87%	0.865	76%	0.757	S	S	*	*			trans	-124.3	109.1	149.1	-71.8	0	0	0	0	107.3	C51	C49-C51 PolarHBondContact O-N 3.45Å
50	H	40.2	Very low	40.3	Very low	172 Å²	172	149.9 Å²	149.9	80%	0.796	77%	0.768	S	S	*	*			trans	-56.6	126.4	167.9	-130.4	-64.4	0	0	0	108.8
51	C	32.6	Very low	40	Very low	123 Å²	123	152.5 Å²	152.5	83%	0.831	78%	0.783	S	S	*	*			trans	-79.9	119	160.7	-71.5	0	0	0	0	107.9	C49	C49-C51 PolarHBondContact O-N 3.45Å
52	N	43	Very low	39.9	Very low	147 Å²	147	153.4 Å²	153.4	79%	0.786	79%	0.79	S	S	*	*			trans	-138.8	86.5	158.8	-162.4	16.7	0	0	0	110.8
53	C	43.3	Very low	39.8	Very low	105 Å²	105	152 Å²	152	71%	0.709	79%	0.789	S	S	*	*	S	Bend		-169.9	163	121.8	-95.9	0	0	0	0	105.9	R55	C53-R55 PolarHBondContact O-N 3.47Å
54	G	42.9	Very low	39.6	Very low	74 Å²	74	152.3 Å²	152.3	76%	0.763	79%	0.792	S	S	*	*	S	Bend		38.4	94.9	95.9	0	0	0	0	0	112.4
55	R	40.3	Very low	40.1	Very low	223 Å²	223	156.3 Å²	156.3	84%	0.842	80%	0.799	S	S	*	*	S	Bend	trans	72.9	108.8	156.6	-86.3	-175.1	168.1	140.7	-1.5	120.2	C53	C53-R55 PolarHBondContact O-N 3.47Å
56	H	42.8	Very low	40.2	Very low	157 Å²	157	150.9 Å²	150.9	73%	0.727	79%	0.793	S	S	*	*			trans	70.3	105.3	145	-65.3	-77.5	0	0	0	119
57	H	34.3	Very low	40.3	Very low	178 Å²	178	150.9 Å²	150.9	82%	0.824	79%	0.793	S	S	*	*				168	143.4	112.5	-91.6	-78.9	0	0	0	112.2
58	V	46.2	Very low	40.5	Very low	112 Å²	112	148.4 Å²	148.4	68%	0.679	79%	0.792	S	S	*	*			trans	-89.1	137.9	-178.2	177.6	0	0	0	0	110.3	Y60	V58-Y60 HydrophobicContact CG1-CE2 4.32Å
59	H	32.6	Very low	40.1	Very low	183 Å²	183	147.7 Å²	147.7	85%	0.847	79%	0.792	S	S	*	*			trans	-147.1	135.6	161.5	-92	-82.3	0	0	0	112.8
60	Y	46.8	Very low	40.6	Very low	211 Å²	211	149.5 Å²	149.5	83%	0.827	79%	0.793	S	S	*	*			trans	-82	147.1	-171.3	-68.9	-100.8	0	0	0	113.6	V58	V58-Y60 HydrophobicContact CG1-CE2 4.32Å
61	V	38	Very low	40.7	Very low	143 Å²	143	147.7 Å²	147.7	87%	0.867	79%	0.793	S	S	*	*			trans	-140	127.8	156.4	-173.3	0	0	0	0	109.1
62	I	40.3	Very low	41	Very low	155 Å²	155	148.8 Å²	148.8	80%	0.795	79%	0.791	S	S	*	*			trans	-71.6	125.9	-176.5	-62.1	157.1	0	0	0	109.2
63	P	36.3	Very low	41	Very low	107 Å²	107	147 Å²	147	70%	0.695	79%	0.79	S	S	*	*			trans	-71.6	133.2	172.1	29.2	-30.9	0	0	0	109.9	D65	P63-D65 PolarHBondContact O-N 3.41Å
64	Y	38.9	Very low	40.8	Very low	231 Å²	231	146.2 Å²	146.2	91%	0.906	79%	0.791	S	S	*	*			trans	-76.6	107.4	165.7	-127.2	-92.5	0	0	0	106.8	G66	Y64-G66 PolarHBondContact O-N 2.94Å
65	D	42.3	Very low	40.7	Very low	145 Å²	145	149.9 Å²	149.9	78%	0.775	79%	0.788	S	S	*	*			trans	-74.8	105.7	166.7	-99.6	-30.1	0	0	0	107.6	P63	P63-D65 PolarHBondContact O-N 3.41Å
66	G	44.4	Very low	40.7	Very low	73 Å²	73	147 Å²	147	75%	0.753	79%	0.79	S	S	*	*			trans	-98	96.9	162	0	0	0	0	0	107.9	Y64	Y64-G66 PolarHBondContact O-N 2.94Å
67	D	37.1	Very low	40.6	Very low	142 Å²	142	149.5 Å²	149.5	76%	0.759	79%	0.794	S	S	*	*			trans	-95.5	95.8	172.7	49.7	-22.6	0	0	0	110.6	S69	D67-S69 PolarHBondContact O-N 3.2Å
68	Q	48.1	Very low	40.7	Very low	195 Å²	195	148.8 Å²	148.8	91%	0.911	79%	0.789	S	S	*	*			trans	-67.4	110.6	155	-79.3	170.5	-12.5	0	0	109.4
69	S	38	Very low	40.7	Very low	97 Å²	97	149.1 Å²	149.1	68%	0.678	79%	0.791	S	S	*	*			trans	-172.6	114.5	142.8	53	0	0	0	0	114	D67	D67-S69 PolarHBondContact O-N 3.2Å
70	L	44.9	Very low	41.1	Very low	167 Å²	167	143.8 Å²	143.8	87%	0.874	77%	0.774	S	S	*	*			trans	53.7	83.3	134.7	-75.1	145.8	0	0	0	118.3
71	V	40.8	Very low	41.1	Very low	134 Å²	134	137.9 Å²	137.9	81%	0.812	76%	0.757	S	S	*	*				-145.7	119.9	126.7	-163.2	0	0	0	0	109.5
72	D	40.3	Very low	41.5	Very low	145 Å²	145	135 Å²	135	78%	0.775	74%	0.743	S	S	*	*			trans	-78.8	136	-176	-153.4	-20.8	0	0	0	110.3
73	S	41.7	Very low	42	Very low	111 Å²	111	131.3 Å²	131.3	78%	0.776	73%	0.728	S	S	*	*	S	Bend	trans	78.5	32.6	152.9	-65.4	0	0	0	0	122.5
74	A	41	Very low	42.8	Very low	88 Å²	88	129 Å²	129	73%	0.727	71%	0.711	S	S	*	*	S	Bend	trans	-135.6	-5.3	164.4	0	0	0	0	0	117
75	E	39	Very low	43.6	Very low	150 Å²	150	124 Å²	124	70%	0.701	70%	0.695	S	S	*	*			trans	-101	7.5	-166.9	-55.5	-160.6	-172.7	0	0	115.7	Y77 F78	E75-Y77 PolarHBondContact O-N 2.86Å; E75-F78 PolarHBondContact O-N 3.4Å
76	N	41.6	Very low	44.2	Very low	164 Å²	164	123.1 Å²	123.1	88%	0.877	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.9	8.9	169.8	-85.8	-44.9	0	0	0	113.9
77	Y	39.8	Very low	45	Very low	208 Å²	208	125 Å²	125	82%	0.816	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.8	-13.7	174.3	-148.3	-99.6	0	0	0	113.9	E75	E75-Y77 PolarHBondContact O-N 2.86Å
78	F	36.6	Very low	46.4	Very low	164 Å²	164	123.4 Å²	123.4	72%	0.719	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.4	-22.6	-171.7	-145.1	-97.7	0	0	0	114.5	E75 S80	E75-F78 PolarHBondContact O-N 3.4Å; F78-S80 VanDerWaalsContact C-N 3.33Å
79	V	45.4	Very low	47.6	Very low	119 Å²	119	118.8 Å²	118.8	72%	0.721	65%	0.648	S	S	*	*	S	Bend	trans	-82.2	-11.1	176.6	178.5	0	0	0	0	112.6
80	S	41.8	Very low	48.9	Very low	71 Å²	71	118.8 Å²	118.8	50%	0.497	64%	0.639	S	S	.	*	H	α-helix	trans	-84.4	-21.1	170.3	-82.8	0	0	0	0	113.7	F78 S82 T84	F78-S80 VanDerWaalsContact C-N 3.33Å; S80-S82 PolarHBondContact O-N 3.37Å; S80-T84 VanDerWaalsContact O-CB 3.26Å; S80-T84 WeakPolarHBondContact O-CB 3.41Å; S80-T84 WeakPolarHBondContact O-CG2 3.29Å; S80-T84 PolarHBondContact O-N 3.49Å; S80-T84 PolarHBondContact O-OG1 2.73Å
81	D	46	Very low	50	Low	87 Å²	87	117.5 Å²	117.5	47%	0.465	63%	0.631	S	S	.	*	H	α-helix	trans	-70.9	-29	-172.5	-162.1	47.8	0	0	0	112.7	T84 K85	D81-T84 WeakPolarHBondContact CA-OG1 3.38Å; D81-T84 PolarHBondContact O-OG1 3.34Å; D81-K85 VanDerWaalsContact O-CB 3.3Å; D81-K85 WeakPolarHBondContact O-CB 3.44Å; D81-K85 PolarHBondContact O-N 2.94Å; D81-K85 VanDerWaalsContact O-N 3.16Å
82	S	46.8	Very low	51.7	Low	82 Å²	82	115.7 Å²	115.7	57%	0.573	62%	0.616	S	S	*	*	H	α-helix	trans	-78.2	-38	177.7	61	0	0	0	0	113.5	S80	S80-S82 PolarHBondContact O-N 3.37Å
83	V	51.5	Low	53.5	Low	78 Å²	78	110.8 Å²	110.8	47%	0.473	60%	0.599	S	S	.	*	H	α-helix	trans	-75	-40.7	178.1	179	0	0	0	0	110.2	K85 Q86 E87	V83-K85 VanDerWaalsContact C-N 3.32Å; V83-K85 PolarHBondContact O-N 3.32Å; V83-Q86 PolarHBondContact O-N 2.78Å; V83-E87 WeakPolarHBondContact O-CG 3.46Å; V83-E87 PolarHBondContact O-N 2.97Å; V83-E87 VanDerWaalsContact O-N 3.07Å
84	T	52.8	Low	55.1	Low	57 Å²	57	110.8 Å²	110.8	35%	0.35	59%	0.59	S	S	.	*	H	α-helix	trans	-68.1	-28.1	175.9	57.2	0	0	0	0	112.9	S80 D81 E87 L88	S80-T84 VanDerWaalsContact O-CB 3.26Å; S80-T84 WeakPolarHBondContact O-CB 3.41Å; S80-T84 WeakPolarHBondContact O-CG2 3.29Å; S80-T84 PolarHBondContact O-N 3.49Å; S80-T84 PolarHBondContact O-OG1 2.73Å; D81-T84 WeakPolarHBondContact CA-OG1 3.38Å; D81-T84 PolarHBondContact O-OG1 3.34Å; T84-E87 PolarHBondContact O-N 3.36Å; T84-L88 WeakPolarHBondContact O-CB 3.36Å; T84-L88 PolarHBondContact O-N 2.88Å
85	K	55.5	Low	56.5	Low	128 Å²	128	111.4 Å²	111.4	56%	0.557	58%	0.581	S	S	*	*	H	α-helix	trans	-65.5	-42.1	175.2	-156.5	-176	-153.9	85.8	0	112.3	D81 V83 L88 D89	D81-K85 VanDerWaalsContact O-CB 3.3Å; D81-K85 WeakPolarHBondContact O-CB 3.44Å; D81-K85 PolarHBondContact O-N 2.94Å; D81-K85 VanDerWaalsContact O-N 3.16Å; V83-K85 VanDerWaalsContact C-N 3.32Å; V83-K85 PolarHBondContact O-N 3.32Å; K85-L88 PolarHBondContact O-N 3.33Å; K85-D89 WeakPolarHBondContact O-CB 3.47Å; K85-D89 PolarHBondContact O-N 3.12Å
86	Q	55.1	Low	58.3	Low	125 Å²	125	109 Å²	109	58%	0.584	57%	0.572	S	S	*	*	H	α-helix	trans	-70.6	-37.7	176.4	-172.7	171	0.1	0	0	111.8	V83 L90	V83-Q86 PolarHBondContact O-N 2.78Å; Q86-L90 WeakPolarHBondContact O-CB 3.12Å; Q86-L90 PolarHBondContact O-N 3.44Å
87	E	60.3	Low	60.2	Low	112 Å²	112	102.8 Å²	102.8	52%	0.523	55%	0.546	S	S	.	.	H	α-helix	trans	-67.6	-38	173.9	-70.5	179.7	174.2	0	0	112.1	V83 T84 L90 M91	V83-E87 WeakPolarHBondContact O-CG 3.46Å; V83-E87 PolarHBondContact O-N 2.97Å; V83-E87 VanDerWaalsContact O-N 3.07Å; T84-E87 PolarHBondContact O-N 3.36Å; E87-L90 WeakPolarHBondContact O-CB 3.26Å; E87-L90 PolarHBondContact O-N 3.46Å; E87-M91 WeakPolarHBondContact O-CB 3.5Å; E87-M91 VanDerWaalsContact O-CG 3.3Å; E87-M91 WeakPolarHBondContact O-CG 3.31Å; E87-M91 PolarHBondContact O-N 2.86Å
88	L	68.2	Low	61.9	Low	109 Å²	109	99.4 Å²	99.4	57%	0.571	54%	0.536	S	S	*	.	H	α-helix	trans	-73.2	-39	178.7	-163.3	154.8	0	0	0	111.3	T84 K85 L90 M91 L92	T84-L88 WeakPolarHBondContact O-CB 3.36Å; T84-L88 PolarHBondContact O-N 2.88Å; K85-L88 PolarHBondContact O-N 3.33Å; L88-L90 VanDerWaalsContact C-N 3.3Å; L88-L90 PolarHBondContact O-N 3.44Å; L88-M91 PolarHBondContact O-N 2.88Å; L88-L92 WeakPolarHBondContact O-CB 3.25Å; L88-L92 PolarHBondContact O-N 3.15Å
89	D	72.8	Confident	63.2	Low	99 Å²	99	96.1 Å²	96.1	53%	0.529	53%	0.526	S	S	.	.	H	α-helix	trans	-64	-35.6	172.4	-78	-14.9	0	0	0	111.6	K85 G93	K85-D89 WeakPolarHBondContact O-CB 3.47Å; K85-D89 PolarHBondContact O-N 3.12Å; D89-G93 PolarHBondContact O-N 2.93Å
90	L	65.3	Low	64.6	Low	96 Å²	96	94.8 Å²	94.8	50%	0.503	51%	0.514	S	S	.	.	H	α-helix	trans	-67.4	-48.6	172.9	179.8	70.1	0	0	0	111.8	Q86 E87 L88 L92 G93 L94	Q86-L90 WeakPolarHBondContact O-CB 3.12Å; Q86-L90 PolarHBondContact O-N 3.44Å; E87-L90 WeakPolarHBondContact O-CB 3.26Å; E87-L90 PolarHBondContact O-N 3.46Å; L88-L90 VanDerWaalsContact C-N 3.3Å; L88-L90 PolarHBondContact O-N 3.44Å; L90-L92 VanDerWaalsContact C-N 3.29Å; L90-L92 PolarHBondContact O-N 3.32Å; L90-G93 PolarHBondContact O-N 3.12Å; L90-L94 HydrophobicContact CD1-CD1 4.44Å; L90-L94 HydrophobicContact CG-CD1 4.23Å; L90-L94 WeakPolarHBondContact O-CG 3.27Å; L90-L94 PolarHBondContact O-N 3.22Å
91	M	68.8	Low	66.4	Low	141 Å²	141	94.9 Å²	94.9	70%	0.695	52%	0.515	S	S	*	.	H	α-helix	trans	-62.3	-39	177.2	-74.6	-154	73.6	0	0	111.7	E87 L88 L95	E87-M91 WeakPolarHBondContact O-CB 3.5Å; E87-M91 VanDerWaalsContact O-CG 3.3Å; E87-M91 WeakPolarHBondContact O-CG 3.31Å; E87-M91 PolarHBondContact O-N 2.86Å; L88-M91 PolarHBondContact O-N 2.88Å; M91-L95 VanDerWaalsContact O-CB 3.29Å; M91-L95 WeakPolarHBondContact O-CB 3.44Å; M91-L95 PolarHBondContact O-N 3.44Å
92	L	76.4	Confident	68	Low	95 Å²	95	98.7 Å²	98.7	50%	0.497	52%	0.523	S	S	.	.	H	α-helix	trans	-67.2	-43.5	176.9	-174.8	65.4	0	0	0	111.1	L88 L90 L95 L96	L88-L92 WeakPolarHBondContact O-CB 3.25Å; L88-L92 PolarHBondContact O-N 3.15Å; L90-L92 VanDerWaalsContact C-N 3.29Å; L90-L92 PolarHBondContact O-N 3.32Å; L92-L95 PolarHBondContact O-N 2.92Å; L92-L96 WeakPolarHBondContact O-CB 3.18Å; L92-L96 PolarHBondContact O-N 3.45Å
93	G	78.3	Confident	69	Low	42 Å²	42	99.6 Å²	99.6	43%	0.433	52%	0.521	S	S	.	.	H	α-helix	trans	-61.6	-42.9	176	0	0	0	0	0	112.9	D89 L90 G97	D89-G93 PolarHBondContact O-N 2.93Å; L90-G93 PolarHBondContact O-N 3.12Å; G93-G97 PolarHBondContact O-N 3.38Å
94	L	74.1	Confident	70.1	Confident	111 Å²	111	101.5 Å²	101.5	58%	0.581	53%	0.527	S	S	*	.	H	α-helix	trans	-66.8	-44.7	176.7	-74.8	168.6	0	0	0	112.2	L90 G97 F98	L90-L94 HydrophobicContact CD1-CD1 4.44Å; L90-L94 HydrophobicContact CG-CD1 4.23Å; L90-L94 WeakPolarHBondContact O-CG 3.27Å; L90-L94 PolarHBondContact O-N 3.22Å; L94-G97 PolarHBondContact O-N 2.9Å; L94-F98 WeakPolarHBondContact O-CB 3.18Å; L94-F98 PolarHBondContact O-N 3.43Å
95	L	69.9	Low	71.3	Confident	101 Å²	101	104 Å²	104	53%	0.529	54%	0.538	S	S	.	.	H	α-helix	trans	-62.8	-45.2	177.2	-173.8	72.9	0	0	0	110.9	M91 L92 F98 L99	M91-L95 VanDerWaalsContact O-CB 3.29Å; M91-L95 WeakPolarHBondContact O-CB 3.44Å; M91-L95 PolarHBondContact O-N 3.44Å; L92-L95 PolarHBondContact O-N 2.92Å; L95-F98 PolarHBondContact O-N 3.25Å; L95-L99 HydrophobicContact CG-CD1 4.09Å; L95-L99 WeakPolarHBondContact O-CB 3.33Å; L95-L99 VanDerWaalsContact O-CG 3.23Å; L95-L99 WeakPolarHBondContact O-CG 3.33Å; L95-L99 PolarHBondContact O-N 3.06Å
96	L	78	Confident	72.7	Confident	101 Å²	101	106.2 Å²	106.2	53%	0.529	54%	0.543	S	S	.	.	H	α-helix	trans	-64.7	-42.6	178.2	-168	74.6	0	0	0	111.1	L92 F98 L99 L100	L92-L96 WeakPolarHBondContact O-CB 3.18Å; L92-L96 PolarHBondContact O-N 3.45Å; L96-F98 PolarHBondContact O-N 3.16Å; L96-L99 PolarHBondContact O-N 3.43Å; L96-L100 HydrophobicContact CD2-CD1 4.45Å; L96-L100 HydrophobicContact CG-CD1 4.03Å; L96-L100 HydrophobicContact CG-CG 4.49Å; L96-L100 WeakPolarHBondContact O-CB 3.15Å; L96-L100 VanDerWaalsContact O-CG 3.23Å; L96-L100 WeakPolarHBondContact O-CG 3.27Å; L96-L100 PolarHBondContact O-N 3.16Å
97	G	81.3	Confident	73.5	Confident	32 Å²	32	104.5 Å²	104.5	33%	0.33	54%	0.538	S	S	.	.	H	α-helix	trans	-61.5	-41.6	174.9	0	0	0	0	0	112.7	G93 L94 S101	G93-G97 PolarHBondContact O-N 3.38Å; L94-G97 PolarHBondContact O-N 2.9Å; G97-S101 VanDerWaalsContact O-CB 3.28Å; G97-S101 WeakPolarHBondContact O-CB 3.31Å; G97-S101 PolarHBondContact O-N 3.3Å; G97-S101 PolarHBondContact O-OG 2.93Å
98	F	75.3	Confident	74.3	Confident	137 Å²	137	102.3 Å²	102.3	60%	0.601	53%	0.529	S	S	*	.	H	α-helix	trans	-65.2	-46.3	175.3	-177.2	-99	0	0	0	111.9	L94 L95 L96 S101 W102	L94-F98 WeakPolarHBondContact O-CB 3.18Å; L94-F98 PolarHBondContact O-N 3.43Å; L95-F98 PolarHBondContact O-N 3.25Å; L96-F98 PolarHBondContact O-N 3.16Å; F98-S101 PolarHBondContact O-N 2.67Å; F98-W102 WeakPolarHBondContact O-CB 3.5Å; F98-W102 PolarHBondContact O-N 2.91Å
99	L	64.1	Low	74.7	Confident	95 Å²	95	99.1 Å²	99.1	50%	0.497	52%	0.522	S	S	.	.	H	α-helix	trans	-62.1	-44.5	177.4	-73.7	170.3	0	0	0	112.1	L95 L96 W102 L103	L95-L99 HydrophobicContact CG-CD1 4.09Å; L95-L99 WeakPolarHBondContact O-CB 3.33Å; L95-L99 VanDerWaalsContact O-CG 3.23Å; L95-L99 WeakPolarHBondContact O-CG 3.33Å; L95-L99 PolarHBondContact O-N 3.06Å; L96-L99 PolarHBondContact O-N 3.43Å; L99-W102 PolarHBondContact O-N 2.81Å; L99-L103 VanDerWaalsContact O-CB 3.28Å; L99-L103 WeakPolarHBondContact O-CB 3.27Å; L99-L103 PolarHBondContact O-N 3.39Å
100	L	75.3	Confident	74.9	Confident	91 Å²	91	96.1 Å²	96.1	48%	0.476	51%	0.512	S	S	.	.	H	α-helix	trans	-64	-43.9	176.5	-73.6	169.3	0	0	0	111.3	L96 L103 L104	L96-L100 HydrophobicContact CD2-CD1 4.45Å; L96-L100 HydrophobicContact CG-CD1 4.03Å; L96-L100 HydrophobicContact CG-CG 4.49Å; L96-L100 WeakPolarHBondContact O-CB 3.15Å; L96-L100 VanDerWaalsContact O-CG 3.23Å; L96-L100 WeakPolarHBondContact O-CG 3.27Å; L96-L100 PolarHBondContact O-N 3.16Å; L100-L103 PolarHBondContact O-N 3.41Å; L100-L104 WeakPolarHBondContact O-CB 3.31Å; L100-L104 WeakPolarHBondContact O-CD1 3.35Å; L100-L104 WeakPolarHBondContact O-CG 3.2Å; L100-L104 PolarHBondContact O-N 2.87Å
101	S	79.5	Confident	75.5	Confident	73 Å²	73	95.9 Å²	95.9	51%	0.51	51%	0.51	S	S	.	.	H	α-helix	trans	-63.4	-42.3	177.9	-60.1	0	0	0	0	111.9	G97 F98 L104 L105	G97-S101 VanDerWaalsContact O-CB 3.28Å; G97-S101 WeakPolarHBondContact O-CB 3.31Å; G97-S101 PolarHBondContact O-N 3.3Å; G97-S101 PolarHBondContact O-OG 2.93Å; F98-S101 PolarHBondContact O-N 2.67Å; S101-L104 PolarHBondContact O-N 3.41Å; S101-L105 WeakPolarHBondContact O-CB 3.45Å; S101-L105 PolarHBondContact O-N 3.45Å
102	W	79.1	Confident	75.9	Confident	168 Å²	168	93.4 Å²	93.4	64%	0.636	50%	0.497	S	S	*	.	H	α-helix	trans	-62.6	-45.4	174.7	-178	-95.2	0	0	0	111.9	F98 L99 L105 W106	F98-W102 WeakPolarHBondContact O-CB 3.5Å; F98-W102 PolarHBondContact O-N 2.91Å; L99-W102 PolarHBondContact O-N 2.81Å; W102-L105 PolarHBondContact O-N 3.07Å; W102-W106 WeakPolarHBondContact O-CB 3.22Å; W102-W106 PolarHBondContact O-N 3.46Å
103	L	68.4	Low	75.9	Confident	101 Å²	101	91.2 Å²	91.2	53%	0.529	49%	0.493	S	S	.	.	H	α-helix	trans	-64.4	-41.8	178.2	-171.5	120.7	0	0	0	111.8	L99 L100 W106 L107	L99-L103 VanDerWaalsContact O-CB 3.28Å; L99-L103 WeakPolarHBondContact O-CB 3.27Å; L99-L103 PolarHBondContact O-N 3.39Å; L100-L103 PolarHBondContact O-N 3.41Å; L103-W106 PolarHBondContact O-N 2.78Å; L103-L107 WeakPolarHBondContact O-CB 3.48Å; L103-L107 PolarHBondContact O-N 2.97Å
104	L	74.7	Confident	75.9	Confident	117 Å²	117	92 Å²	92	61%	0.613	50%	0.495	S	S	*	.	H	α-helix	trans	-61.5	-43.6	175	-83.3	154.4	0	0	0	111.7	L100 S101 L107 D108	L100-L104 WeakPolarHBondContact O-CB 3.31Å; L100-L104 WeakPolarHBondContact O-CD1 3.35Å; L100-L104 WeakPolarHBondContact O-CG 3.2Å; L100-L104 PolarHBondContact O-N 2.87Å; S101-L104 PolarHBondContact O-N 3.41Å; L104-L107 PolarHBondContact O-N 3.29Å; L104-D108 PolarHBondContact O-N 2.94Å
105	L	77.1	Confident	76.1	Confident	110 Å²	110	90 Å²	90	58%	0.576	49%	0.485	S	S	*	.	H	α-helix	trans	-65.4	-43.6	177.6	-167.7	74.4	0	0	0	111.6	S101 W102 L107 D108 G109	S101-L105 WeakPolarHBondContact O-CB 3.45Å; S101-L105 PolarHBondContact O-N 3.45Å; W102-L105 PolarHBondContact O-N 3.07Å; L105-L107 VanDerWaalsContact C-N 3.34Å; L105-D108 PolarHBondContact O-N 3.46Å; L105-G109 PolarHBondContact O-N 3.46Å; L105-G109 VanDerWaalsContact O-N 3.08Å
106	W	84.1	Confident	76.4	Confident	174 Å²	174	92.6 Å²	92.6	66%	0.659	49%	0.488	S	S	*	.	H	α-helix	trans	-62.5	-43.2	175.1	-177.3	88.1	0	0	0	111.4	W102 L103 G109 A110	W102-W106 WeakPolarHBondContact O-CB 3.22Å; W102-W106 PolarHBondContact O-N 3.46Å; L103-W106 PolarHBondContact O-N 2.78Å; W106-G109 PolarHBondContact O-N 3.06Å; W106-A110 HydrophobicContact CD2-CB 4.49Å; W106-A110 HydrophobicContact CE3-CB 4.32Å; W106-A110 HydrophobicContact CH2-CB 4.29Å; W106-A110 HydrophobicContact CZ2-CB 4.45Å; W106-A110 HydrophobicContact CZ3-CB 4.21Å; W106-A110 VanDerWaalsContact O-CB 3.28Å; W106-A110 WeakPolarHBondContact O-CB 3.39Å; W106-A110 PolarHBondContact O-N 3.37Å
107	L	71.9	Confident	76.2	Confident	90 Å²	90	90.8 Å²	90.8	47%	0.471	49%	0.487	S	S	.	.	H	α-helix	trans	-67.1	-38.4	-179.7	-167.7	140.6	0	0	0	111.6	L103 L104 L105 A110 L111	L103-L107 WeakPolarHBondContact O-CB 3.48Å; L103-L107 PolarHBondContact O-N 2.97Å; L104-L107 PolarHBondContact O-N 3.29Å; L105-L107 VanDerWaalsContact C-N 3.34Å; L107-A110 PolarHBondContact O-N 2.94Å; L107-L111 WeakPolarHBondContact O-CB 3.31Å; L107-L111 PolarHBondContact O-N 3.4Å
108	D	79.1	Confident	75.6	Confident	66 Å²	66	95.5 Å²	95.5	35%	0.353	50%	0.495	S	S	.	.	H	α-helix	trans	-63.3	-44.3	172.6	-173.5	74.6	0	0	0	111.7	L104 L105 L111 H112	L104-D108 PolarHBondContact O-N 2.94Å; L105-D108 PolarHBondContact O-N 3.46Å; D108-L111 PolarHBondContact O-N 3.24Å; D108-H112 WeakPolarHBondContact O-CB 3.42Å; D108-H112 PolarHBondContact O-N 3.33Å; D108-H112 PolarHBondContact O-ND1 3.28Å; D108-H112 IonicContact OD1-CE1 3.55Å; D108-H112 IonicContact OD1-ND1 3.86Å; D108-H112 IonicContact OD2-CE1 3.38Å; D108-H112 PolarHBondContact OD2-CE1 3.5Å; D108-H112 IonicContact OD2-ND1 3.17Å; D108-H112 PolarHBondContact OD2-ND1 2.95Å
109	G	76.4	Confident	75.2	Confident	41 Å²	41	97.3 Å²	97.3	42%	0.423	50%	0.497	S	S	.	.	H	α-helix	trans	-62.6	-45.1	175.8	0	0	0	0	0	112.9	L105 W106 H112 A113	L105-G109 PolarHBondContact O-N 3.46Å; L105-G109 VanDerWaalsContact O-N 3.08Å; W106-G109 PolarHBondContact O-N 3.06Å; G109-H112 PolarHBondContact O-N 3.42Å; G109-A113 WeakPolarHBondContact O-CB 3.35Å; G109-A113 PolarHBondContact O-N 3.1Å
110	A	76.9	Confident	75.1	Confident	37 Å²	37	96.1 Å²	96.1	31%	0.306	50%	0.502	S	S	.	.	H	α-helix	trans	-67.1	-41.1	177.3	0	0	0	0	0	111.7	W106 L107 A113 A114	W106-A110 HydrophobicContact CD2-CB 4.49Å; W106-A110 HydrophobicContact CE3-CB 4.32Å; W106-A110 HydrophobicContact CH2-CB 4.29Å; W106-A110 HydrophobicContact CZ2-CB 4.45Å; W106-A110 HydrophobicContact CZ3-CB 4.21Å; W106-A110 VanDerWaalsContact O-CB 3.28Å; W106-A110 WeakPolarHBondContact O-CB 3.39Å; W106-A110 PolarHBondContact O-N 3.37Å; L107-A110 PolarHBondContact O-N 2.94Å; A110-A113 PolarHBondContact O-N 3Å; A110-A114 WeakPolarHBondContact O-CB 3.25Å; A110-A114 PolarHBondContact O-N 3.42Å
111	L	77.3	Confident	74.2	Confident	90 Å²	90	98.3 Å²	98.3	47%	0.471	51%	0.507	S	S	.	.	H	α-helix	trans	-63.3	-43.6	175.9	-168.4	83.1	0	0	0	110.4	L107 D108 A114 L115	L107-L111 WeakPolarHBondContact O-CB 3.31Å; L107-L111 PolarHBondContact O-N 3.4Å; D108-L111 PolarHBondContact O-N 3.24Å; L111-A114 PolarHBondContact O-N 2.93Å; L111-L115 HydrophobicContact CD2-CD1 4.29Å; L111-L115 HydrophobicContact CG-CD1 4.04Å; L111-L115 HydrophobicContact CG-CG 4.45Å; L111-L115 WeakPolarHBondContact O-CB 3.16Å; L111-L115 WeakPolarHBondContact O-CG 3.3Å; L111-L115 PolarHBondContact O-N 2.95Å
112	H	76.9	Confident	72.9	Confident	89 Å²	89	98.9 Å²	98.9	41%	0.412	50%	0.502	S	S	.	.	H	α-helix	trans	-66.1	-38.5	175.9	-79.6	149.1	0	0	0	113	D108 G109 R116	D108-H112 WeakPolarHBondContact O-CB 3.42Å; D108-H112 PolarHBondContact O-N 3.33Å; D108-H112 PolarHBondContact O-ND1 3.28Å; D108-H112 IonicContact OD1-CE1 3.55Å; D108-H112 IonicContact OD1-ND1 3.86Å; D108-H112 IonicContact OD2-CE1 3.38Å; D108-H112 PolarHBondContact OD2-CE1 3.5Å; D108-H112 IonicContact OD2-ND1 3.17Å; D108-H112 PolarHBondContact OD2-ND1 2.95Å; G109-H112 PolarHBondContact O-N 3.42Å; H112-R116 WeakPolarHBondContact O-CB 3.11Å; H112-R116 WeakPolarHBondContact O-CG 3.32Å; H112-R116 PolarHBondContact O-N 3.1Å
113	A	76.8	Confident	71.6	Confident	50 Å²	50	98.8 Å²	98.8	41%	0.413	51%	0.508	S	S	.	.	H	α-helix	trans	-66.6	-45.2	173.9	0	0	0	0	0	111.7	G109 A110 R116 A117	G109-A113 WeakPolarHBondContact O-CB 3.35Å; G109-A113 PolarHBondContact O-N 3.1Å; A110-A113 PolarHBondContact O-N 3Å; A113-R116 PolarHBondContact O-N 2.94Å; A113-A117 WeakPolarHBondContact O-CB 3.42Å; A113-A117 PolarHBondContact O-N 2.83Å
114	A	77.4	Confident	70.7	Confident	59 Å²	59	102.3 Å²	102.3	49%	0.488	52%	0.522	S	S	.	.	H	α-helix	trans	-64.4	-40.6	177.2	0	0	0	0	0	111.7	A110 L111 A117 W118	A110-A114 WeakPolarHBondContact O-CB 3.25Å; A110-A114 PolarHBondContact O-N 3.42Å; L111-A114 PolarHBondContact O-N 2.93Å; A114-A117 PolarHBondContact O-N 3.32Å; A114-W118 WeakPolarHBondContact O-CB 3.29Å; A114-W118 PolarHBondContact O-N 3.22Å
115	L	78.6	Confident	69.4	Low	68 Å²	68	100 Å²	100	36%	0.356	51%	0.51	S	S	.	.	H	α-helix	trans	-65.4	-38.5	174.8	-76.9	170.5	0	0	0	111.9	L111 W118 R119	L111-L115 HydrophobicContact CD2-CD1 4.29Å; L111-L115 HydrophobicContact CG-CD1 4.04Å; L111-L115 HydrophobicContact CG-CG 4.45Å; L111-L115 WeakPolarHBondContact O-CB 3.16Å; L111-L115 WeakPolarHBondContact O-CG 3.3Å; L111-L115 PolarHBondContact O-N 2.95Å; L115-W118 HydrophobicContact CD2-CE3 4.06Å; L115-W118 HydrophobicContact CD2-CZ3 4.41Å; L115-R119 WeakPolarHBondContact O-CB 3.23Å; L115-R119 WeakPolarHBondContact O-CG 3.35Å; L115-R119 PolarHBondContact O-N 3.13Å
116	R	77	Confident	68.2	Low	156 Å²	156	100 Å²	100	59%	0.589	51%	0.514	S	S	*	.	H	α-helix	trans	-67.7	-45	174.1	-78.4	-165.4	-125.6	123.3	0.9	111.8	H112 A113 W118 R119 A120	H112-R116 WeakPolarHBondContact O-CB 3.11Å; H112-R116 WeakPolarHBondContact O-CG 3.32Å; H112-R116 PolarHBondContact O-N 3.1Å; A113-R116 PolarHBondContact O-N 2.94Å; R116-W118 VanDerWaalsContact C-N 3.31Å; R116-W118 PolarHBondContact O-N 3.45Å; R116-R119 PolarHBondContact O-N 2.85Å; R116-A120 WeakPolarHBondContact O-CB 2.94Å; R116-A120 PolarHBondContact O-N 2.81Å
117	A	72.3	Confident	66.4	Low	62 Å²	62	102 Å²	102	51%	0.512	53%	0.528	S	S	.	.	H	α-helix	trans	-62.8	-40	175.9	0	0	0	0	0	111.5	A113 A114 A120 K121	A113-A117 WeakPolarHBondContact O-CB 3.42Å; A113-A117 PolarHBondContact O-N 2.83Å; A114-A117 PolarHBondContact O-N 3.32Å; A117-A120 PolarHBondContact O-N 2.8Å; A117-K121 VanDerWaalsContact O-CB 3.32Å; A117-K121 WeakPolarHBondContact O-CB 3.43Å; A117-K121 PolarHBondContact O-N 3.45Å
118	W	70.3	Confident	65.4	Low	132 Å²	132	102.1 Å²	102.1	50%	0.5	54%	0.537	S	S	.	.	H	α-helix	trans	-66.2	-44.6	176.1	-179.2	56.6	0	0	0	111.9	A114 L115 R116 A120 K121 Q122	A114-W118 WeakPolarHBondContact O-CB 3.29Å; A114-W118 PolarHBondContact O-N 3.22Å; L115-W118 HydrophobicContact CD2-CE3 4.06Å; L115-W118 HydrophobicContact CD2-CZ3 4.41Å; R116-W118 VanDerWaalsContact C-N 3.31Å; R116-W118 PolarHBondContact O-N 3.45Å; W118-A120 PolarHBondContact O-N 3.36Å; W118-K121 CarbonylContact O-C 3.53Å; W118-K121 PolarHBondContact O-N 3.25Å; W118-Q122 VanDerWaalsContact O-CB 3.27Å; W118-Q122 WeakPolarHBondContact O-CB 3.27Å; W118-Q122 PolarHBondContact O-N 3.49Å
119	R	66.8	Low	64.1	Low	174 Å²	174	105.6 Å²	105.6	66%	0.657	55%	0.545	S	S	*	.	H	α-helix	trans	-63.3	-39.5	173.6	-79.3	-165	-166.4	150.9	3.8	112.9	L115 R116 K121 Q122 H123	L115-R119 WeakPolarHBondContact O-CB 3.23Å; L115-R119 WeakPolarHBondContact O-CG 3.35Å; L115-R119 PolarHBondContact O-N 3.13Å; R116-R119 PolarHBondContact O-N 2.85Å; R119-K121 VanDerWaalsContact C-N 3.31Å; R119-Q122 PolarHBondContact O-N 3.32Å; R119-H123 PolarHBondContact O-N 2.86Å
120	A	60.8	Low	62.9	Low	71 Å²	71	109.3 Å²	109.3	59%	0.587	56%	0.564	S	S	*	*	H	α-helix	trans	-64.1	-39	175.9	0	0	0	0	0	111.2	R116 A117 W118	R116-A120 WeakPolarHBondContact O-CB 2.94Å; R116-A120 PolarHBondContact O-N 2.81Å; A117-A120 PolarHBondContact O-N 2.8Å; W118-A120 PolarHBondContact O-N 3.36Å
121	K	57.3	Low	61.9	Low	136 Å²	136	114.7 Å²	114.7	59%	0.591	58%	0.577	S	S	*	*	H	α-helix	trans	-70	-35.3	174.1	-160.6	-178.6	-178.7	-171.4	0	112.5	A117 W118 R119 H123 H124 D125	A117-K121 VanDerWaalsContact O-CB 3.32Å; A117-K121 WeakPolarHBondContact O-CB 3.43Å; A117-K121 PolarHBondContact O-N 3.45Å; W118-K121 CarbonylContact O-C 3.53Å; W118-K121 PolarHBondContact O-N 3.25Å; R119-K121 VanDerWaalsContact C-N 3.31Å; K121-H123 VanDerWaalsContact C-N 3.27Å; K121-H123 PolarHBondContact O-N 3.46Å; K121-H124 WeakPolarHBondContact O-CA 3.33Å; K121-H124 WeakPolarHBondContact O-CB 2.97Å; K121-H124 PolarHBondContact O-N 2.92Å; K121-D125 PolarHBondContact O-N 2.86Å
122	Q	51.3	Low	60.9	Low	85 Å²	85	112.4 Å²	112.4	40%	0.397	57%	0.566	S	S	.	*	H	α-helix	trans	-65.8	-27.4	178.1	-161.5	174.2	6	0	0	112.7	W118 R119 H124 V126	W118-Q122 VanDerWaalsContact O-CB 3.27Å; W118-Q122 WeakPolarHBondContact O-CB 3.27Å; W118-Q122 PolarHBondContact O-N 3.49Å; R119-Q122 PolarHBondContact O-N 3.32Å; Q122-H124 VanDerWaalsContact C-N 3.29Å; Q122-V126 WeakPolarHBondContact O-CG2 3.32Å; Q122-V126 PolarHBondContact O-N 3.47Å
123	H	51.8	Low	59.9	Low	166 Å²	166	111.7 Å²	111.7	77%	0.769	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.8	-19.7	170.5	-110.9	58.7	0	0	0	113.5	R119 K121	R119-H123 PolarHBondContact O-N 2.86Å; K121-H123 VanDerWaalsContact C-N 3.27Å; K121-H123 PolarHBondContact O-N 3.46Å
124	H	49.7	Very low	58.7	Low	175 Å²	175	118.2 Å²	118.2	81%	0.81	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.5	-29.9	174.9	-128	48.6	0	0	0	112.3	K121 Q122	K121-H124 WeakPolarHBondContact O-CA 3.33Å; K121-H124 WeakPolarHBondContact O-CB 2.97Å; K121-H124 PolarHBondContact O-N 2.92Å; Q122-H124 VanDerWaalsContact C-N 3.29Å
125	D	48.8	Very low	57.6	Low	68 Å²	68	121.3 Å²	121.3	36%	0.364	59%	0.586	S	S	.	*	S	Bend	trans	-100.8	22.2	-177.2	-70	-26.7	0	0	0	114.1	K121 F127 S128	K121-D125 PolarHBondContact O-N 2.86Å; D125-F127 PolarHBondContact O-N 2.85Å; D125-S128 PolarHBondContact O-N 3.37Å
126	V	51.1	Low	56.6	Low	110 Å²	110	121.4 Å²	121.4	67%	0.667	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.2	-20.7	-174.1	175.4	0	0	0	0	113.8	Q122	Q122-V126 WeakPolarHBondContact O-CG2 3.32Å; Q122-V126 PolarHBondContact O-N 3.47Å
127	F	46.8	Very low	55.5	Low	216 Å²	216	118.1 Å²	118.1	95%	0.947	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.4	-10.1	-175.9	-133.7	-94.1	0	0	0	115.4	D125	D125-F127 PolarHBondContact O-N 2.85Å
128	S	49.8	Very low	54.7	Low	94 Å²	94	120.3 Å²	120.3	66%	0.657	59%	0.589	S	S	*	*	S	Bend	trans	-118.5	8.6	-164.2	-172.9	0	0	0	0	116.9	D125	D125-S128 PolarHBondContact O-N 3.37Å
129	W	51.3	Low	54	Low	139 Å²	139	124 Å²	124	53%	0.527	60%	0.602	S	S	.	*			trans	-123	47.4	-167.1	-74.5	85.2	0	0	0	115.8	W131 V132	W129-W131 PolarHBondContact O-N 2.89Å; W129-V132 HydrophobicContact CD2-CG2 4.41Å; W129-V132 HydrophobicContact CE3-CB 3.9Å; W129-V132 HydrophobicContact CE3-CG2 3.15Å; W129-V132 HydrophobicContact CZ3-CB 4.4Å; W129-V132 HydrophobicContact CZ3-CG2 3.21Å
130	S	51.9	Low	53.5	Low	118 Å²	118	119 Å²	119	83%	0.825	59%	0.589	S	S	*	*	S	Bend	trans	-67.1	-9.4	170.9	62.6	0	0	0	0	114.4
131	W	55.5	Low	53.2	Low	150 Å²	150	119.9 Å²	119.9	57%	0.568	58%	0.583	S	S	*	*	S	Bend	trans	-96.9	-23.3	-175.4	-177.7	62.6	0	0	0	115.5	W129 P133 R134 F135	W129-W131 PolarHBondContact O-N 2.89Å; W131-P133 VanDerWaalsContact C-CD 3.46Å; W131-R134 WeakPolarHBondContact O-CB 3.3Å; W131-R134 PolarHBondContact O-N 2.82Å; W131-F135 AromaticContact CE2-CE2 3.82Å; W131-F135 HydrophobicContact CH2-CD2 4.41Å; W131-F135 AromaticContact CH2-CE2 3.85Å; W131-F135 HydrophobicContact CH2-CE2 3.85Å; W131-F135 HydrophobicContact CZ2-CD2 4.06Å; W131-F135 AromaticContact CZ2-CE2 3.35Å; W131-F135 HydrophobicContact CZ2-CE2 3.35Å; W131-F135 HydrophobicContact CZ2-CZ 4.25Å
132	V	57.4	Low	53.4	Low	42 Å²	42	115.5 Å²	115.5	26%	0.255	58%	0.577	S	S	.	*	H	α-helix	trans	-66	-31.6	179.1	155.3	0	0	0	0	116.3	W129 R134 F135 C136	W129-V132 HydrophobicContact CD2-CG2 4.41Å; W129-V132 HydrophobicContact CE3-CB 3.9Å; W129-V132 HydrophobicContact CE3-CG2 3.15Å; W129-V132 HydrophobicContact CZ3-CB 4.4Å; W129-V132 HydrophobicContact CZ3-CG2 3.21Å; V132-R134 PolarHBondContact O-N 2.86Å; V132-R134 VanDerWaalsContact O-N 3.08Å; V132-F135 PolarHBondContact O-N 2.94Å; V132-F135 VanDerWaalsContact O-N 3.12Å; V132-C136 PolarHBondContact O-N 2.84Å
133	P	55.1	Low	53.6	Low	74 Å²	74	120.7 Å²	120.7	48%	0.481	59%	0.592	S	S	.	*	H	α-helix	trans	-65.7	-14.5	176.1	24.7	-31.5	0	0	0	113.3	W131 N137	W131-P133 VanDerWaalsContact C-CD 3.46Å; P133-N137 PolarHBondContact O-N 3.48Å; P133-N137 PolarHBondContact O-ND2 3.48Å; P133-N137 VanDerWaalsContact O-ND2 3.15Å
134	R	51.9	Low	53.7	Low	188 Å²	188	121 Å²	121	71%	0.709	59%	0.587	S	S	*	*	H	α-helix	trans	-71.6	-33	172.9	-96.1	177.1	173.6	169.7	-0.8	113.2	W131 V132	W131-R134 WeakPolarHBondContact O-CB 3.3Å; W131-R134 PolarHBondContact O-N 2.82Å; V132-R134 PolarHBondContact O-N 2.86Å; V132-R134 VanDerWaalsContact O-N 3.08Å
135	F	53.8	Low	54.1	Low	123 Å²	123	117.2 Å²	117.2	54%	0.539	58%	0.576	S	S	.	*	H	α-helix	trans	-84.2	-32.6	179.1	-90.9	-88.6	0	0	0	113.1	W131 V132 N137 L138	W131-F135 AromaticContact CE2-CE2 3.82Å; W131-F135 HydrophobicContact CH2-CD2 4.41Å; W131-F135 AromaticContact CH2-CE2 3.85Å; W131-F135 HydrophobicContact CH2-CE2 3.85Å; W131-F135 HydrophobicContact CZ2-CD2 4.06Å; W131-F135 AromaticContact CZ2-CE2 3.35Å; W131-F135 HydrophobicContact CZ2-CE2 3.35Å; W131-F135 HydrophobicContact CZ2-CZ 4.25Å; V132-F135 PolarHBondContact O-N 2.94Å; V132-F135 VanDerWaalsContact O-N 3.12Å; F135-N137 VanDerWaalsContact C-N 3.29Å; F135-N137 PolarHBondContact O-N 3.02Å; F135-L138 PolarHBondContact O-N 2.87Å
136	C	57.9	Low	54.3	Low	71 Å²	71	121 Å²	121	48%	0.48	59%	0.591	S	S	.	*	H	α-helix	trans	-65.3	-33.3	173.6	-67	0	0	0	0	112.3	V132 L138 R139 D140	V132-C136 PolarHBondContact O-N 2.84Å; C136-L138 VanDerWaalsContact C-N 3.29Å; C136-L138 PolarHBondContact O-N 2.87Å; C136-R139 PolarHBondContact O-N 2.89Å; C136-D140 PolarHBondContact O-N 3.39Å; C136-D140 VanDerWaalsContact O-N 3.15Å
137	N	54.8	Low	54.3	Low	86 Å²	86	120.9 Å²	120.9	46%	0.46	59%	0.586	S	S	.	*	H	α-helix	trans	-62	-32	174.2	-98.2	-60.8	0	0	0	113.4	P133 F135 D140 L141	P133-N137 PolarHBondContact O-N 3.48Å; P133-N137 PolarHBondContact O-ND2 3.48Å; P133-N137 VanDerWaalsContact O-ND2 3.15Å; F135-N137 VanDerWaalsContact C-N 3.29Å; F135-N137 PolarHBondContact O-N 3.02Å; N137-D140 PolarHBondContact O-N 3.32Å; N137-L141 VanDerWaalsContact O-CB 3.23Å; N137-L141 WeakPolarHBondContact O-CB 3.34Å; N137-L141 WeakPolarHBondContact O-CD1 3.37Å; N137-L141 VanDerWaalsContact O-CG 3.27Å; N137-L141 WeakPolarHBondContact O-CG 3.28Å; N137-L141 PolarHBondContact O-N 3.27Å
138	L	54.9	Low	54.6	Low	109 Å²	109	119.9 Å²	119.9	57%	0.571	58%	0.576	S	S	*	*	H	α-helix	trans	-69.6	-39.1	178.7	-89	156.1	0	0	0	112.5	F135 C136 L141 G142	F135-L138 PolarHBondContact O-N 2.87Å; C136-L138 VanDerWaalsContact C-N 3.29Å; C136-L138 PolarHBondContact O-N 2.87Å; L138-L141 PolarHBondContact O-N 3.38Å; L138-G142 PolarHBondContact O-N 2.82Å
139	R	54.7	Low	54.4	Low	208 Å²	208	123 Å²	123	79%	0.785	58%	0.578	S	S	*	*	H	α-helix	trans	-69.1	-37.4	175.8	-163.7	173.9	75	167.4	2.5	111.6	C136 G142 R143	C136-R139 PolarHBondContact O-N 2.89Å; R139-G142 PolarHBondContact O-N 3.19Å; R139-R143 PolarHBondContact O-N 2.8Å
140	D	56.3	Low	54.2	Low	70 Å²	70	122.7 Å²	122.7	37%	0.374	59%	0.586	S	S	.	*	H	α-helix	trans	-73.2	-30.7	174	-76.7	-30.3	0	0	0	112.7	C136 N137 R143 R144	C136-D140 PolarHBondContact O-N 3.39Å; C136-D140 VanDerWaalsContact O-N 3.15Å; N137-D140 PolarHBondContact O-N 3.32Å; D140-R143 PolarHBondContact O-N 2.95Å; D140-R144 WeakPolarHBondContact O-CG 3.18Å; D140-R144 PolarHBondContact O-N 3.45Å
141	L	55.5	Low	54.1	Low	90 Å²	90	123.4 Å²	123.4	47%	0.471	58%	0.576	S	S	.	*	H	α-helix	trans	-64	-43.2	170.4	-88.5	156.4	0	0	0	111.2	N137 L138 R143 R144 V145	N137-L141 VanDerWaalsContact O-CB 3.23Å; N137-L141 WeakPolarHBondContact O-CB 3.34Å; N137-L141 WeakPolarHBondContact O-CD1 3.37Å; N137-L141 VanDerWaalsContact O-CG 3.27Å; N137-L141 WeakPolarHBondContact O-CG 3.28Å; N137-L141 PolarHBondContact O-N 3.27Å; L138-L141 PolarHBondContact O-N 3.38Å; L141-R143 VanDerWaalsContact C-N 3.26Å; L141-R143 PolarHBondContact O-N 3.39Å; L141-R144 PolarHBondContact O-N 2.82Å; L141-R144 VanDerWaalsContact O-N 3.17Å; L141-V145 VanDerWaalsContact O-CG2 3.32Å; L141-V145 WeakPolarHBondContact O-CG2 3.27Å; L141-V145 PolarHBondContact O-N 3.39Å
142	G	61.2	Low	53.8	Low	44 Å²	44	122.1 Å²	122.1	45%	0.454	58%	0.58	S	S	.	*	H	α-helix	trans	-58.2	-39.1	174.3	0	0	0	0	0	112.6	L138 R139 H146	L138-G142 PolarHBondContact O-N 2.82Å; R139-G142 PolarHBondContact O-N 3.19Å; G142-H146 PolarHBondContact O-N 2.78Å; G142-H146 VanDerWaalsContact O-N 3.14Å
143	R	55.5	Low	53.3	Low	193 Å²	193	124.3 Å²	124.3	73%	0.728	60%	0.597	S	S	*	*	H	α-helix	trans	-71	-36.3	176.6	-160.5	178.5	-90.8	-168.8	-7.5	112.4	R139 D140 L141 L147	R139-R143 PolarHBondContact O-N 2.8Å; D140-R143 PolarHBondContact O-N 2.95Å; L141-R143 VanDerWaalsContact C-N 3.26Å; L141-R143 PolarHBondContact O-N 3.39Å; R143-L147 PolarHBondContact O-N 2.69Å
144	R	55	Low	52.8	Low	172 Å²	172	125.2 Å²	125.2	65%	0.649	61%	0.606	S	S	*	*	H	α-helix	trans	-71.1	-35.6	174.6	-69.9	-179.1	-153.1	-132.6	7.2	113.2	D140 L141 L147 R148	D140-R144 WeakPolarHBondContact O-CG 3.18Å; D140-R144 PolarHBondContact O-N 3.45Å; L141-R144 PolarHBondContact O-N 2.82Å; L141-R144 VanDerWaalsContact O-N 3.17Å; R144-L147 PolarHBondContact O-N 3.25Å; R144-R148 PolarHBondContact O-N 3.42Å
145	V	56.5	Low	52.5	Low	97 Å²	97	119.7 Å²	119.7	59%	0.588	61%	0.607	S	S	*	*	H	α-helix	trans	-66.7	-39.7	175	170.5	0	0	0	0	110.8	L141 L147 R148 K149	L141-V145 VanDerWaalsContact O-CG2 3.32Å; L141-V145 WeakPolarHBondContact O-CG2 3.27Å; L141-V145 PolarHBondContact O-N 3.39Å; V145-L147 VanDerWaalsContact C-N 3.32Å; V145-L147 PolarHBondContact O-N 2.86Å; V145-R148 PolarHBondContact O-N 3.17Å; V145-K149 PolarHBondContact O-N 3.31Å
146	H	53.5	Low	52.1	Low	146 Å²	146	119.9 Å²	119.9	68%	0.676	61%	0.614	S	S	*	*	H	α-helix	trans	-67.1	-33.3	176.9	-145.9	-73.7	0	0	0	112.7	G142 L150	G142-H146 PolarHBondContact O-N 2.78Å; G142-H146 VanDerWaalsContact O-N 3.14Å; H146-L150 PolarHBondContact O-N 2.84Å
147	L	51.3	Low	51.4	Low	108 Å²	108	124.1 Å²	124.1	57%	0.565	63%	0.629	S	S	*	*	H	α-helix	trans	-74.8	-41.1	175.9	-155.6	120.4	0	0	0	111.9	R143 R144 V145 K149 L150 E151	R143-L147 PolarHBondContact O-N 2.69Å; R144-L147 PolarHBondContact O-N 3.25Å; V145-L147 VanDerWaalsContact C-N 3.32Å; V145-L147 PolarHBondContact O-N 2.86Å; L147-K149 VanDerWaalsContact C-N 3.3Å; L147-K149 PolarHBondContact O-N 3.49Å; L147-L150 WeakPolarHBondContact O-CB 3.1Å; L147-L150 PolarHBondContact O-N 3.37Å; L147-L150 VanDerWaalsContact O-N 3.16Å; L147-E151 PolarHBondContact O-N 2.7Å
148	R	52.6	Low	50.9	Low	195 Å²	195	125.1 Å²	125.1	74%	0.736	64%	0.637	S	S	*	*	H	α-helix	trans	-60.8	-36.8	172.9	-108.9	-176.9	179.9	172	-0.9	112.9	R144 V145 L150 E151 D152	R144-R148 PolarHBondContact O-N 3.42Å; V145-R148 PolarHBondContact O-N 3.17Å; R148-L150 VanDerWaalsContact C-N 3.3Å; R148-L150 PolarHBondContact O-N 2.79Å; R148-E151 PolarHBondContact O-N 3.32Å; R148-D152 PolarHBondContact O-N 2.73Å
149	K	46.8	Very low	50.4	Low	161 Å²	161	128.5 Å²	128.5	70%	0.7	65%	0.65	S	S	*	*	H	α-helix	trans	-67.3	-30.1	176.9	-164.8	176.3	-177.5	-179.2	0	112.7	V145 L147 S153	V145-K149 PolarHBondContact O-N 3.31Å; L147-K149 VanDerWaalsContact C-N 3.3Å; L147-K149 PolarHBondContact O-N 3.49Å; K149-S153 WeakPolarHBondContact O-CB 3.3Å; K149-S153 PolarHBondContact O-N 2.91Å
150	L	46.6	Very low	50	Low	131 Å²	131	126.1 Å²	126.1	69%	0.686	65%	0.651	S	S	*	*	H	α-helix	trans	-73.6	-37.5	172.9	-170.7	70.4	0	0	0	111.2	H146 L147 R148 S153 S154	H146-L150 PolarHBondContact O-N 2.84Å; L147-L150 WeakPolarHBondContact O-CB 3.1Å; L147-L150 PolarHBondContact O-N 3.37Å; L147-L150 VanDerWaalsContact O-N 3.16Å; R148-L150 VanDerWaalsContact C-N 3.3Å; R148-L150 PolarHBondContact O-N 2.79Å; L150-S153 PolarHBondContact O-N 2.82Å; L150-S154 PolarHBondContact O-N 3.45Å; L150-S154 VanDerWaalsContact O-N 3.1Å
151	E	49.1	Very low	49.1	Very low	133 Å²	133	131 Å²	131	62%	0.621	67%	0.669	S	S	*	*	H	α-helix	trans	-73.4	-40.2	-179.3	-148.2	150.5	142.9	0	0	112.6	L147 R148 S153 S154 G155	L147-E151 PolarHBondContact O-N 2.7Å; R148-E151 PolarHBondContact O-N 3.32Å; E151-S153 VanDerWaalsContact C-N 3.29Å; E151-S153 PolarHBondContact O-N 2.73Å; E151-S154 WeakPolarHBondContact O-CB 3.44Å; E151-S154 PolarHBondContact O-N 2.92Å; E151-S154 VanDerWaalsContact O-N 3.13Å; E151-G155 PolarHBondContact O-N 3.2Å
152	D	48.7	Very low	48.4	Very low	123 Å²	123	135.4 Å²	135.4	66%	0.658	69%	0.687	S	S	*	*	H	α-helix	trans	-67.8	-28	172.2	-83.1	-23.1	0	0	0	112.4	R148 S154 N156	R148-D152 PolarHBondContact O-N 2.73Å; D152-S154 VanDerWaalsContact C-N 3.34Å; D152-N156 PolarHBondContact O-N 2.81Å
153	S	47.4	Very low	47.3	Very low	88 Å²	88	140.5 Å²	140.5	62%	0.615	70%	0.697	S	S	*	*	H	α-helix	trans	-74.9	-24.6	172.3	-167.8	0	0	0	0	112.7	K149 L150 E151	K149-S153 WeakPolarHBondContact O-CB 3.3Å; K149-S153 PolarHBondContact O-N 2.91Å; L150-S153 PolarHBondContact O-N 2.82Å; E151-S153 VanDerWaalsContact C-N 3.29Å; E151-S153 PolarHBondContact O-N 2.73Å
154	S	44.7	Very low	46.8	Very low	93 Å²	93	138 Å²	138	65%	0.65	70%	0.697	S	S	*	*	H	α-helix	trans	-81.8	-28.4	172.4	-171	0	0	0	0	112.1	L150 E151 D152	L150-S154 PolarHBondContact O-N 3.45Å; L150-S154 VanDerWaalsContact O-N 3.1Å; E151-S154 WeakPolarHBondContact O-CB 3.44Å; E151-S154 PolarHBondContact O-N 2.92Å; E151-S154 VanDerWaalsContact O-N 3.13Å; D152-S154 VanDerWaalsContact C-N 3.34Å
155	G	46.5	Very low	46.1	Very low	72 Å²	72	139.3 Å²	139.3	74%	0.742	70%	0.703	S	S	*	*	H	α-helix	trans	-77.4	-17.7	176.7	0	0	0	0	0	114.8	E151	E151-G155 PolarHBondContact O-N 3.2Å
156	N	44.2	Very low	45.7	Very low	127 Å²	127	142.4 Å²	142.4	68%	0.679	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.7	28.8	178.8	-155	16.1	0	0	0	113.2	D152 V158	D152-N156 PolarHBondContact O-N 2.81Å; N156-V158 VanDerWaalsContact C-N 3.28Å; N156-V158 PolarHBondContact O-N 3.1Å
157	M	43	Very low	45.3	Very low	161 Å²	161	142.7 Å²	142.7	79%	0.793	72%	0.718	S	S	*	*			trans	-76.9	87.8	166.1	-159.1	171.4	-172.7	0	0	107.5	H159	M157-H159 PolarHBondContact O-N 3.18Å
158	V	45.8	Very low	45	Very low	106 Å²	106	141.1 Å²	141.1	64%	0.642	73%	0.727	S	S	*	*			trans	-49.8	112.1	167.9	175.6	0	0	0	0	106.9	N156 I160	N156-V158 VanDerWaalsContact C-N 3.28Å; N156-V158 PolarHBondContact O-N 3.1Å; V158-I160 VanDerWaalsContact C-N 3.31Å; V158-I160 PolarHBondContact O-N 3.07Å
159	H	43	Very low	44.5	Very low	181 Å²	181	140.3 Å²	140.3	84%	0.838	73%	0.732	S	S	*	*			trans	-55.3	97.9	171.1	-85.1	-90.3	0	0	0	108	M157 K161	M157-H159 PolarHBondContact O-N 3.18Å; H159-K161 PolarHBondContact O-N 2.89Å
160	I	45.8	Very low	44.9	Very low	157 Å²	157	138.2 Å²	138.2	81%	0.805	74%	0.735	S	S	*	*			trans	-69.2	87.5	164.3	-61.9	176.2	0	0	0	104.9	V158 Q162	V158-I160 VanDerWaalsContact C-N 3.31Å; V158-I160 PolarHBondContact O-N 3.07Å; I160-Q162 VanDerWaalsContact C-N 3.34Å; I160-Q162 PolarHBondContact O-N 2.94Å
161	K	38.7	Very low	44.8	Very low	172 Å²	172	137.3 Å²	137.3	75%	0.748	74%	0.739	S	S	*	*			trans	-61.5	97.7	172.8	-168.2	179.5	-174	174.9	0	106.6	H159 K163	H159-K161 PolarHBondContact O-N 2.89Å; K161-K163 VanDerWaalsContact C-N 3.27Å; K161-K163 PolarHBondContact O-N 3.41Å
162	Q	39.4	Very low	45	Very low	183 Å²	183	136.6 Å²	136.6	86%	0.855	75%	0.746	S	S	*	*			trans	-61.3	92.8	170.9	-169.4	174	-17.3	0	0	107.6	I160 L164	I160-Q162 VanDerWaalsContact C-N 3.34Å; I160-Q162 PolarHBondContact O-N 2.94Å; Q162-L164 PolarHBondContact O-N 3.02Å; Q162-L164 VanDerWaalsContact O-N 3.1Å
163	K	40	Very low	45	Very low	152 Å²	152	142.4 Å²	142.4	66%	0.661	76%	0.759	S	S	*	*			trans	-72	102	174.2	-73.4	-174.3	-179.5	179.4	0	107.4	K161 Y165	K161-K163 VanDerWaalsContact C-N 3.27Å; K161-K163 PolarHBondContact O-N 3.41Å; K163-Y165 WeakPolarHBondContact O-CD2 3.42Å; K163-Y165 PolarHBondContact O-N 3.1Å
164	L	44.1	Very low	44.7	Very low	139 Å²	139	146 Å²	146	73%	0.728	77%	0.771	S	S	*	*			trans	-63.5	109.1	166.5	-172	71.4	0	0	0	107.9	Q162 H166	Q162-L164 PolarHBondContact O-N 3.02Å; Q162-L164 VanDerWaalsContact O-N 3.1Å; L164-H166 PolarHBondContact O-N 3.33Å
165	Y	41	Very low	44.6	Very low	200 Å²	200	153.4 Å²	153.4	78%	0.784	80%	0.802	S	S	*	*			trans	-73.1	114.9	172.6	-71.2	-90.6	0	0	0	108.6	K163	K163-Y165 WeakPolarHBondContact O-CD2 3.42Å; K163-Y165 PolarHBondContact O-N 3.1Å
166	H	47.9	Very low	44.5	Very low	163 Å²	163	157.5 Å²	157.5	76%	0.755	81%	0.805	S	S	*	*			trans	-81.4	114	161.1	-80.3	2.8	0	0	0	107.9	L164 G168	L164-H166 PolarHBondContact O-N 3.33Å; H166-G168 PolarHBondContact O-N 3.44Å; H166-G168 VanDerWaalsContact O-N 3.1Å
167	N	43.8	Very low	44.5	Very low	152 Å²	152	159.1 Å²	159.1	81%	0.813	81%	0.811	S	S	*	*			trans	-63.2	109.8	167.3	-73	-32.9	0	0	0	108	H169	N167-H169 PolarHBondContact O-N 3.1Å; N167-H169 VanDerWaalsContact O-N 3.1Å
168	G	45.4	Very low	44.6	Very low	74 Å²	74	158.9 Å²	158.9	76%	0.763	81%	0.812	S	S	*	*			trans	-66.6	104.6	176.6	0	0	0	0	0	110.5	H166	H166-G168 PolarHBondContact O-N 3.44Å; H166-G168 VanDerWaalsContact O-N 3.1Å
169	H	43	Very low	44.5	Very low	179 Å²	179	162.1 Å²	162.1	83%	0.829	82%	0.822	S	S	*	*	P	Polyproline II helix	trans	-89.5	124.2	157.1	-101.8	-83.6	0	0	0	108.6	N167	N167-H169 PolarHBondContact O-N 3.1Å; N167-H169 VanDerWaalsContact O-N 3.1Å
170	P	53.8	Low	44.6	Very low	117 Å²	117	160.9 Å²	160.9	76%	0.76	82%	0.821	S	S	*	*	P	Polyproline II helix	trans	-73.3	132.4	174.2	27.7	-30.8	0	0	0	111
171	S	45.8	Very low	44.5	Very low	112 Å²	112	161.1 Å²	161.1	78%	0.783	82%	0.823	S	S	*	*	P	Polyproline II helix	trans	-71.7	130.9	166.2	170.6	0	0	0	0	109.8
172	P	52.3	Low	44.9	Very low	118 Å²	118	160.4 Å²	160.4	77%	0.766	83%	0.828	S	S	*	*	P	Polyproline II helix	trans	-78.8	124.8	171.7	30.7	-31.5	0	0	0	110.1
173	R	48.3	Very low	45.3	Very low	245 Å²	245	158.6 Å²	158.6	93%	0.925	83%	0.826	S	S	*	*	P	Polyproline II helix	trans	-69.8	140.6	171	-108.2	175	170.7	156.9	-3.9	110.1
174	N	41.8	Very low	45.8	Very low	162 Å²	162	159.2 Å²	159.2	87%	0.866	84%	0.84	S	S	*	*	P	Polyproline II helix	trans	-49.1	130	170.7	-63.9	-47.6	0	0	0	113.1
175	L	42.3	Very low	45.9	Very low	249 Å²	249	161 Å²	161	100%	1.304	85%	0.85	S	S	*	*			trans	-154.4	0	140.3	-103.9	158.5	0	0	0	107.6

Retrieved 175 of 175 residues in 132.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).