A0A060WRS0_ONCMY Loading...

Basic leucine zipper transcription factor, ATF-like 3

AlphaFold DB , UniProt , Accession A0A060WRS0, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene batf3, Length 129 aa.

						>A0A060WRS0_ONCMY|A0A060WRS0|batf3
MSDSDISGSFLHSKNQNMLLLEICELQSSGDDGDEDRRLKRREKNRVAAKNSRKKQTQRADELHEAYECLEQKNRQLKKDVQFLSEEQRRLTEALKAHEPLCPIMHCVANLGSGTLGPRDVGVPSYLPR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.2	Very low	50.4	Low	241 Å²	241	99.5 Å²	99.5	100%	1.187	58%	0.576	S	S	*	*				0	128	0	-74.7	152.5	100.7	0	0	105.8
2	S	44.2	Very low	51.1	Low	64 Å²	64	101.2 Å²	101.2	45%	0.448	57%	0.574	S	S	.	*			trans	-79.9	126.9	-145.8	12.8	0	0	0	0	115.2	S4 D5	S2-S4 VanDerWaalsContact CB-OG 3.23Å; S2-S4 WeakPolarHBondContact CB-OG 3.3Å; S2-S4 PolarHBondContact O-N 3.12Å; S2-D5 PolarHBondContact O-N 2.88Å; S2-D5 PolarHBondContact OG-OD2 3.14Å
3	D	41.1	Very low	51.8	Low	146 Å²	146	94.9 Å²	94.9	78%	0.781	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.4	-15.2	168.5	-66.1	-40.3	0	0	0	113.5	D5	D3-D5 PolarHBondContact O-N 3.28Å
4	S	47.2	Very low	52.5	Low	86 Å²	86	96.2 Å²	96.2	60%	0.601	54%	0.537	S	S	*	.	H	α-helix	trans	-71.1	-21.7	179.3	21.5	0	0	0	0	114.6	S2	S2-S4 VanDerWaalsContact CB-OG 3.23Å; S2-S4 WeakPolarHBondContact CB-OG 3.3Å; S2-S4 PolarHBondContact O-N 3.12Å
5	D	50.2	Low	53.1	Low	106 Å²	106	96.9 Å²	96.9	57%	0.567	54%	0.539	S	S	*	.	H	α-helix	trans	-84.3	-25.6	-173.9	-62.9	-45.6	0	0	0	112.9	S2 D3 S9	S2-D5 PolarHBondContact O-N 2.88Å; S2-D5 PolarHBondContact OG-OD2 3.14Å; D3-D5 PolarHBondContact O-N 3.28Å; D5-S9 PolarHBondContact O-N 3.16Å; D5-S9 PolarHBondContact O-OG 3.29Å; D5-S9 VanDerWaalsContact O-OG 3.08Å
6	I	54	Low	53.8	Low	111 Å²	111	97.2 Å²	97.2	57%	0.569	54%	0.535	S	S	*	.	H	α-helix	trans	-72	-39.8	178.3	-59.7	179	0	0	0	110.6	S9 F10	I6-S9 PolarHBondContact O-OG 3.4Å; I6-F10 WeakPolarHBondContact O-CB 3.44Å; I6-F10 PolarHBondContact O-N 3.35Å; I6-F10 VanDerWaalsContact O-N 3.1Å
7	S	55.9	Low	54.6	Low	70 Å²	70	92.1 Å²	92.1	49%	0.49	51%	0.507	S	S	.	.	H	α-helix	trans	-67.8	-41.4	178	-172.2	0	0	0	0	112	F10 L11	S7-F10 PolarHBondContact O-N 2.87Å; S7-L11 WeakPolarHBondContact O-CB 3.48Å; S7-L11 WeakPolarHBondContact O-CG 3.32Å; S7-L11 PolarHBondContact O-N 3.35Å
8	G	52.5	Low	55.5	Low	40 Å²	40	92.4 Å²	92.4	41%	0.412	51%	0.506	S	S	.	.	H	α-helix	trans	-63.1	-44.6	178.1	0	0	0	0	0	113.2	H12	G8-H12 VanDerWaalsContact O-CB 3.26Å; G8-H12 WeakPolarHBondContact O-CB 3.49Å; G8-H12 PolarHBondContact O-N 3.32Å
9	S	56.4	Low	56.1	Low	73 Å²	73	92.7 Å²	92.7	51%	0.51	51%	0.506	S	S	.	.	H	α-helix	trans	-70.2	-32.7	177.8	60	0	0	0	0	113	D5 I6 S13	D5-S9 PolarHBondContact O-N 3.16Å; D5-S9 PolarHBondContact O-OG 3.29Å; D5-S9 VanDerWaalsContact O-OG 3.08Å; I6-S9 PolarHBondContact O-OG 3.4Å; S9-S13 WeakPolarHBondContact O-CB 3.48Å; S9-S13 PolarHBondContact O-N 3.38Å
10	F	54.4	Low	56.6	Low	65 Å²	65	91.1 Å²	91.1	29%	0.285	50%	0.496	S	S	.	.	H	α-helix	trans	-67.4	-45.4	174.3	-178.5	-106	0	0	0	112.6	I6 S7 S13 K14	I6-F10 WeakPolarHBondContact O-CB 3.44Å; I6-F10 PolarHBondContact O-N 3.35Å; I6-F10 VanDerWaalsContact O-N 3.1Å; S7-F10 PolarHBondContact O-N 2.87Å; F10-S13 PolarHBondContact O-N 2.8Å; F10-K14 HydrophobicContact CD1-CD 4.22Å; F10-K14 HydrophobicContact CE1-CD 3.81Å; F10-K14 HydrophobicContact CZ-CD 4.09Å; F10-K14 PolarHBondContact O-N 3.48Å
11	L	55.4	Low	57.1	Low	93 Å²	93	89 Å²	89	49%	0.487	49%	0.485	S	S	.	.	H	α-helix	trans	-64.2	-46.1	174.7	-73	166.3	0	0	0	111.3	S7 S13 K14 N15	S7-L11 WeakPolarHBondContact O-CB 3.48Å; S7-L11 WeakPolarHBondContact O-CG 3.32Å; S7-L11 PolarHBondContact O-N 3.35Å; L11-S13 VanDerWaalsContact C-N 3.32Å; L11-S13 PolarHBondContact O-N 2.91Å; L11-K14 PolarHBondContact O-N 2.93Å; L11-N15 WeakPolarHBondContact O-CB 3.47Å; L11-N15 VanDerWaalsContact O-CG 3.26Å; L11-N15 PolarHBondContact O-N 3.12Å; L11-N15 PolarHBondContact O-ND2 3.16Å
12	H	59.3	Low	58.2	Low	119 Å²	119	82.2 Å²	82.2	55%	0.551	45%	0.45	S	S	*	.	H	α-helix	trans	-60.5	-41.3	177.8	-160.6	88.5	0	0	0	112	G8 N15 Q16	G8-H12 VanDerWaalsContact O-CB 3.26Å; G8-H12 WeakPolarHBondContact O-CB 3.49Å; G8-H12 PolarHBondContact O-N 3.32Å; H12-N15 PolarHBondContact O-N 3Å; H12-Q16 PolarHBondContact CD2-NE2 2.91Å; H12-Q16 VanDerWaalsContact CD2-NE2 3.27Å; H12-Q16 PolarHBondContact NE2-NE2 2.99Å; H12-Q16 VanDerWaalsContact NE2-NE2 3.11Å; H12-Q16 WeakPolarHBondContact O-CG 3.29Å; H12-Q16 PolarHBondContact O-N 2.9Å
13	S	60.1	Low	59.2	Low	20 Å²	20	82.5 Å²	82.5	14%	0.14	45%	0.446	C	S	.	.	H	α-helix	trans	-69.3	-34.6	176	173.6	0	0	0	0	113.3	S9 F10 L11 N17 K54	S9-S13 WeakPolarHBondContact O-CB 3.48Å; S9-S13 PolarHBondContact O-N 3.38Å; F10-S13 PolarHBondContact O-N 2.8Å; L11-S13 VanDerWaalsContact C-N 3.32Å; L11-S13 PolarHBondContact O-N 2.91Å; S13-N17 WeakPolarHBondContact O-CB 3.26Å; S13-N17 PolarHBondContact O-N 3.37Å; S13-N17 VanDerWaalsContact O-N 3.15Å; S13-N17 PolarHBondContact O-ND2 3.22Å; S13-N17 VanDerWaalsContact O-ND2 3.09Å; S13-K54 VanDerWaalsContact CB-NZ 3.33Å; S13-K54 PolarHBondContact OG-NZ 3.39Å
14	K	60.6	Low	60.1	Low	113 Å²	113	77.1 Å²	77.1	49%	0.491	42%	0.419	S	S	.	.	H	α-helix	trans	-67.6	-44.4	173	-83.7	-178	169.1	178.1	0	110.8	F10 L11 N17 M18	F10-K14 HydrophobicContact CD1-CD 4.22Å; F10-K14 HydrophobicContact CE1-CD 3.81Å; F10-K14 HydrophobicContact CZ-CD 4.09Å; F10-K14 PolarHBondContact O-N 3.48Å; L11-K14 PolarHBondContact O-N 2.93Å; K14-N17 PolarHBondContact O-N 2.88Å; K14-M18 WeakPolarHBondContact O-CB 3.39Å; K14-M18 PolarHBondContact O-N 3.26Å
15	N	61.7	Low	60.8	Low	106 Å²	106	77.7 Å²	77.7	57%	0.567	41%	0.412	S	S	*	.	H	α-helix	trans	-62.7	-42	177.4	-70.9	-25	0	0	0	112	L11 H12 M18 L19	L11-N15 WeakPolarHBondContact O-CB 3.47Å; L11-N15 VanDerWaalsContact O-CG 3.26Å; L11-N15 PolarHBondContact O-N 3.12Å; L11-N15 PolarHBondContact O-ND2 3.16Å; H12-N15 PolarHBondContact O-N 3Å; N15-M18 PolarHBondContact O-N 3.26Å; N15-L19 VanDerWaalsContact O-CB 3.24Å; N15-L19 WeakPolarHBondContact O-CB 3.09Å; N15-L19 PolarHBondContact O-N 3.31Å
16	Q	65.4	Low	61.2	Low	102 Å²	102	79.2 Å²	79.2	48%	0.477	42%	0.42	S	S	.	.	H	α-helix	trans	-64.4	-40.6	173.9	-77.5	-177.8	-2.2	0	0	113.1	H12 L20	H12-Q16 PolarHBondContact CD2-NE2 2.91Å; H12-Q16 VanDerWaalsContact CD2-NE2 3.27Å; H12-Q16 PolarHBondContact NE2-NE2 2.99Å; H12-Q16 VanDerWaalsContact NE2-NE2 3.11Å; H12-Q16 WeakPolarHBondContact O-CG 3.29Å; H12-Q16 PolarHBondContact O-N 2.9Å; Q16-L20 WeakPolarHBondContact O-CB 3.33Å; Q16-L20 PolarHBondContact O-N 2.96Å
17	N	66.2	Low	61.3	Low	10 Å²	10	81 Å²	81	5%	0.053	43%	0.426	C	S	.	.	H	α-helix	trans	-71.3	-31.7	178.4	-71.7	-30.4	0	0	0	112	S13 K14 L21 V47 K50 N51	S13-N17 WeakPolarHBondContact O-CB 3.26Å; S13-N17 PolarHBondContact O-N 3.37Å; S13-N17 VanDerWaalsContact O-N 3.15Å; S13-N17 PolarHBondContact O-ND2 3.22Å; S13-N17 VanDerWaalsContact O-ND2 3.09Å; K14-N17 PolarHBondContact O-N 2.88Å; N17-L21 PolarHBondContact O-N 3.17Å; N17-V47 HydrophobicContact CB-CG1 4.09Å; N17-K50 PolarHBondContact OD1-NZ 3.34Å; N17-N51 PolarHBondContact ND2-OD1 2.9Å
18	M	71.7	Confident	61.2	Low	99 Å²	99	79.6 Å²	79.6	49%	0.488	42%	0.416	S	S	.	.	H	α-helix	trans	-67.8	-52	171.2	-118.3	-92.9	44.5	0	0	110.3	K14 N15 L20 L21 E22	K14-M18 WeakPolarHBondContact O-CB 3.39Å; K14-M18 PolarHBondContact O-N 3.26Å; N15-M18 PolarHBondContact O-N 3.26Å; M18-L20 PolarHBondContact O-N 2.89Å; M18-L21 WeakPolarHBondContact O-CA 3.5Å; M18-L21 VanDerWaalsContact O-CB 3.27Å; M18-L21 WeakPolarHBondContact O-CB 3.39Å; M18-L21 PolarHBondContact O-N 3.41Å; M18-E22 HydrophobicContact CE-CB 3.91Å; M18-E22 PolarHBondContact O-N 3.41Å
19	L	67.1	Low	61.2	Low	97 Å²	97	83.6 Å²	83.6	51%	0.508	44%	0.438	S	S	.	.	H	α-helix	trans	-56.5	-39.7	-180	-176.5	64.6	0	0	0	112	N15 L21 E22 I23	N15-L19 VanDerWaalsContact O-CB 3.24Å; N15-L19 WeakPolarHBondContact O-CB 3.09Å; N15-L19 PolarHBondContact O-N 3.31Å; L19-L21 VanDerWaalsContact C-N 3.34Å; L19-L21 PolarHBondContact O-N 3.14Å; L19-E22 PolarHBondContact O-N 3.42Å; L19-I23 HydrophobicContact CD1-CD1 4.22Å; L19-I23 HydrophobicContact CD1-CG1 4.38Å; L19-I23 HydrophobicContact CD2-CD1 4.45Å; L19-I23 HydrophobicContact CG-CD1 3.81Å; L19-I23 HydrophobicContact CG-CG1 4.4Å; L19-I23 WeakPolarHBondContact O-CB 3.5Å; L19-I23 WeakPolarHBondContact O-CD1 3.38Å; L19-I23 WeakPolarHBondContact O-CG1 3.33Å; L19-I23 PolarHBondContact O-N 2.96Å
20	L	66.4	Low	60.8	Low	60 Å²	60	82.7 Å²	82.7	31%	0.314	44%	0.44	S	S	.	.	H	α-helix	trans	-69.7	-31.3	177.4	-173.6	54.7	0	0	0	113.2	Q16 M18 C24 E43	Q16-L20 WeakPolarHBondContact O-CB 3.33Å; Q16-L20 PolarHBondContact O-N 2.96Å; M18-L20 PolarHBondContact O-N 2.89Å; L20-C24 PolarHBondContact O-N 3.46Å; L20-E43 VanDerWaalsContact CD2-OE1 3.25Å; L20-E43 WeakPolarHBondContact CD2-OE1 3.39Å; L20-E43 VanDerWaalsContact CG-OE1 3.32Å; L20-E43 WeakPolarHBondContact CG-OE1 3.05Å
21	L	66.6	Low	61.2	Low	49 Å²	49	88 Å²	88	26%	0.257	47%	0.471	S	S	.	.	H	α-helix	trans	-68	-41.6	172.6	-155.3	70.2	0	0	0	111	N17 M18 L19 C24 E25 K44	N17-L21 PolarHBondContact O-N 3.17Å; M18-L21 WeakPolarHBondContact O-CA 3.5Å; M18-L21 VanDerWaalsContact O-CB 3.27Å; M18-L21 WeakPolarHBondContact O-CB 3.39Å; M18-L21 PolarHBondContact O-N 3.41Å; L19-L21 VanDerWaalsContact C-N 3.34Å; L19-L21 PolarHBondContact O-N 3.14Å; L21-C24 PolarHBondContact O-N 3.04Å; L21-E25 WeakPolarHBondContact O-CG 3.48Å; L21-E25 PolarHBondContact O-N 3.04Å; L21-K44 HydrophobicContact CD1-CG 3.67Å
22	E	66.5	Low	61.1	Low	97 Å²	97	90.4 Å²	90.4	45%	0.453	48%	0.484	S	S	.	.	H	α-helix	trans	-70.9	-39.7	-178.6	-163.8	165.2	-160.1	0	0	112.1	M18 L19 C24 E25 L26	M18-E22 HydrophobicContact CE-CB 3.91Å; M18-E22 PolarHBondContact O-N 3.41Å; L19-E22 PolarHBondContact O-N 3.42Å; E22-C24 VanDerWaalsContact C-N 3.32Å; E22-C24 PolarHBondContact O-N 3.02Å; E22-E25 PolarHBondContact O-N 2.67Å; E22-L26 HydrophobicContact CG-CD1 4.45Å; E22-L26 WeakPolarHBondContact O-CG 3.5Å; E22-L26 PolarHBondContact O-N 2.71Å
23	I	65	Low	61.3	Low	71 Å²	71	87.3 Å²	87.3	36%	0.364	49%	0.485	S	S	.	.	H	α-helix	trans	-60.2	-40.2	173.9	-72.9	166.7	0	0	0	111.4	L19 E25 L26 Q27	L19-I23 HydrophobicContact CD1-CD1 4.22Å; L19-I23 HydrophobicContact CD1-CG1 4.38Å; L19-I23 HydrophobicContact CD2-CD1 4.45Å; L19-I23 HydrophobicContact CG-CD1 3.81Å; L19-I23 HydrophobicContact CG-CG1 4.4Å; L19-I23 WeakPolarHBondContact O-CB 3.5Å; L19-I23 WeakPolarHBondContact O-CD1 3.38Å; L19-I23 WeakPolarHBondContact O-CG1 3.33Å; L19-I23 PolarHBondContact O-N 2.96Å; I23-E25 VanDerWaalsContact C-N 3.28Å; I23-E25 PolarHBondContact O-N 2.85Å; I23-L26 PolarHBondContact O-N 3.14Å; I23-Q27 WeakPolarHBondContact O-CG 3.49Å; I23-Q27 PolarHBondContact O-N 3.22Å
24	C	59	Low	61.9	Low	32 Å²	32	92.2 Å²	92.2	22%	0.216	51%	0.51	C	S	.	.	H	α-helix	trans	-71.7	-20.1	175.7	-75.4	0	0	0	0	113.7	L20 L21 E22 K40	L20-C24 PolarHBondContact O-N 3.46Å; L21-C24 PolarHBondContact O-N 3.04Å; E22-C24 VanDerWaalsContact C-N 3.32Å; E22-C24 PolarHBondContact O-N 3.02Å; C24-K40 WeakPolarHBondContact O-CE 3.3Å
25	E	62.4	Low	62.6	Low	99 Å²	99	91.9 Å²	91.9	46%	0.463	51%	0.51	S	S	.	.	H	α-helix	trans	-83.3	-29.7	175.9	-72.5	178.7	171.9	0	0	111.8	L21 E22 I23 K44	L21-E25 WeakPolarHBondContact O-CG 3.48Å; L21-E25 PolarHBondContact O-N 3.04Å; E22-E25 PolarHBondContact O-N 2.67Å; I23-E25 VanDerWaalsContact C-N 3.28Å; I23-E25 PolarHBondContact O-N 2.85Å; E25-K44 IonicContact OE1-NZ 2.87Å; E25-K44 PolarHBondContact OE1-NZ 3.27Å
26	L	58	Low	63.5	Low	137 Å²	137	89 Å²	89	72%	0.717	50%	0.495	S	S	*	.	H	α-helix	trans	-82.7	-20.4	-178.3	-70.4	170.6	0	0	0	115.5	E22 I23 S28	E22-L26 HydrophobicContact CG-CD1 4.45Å; E22-L26 WeakPolarHBondContact O-CG 3.5Å; E22-L26 PolarHBondContact O-N 2.71Å; I23-L26 PolarHBondContact O-N 3.14Å; L26-S28 PolarHBondContact O-N 2.93Å; L26-S28 VanDerWaalsContact O-N 3.17Å
27	Q	57.2	Low	64.3	Low	149 Å²	149	93 Å²	93	70%	0.696	51%	0.505	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.7	10.6	-177.2	-74.7	177.3	-29.7	0	0	114.8	I23	I23-Q27 WeakPolarHBondContact O-CG 3.49Å; I23-Q27 PolarHBondContact O-N 3.22Å
28	S	54.6	Low	65.2	Low	40 Å²	40	98.5 Å²	98.5	28%	0.28	53%	0.525	S	S	.	.			trans	-121.6	44.5	-160.2	-149	0	0	0	0	113.8	L26 G30 D36 K40	L26-S28 PolarHBondContact O-N 2.93Å; L26-S28 VanDerWaalsContact O-N 3.17Å; S28-G30 VanDerWaalsContact C-N 3.32Å; S28-G30 PolarHBondContact O-N 2.88Å; S28-D36 PolarHBondContact OG-OD1 3Å; S28-D36 VanDerWaalsContact OG-OD1 3.09Å; S28-D36 PolarHBondContact OG-OD2 2.92Å; S28-K40 PolarHBondContact OG-NZ 3.29Å
29	S	52.3	Low	65.8	Low	125 Å²	125	99 Å²	99	87%	0.874	53%	0.529	S	S	*	.			trans	-95.2	56.9	169.5	65.2	0	0	0	0	110.9
30	G	48.3	Very low	66.5	Low	54 Å²	54	96.9 Å²	96.9	56%	0.557	52%	0.516	S	S	*	.	S	Bend	trans	-157.2	127.2	177.4	0	0	0	0	0	110.7	S28 D32	S28-G30 VanDerWaalsContact C-N 3.32Å; S28-G30 PolarHBondContact O-N 2.88Å; G30-D32 VanDerWaalsContact C-N 3.31Å; G30-D32 PolarHBondContact O-N 3.26Å
31	D	61.7	Low	67.6	Low	176 Å²	176	103.5 Å²	103.5	94%	0.941	54%	0.537	S	S	*	.			trans	-62.5	85.1	172.8	-178.5	41.4	0	0	0	110.1
32	D	54.3	Low	68.7	Low	143 Å²	143	108.2 Å²	108.2	77%	0.765	55%	0.551	S	S	*	*			trans	-142	125.2	172.7	-138.1	-27	0	0	0	111.5	G30	G30-D32 VanDerWaalsContact C-N 3.31Å; G30-D32 PolarHBondContact O-N 3.26Å
33	G	62.4	Low	69.7	Low	55 Å²	55	105 Å²	105	57%	0.567	54%	0.536	S	S	*	.			trans	-78.1	153.6	-160.3	0	0	0	0	0	114.8	E35	G33-E35 PolarHBondContact O-N 3.48Å
34	D	72.2	Confident	70.8	Confident	122 Å²	122	106.5 Å²	106.5	65%	0.652	54%	0.54	S	S	*	.	S	Bend	trans	46	-42.9	167.6	-71.7	-23.7	0	0	0	120.6	R37 R38	D34-R37 PolarHBondContact O-N 3.36Å; D34-R38 WeakPolarHBondContact O-CB 3.49Å; D34-R38 PolarHBondContact O-N 2.94Å
35	E	76.4	Confident	72.4	Confident	107 Å²	107	110.3 Å²	110.3	50%	0.5	56%	0.558	S	S	.	*	H	α-helix	trans	-68.3	-39.1	178.5	-72.1	-60	137	0	0	112.5	G33 R37 R38 L39	G33-E35 PolarHBondContact O-N 3.48Å; E35-R37 PolarHBondContact O-N 3.29Å; E35-R38 WeakPolarHBondContact O-CB 3.48Å; E35-R38 PolarHBondContact O-N 3.5Å; E35-R38 IonicContact OE1-NH1 3.66Å; E35-R38 PolarHBondContact OE1-NH1 3.5Å; E35-R38 VanDerWaalsContact OE1-NH1 3.12Å; E35-R38 IonicContact OE2-NH1 3.91Å; E35-L39 WeakPolarHBondContact O-CG 3.42Å; E35-L39 PolarHBondContact O-N 2.94Å
36	D	80.1	Confident	73.8	Confident	46 Å²	46	110.3 Å²	110.3	25%	0.246	55%	0.554	C	S	.	*	H	α-helix	trans	-63	-41.8	173.3	174.8	81.3	0	0	0	111.7	S28 R38 L39 K40	S28-D36 PolarHBondContact OG-OD1 3Å; S28-D36 VanDerWaalsContact OG-OD1 3.09Å; S28-D36 PolarHBondContact OG-OD2 2.92Å; D36-R38 VanDerWaalsContact C-N 3.3Å; D36-R38 PolarHBondContact O-N 3.33Å; D36-L39 PolarHBondContact O-N 2.69Å; D36-K40 WeakPolarHBondContact O-CG 3.3Å; D36-K40 PolarHBondContact O-N 2.96Å; D36-K40 IonicContact OD1-NZ 2.86Å; D36-K40 WeakPolarHBondContact OD2-CE 3.36Å; D36-K40 IonicContact OD2-NZ 3.83Å; D36-K40 PolarHBondContact OD2-NZ 3.33Å
37	R	81.8	Confident	75.2	Confident	186 Å²	186	104.4 Å²	104.4	70%	0.702	52%	0.524	S	S	*	.	H	α-helix	trans	-62.9	-38.4	174.1	-65.5	-178.7	179.2	-171.2	0.1	111.5	D34 E35 R41	D34-R37 PolarHBondContact O-N 3.36Å; E35-R37 PolarHBondContact O-N 3.29Å; R37-R41 WeakPolarHBondContact O-CB 3.27Å; R37-R41 PolarHBondContact O-N 3.28Å
38	R	85.1	Confident	76.7	Confident	125 Å²	125	99.9 Å²	99.9	47%	0.472	51%	0.512	S	S	.	.	H	α-helix	trans	-67	-42.4	177.2	-168.6	-178.6	-177.4	-171.1	3.6	111.4	D34 E35 D36 R41 R42	D34-R38 WeakPolarHBondContact O-CB 3.49Å; D34-R38 PolarHBondContact O-N 2.94Å; E35-R38 WeakPolarHBondContact O-CB 3.48Å; E35-R38 PolarHBondContact O-N 3.5Å; E35-R38 IonicContact OE1-NH1 3.66Å; E35-R38 PolarHBondContact OE1-NH1 3.5Å; E35-R38 VanDerWaalsContact OE1-NH1 3.12Å; E35-R38 IonicContact OE2-NH1 3.91Å; D36-R38 VanDerWaalsContact C-N 3.3Å; D36-R38 PolarHBondContact O-N 3.33Å; R38-R41 PolarHBondContact O-N 3.44Å; R38-R42 VanDerWaalsContact CZ-NH2 3.31Å; R38-R42 VanDerWaalsContact NH2-NH2 3.17Å; R38-R42 WeakPolarHBondContact O-CG 3.37Å; R38-R42 PolarHBondContact O-N 3.47Å
39	L	83.8	Confident	78.5	Confident	108 Å²	108	99.3 Å²	99.3	57%	0.565	51%	0.509	S	S	*	.	H	α-helix	trans	-62.8	-47.1	175	-71.3	171.2	0	0	0	111.2	E35 D36 R41 R42 E43	E35-L39 WeakPolarHBondContact O-CG 3.42Å; E35-L39 PolarHBondContact O-N 2.94Å; D36-L39 PolarHBondContact O-N 2.69Å; L39-R41 VanDerWaalsContact C-N 3.33Å; L39-R41 PolarHBondContact O-N 2.88Å; L39-R42 WeakPolarHBondContact O-CB 3.5Å; L39-R42 PolarHBondContact O-N 2.96Å; L39-R42 VanDerWaalsContact O-N 3.14Å; L39-E43 PolarHBondContact O-N 2.93Å
40	K	83.1	Confident	80.4	Confident	53 Å²	53	96.9 Å²	96.9	23%	0.23	48%	0.483	C	S	.	.	H	α-helix	trans	-58	-42	174.7	-74.4	171.7	179.7	161.4	0	112.8	C24 S28 D36 E43 K44	C24-K40 WeakPolarHBondContact O-CE 3.3Å; S28-K40 PolarHBondContact OG-NZ 3.29Å; D36-K40 WeakPolarHBondContact O-CG 3.3Å; D36-K40 PolarHBondContact O-N 2.96Å; D36-K40 IonicContact OD1-NZ 2.86Å; D36-K40 WeakPolarHBondContact OD2-CE 3.36Å; D36-K40 IonicContact OD2-NZ 3.83Å; D36-K40 PolarHBondContact OD2-NZ 3.33Å; K40-E43 PolarHBondContact O-N 2.81Å; K40-K44 WeakPolarHBondContact O-CB 3.33Å; K40-K44 WeakPolarHBondContact O-CG 3.45Å; K40-K44 PolarHBondContact O-N 3.5Å
41	R	89.4	Confident	82.3	Confident	199 Å²	199	97.7 Å²	97.7	75%	0.751	48%	0.475	S	S	*	.	H	α-helix	trans	-64.5	-43.3	176.1	-175.9	-175.6	-81.4	-159.1	-1.9	111.6	R37 R38 L39 E43 K44 N45	R37-R41 WeakPolarHBondContact O-CB 3.27Å; R37-R41 PolarHBondContact O-N 3.28Å; R38-R41 PolarHBondContact O-N 3.44Å; L39-R41 VanDerWaalsContact C-N 3.33Å; L39-R41 PolarHBondContact O-N 2.88Å; R41-E43 VanDerWaalsContact C-N 3.34Å; R41-K44 PolarHBondContact O-N 3.36Å; R41-N45 WeakPolarHBondContact O-CB 3.42Å; R41-N45 PolarHBondContact O-N 3.23Å
42	R	89.9	Confident	83.8	Confident	148 Å²	148	93 Å²	93	56%	0.558	46%	0.455	S	S	*	.	H	α-helix	trans	-61.6	-43.7	177.1	-73.9	175.8	-170.3	-112.3	10.1	111.1	R38 L39 N45 R46	R38-R42 VanDerWaalsContact CZ-NH2 3.31Å; R38-R42 VanDerWaalsContact NH2-NH2 3.17Å; R38-R42 WeakPolarHBondContact O-CG 3.37Å; R38-R42 PolarHBondContact O-N 3.47Å; L39-R42 WeakPolarHBondContact O-CB 3.5Å; L39-R42 PolarHBondContact O-N 2.96Å; L39-R42 VanDerWaalsContact O-N 3.14Å; R42-N45 PolarHBondContact O-N 3.03Å; R42-R46 WeakPolarHBondContact O-CB 3.23Å; R42-R46 PolarHBondContact O-N 2.89Å
43	E	87.6	Confident	85.8	Confident	31 Å²	31	93.1 Å²	93.1	15%	0.145	45%	0.445	C	S	.	.	H	α-helix	trans	-67.8	-43.4	179.7	-172.5	55	-147.9	0	0	112.1	L20 L39 K40 R41 N45 R46 V47	L20-E43 VanDerWaalsContact CD2-OE1 3.25Å; L20-E43 WeakPolarHBondContact CD2-OE1 3.39Å; L20-E43 VanDerWaalsContact CG-OE1 3.32Å; L20-E43 WeakPolarHBondContact CG-OE1 3.05Å; L39-E43 PolarHBondContact O-N 2.93Å; K40-E43 PolarHBondContact O-N 2.81Å; R41-E43 VanDerWaalsContact C-N 3.34Å; E43-N45 VanDerWaalsContact C-N 3.3Å; E43-N45 PolarHBondContact O-N 3.48Å; E43-R46 VanDerWaalsContact CD-NE 3.27Å; E43-R46 WeakPolarHBondContact O-CB 3.36Å; E43-R46 PolarHBondContact O-N 3.28Å; E43-R46 VanDerWaalsContact O-N 3.11Å; E43-R46 IonicContact OE1-CZ 3.83Å; E43-R46 IonicContact OE1-NE 3.12Å; E43-R46 PolarHBondContact OE1-NE 2.97Å; E43-R46 IonicContact OE1-NH2 3.86Å; E43-R46 PolarHBondContact OE1-NH2 3.47Å; E43-R46 WeakPolarHBondContact OE2-CD 3.39Å; E43-R46 IonicContact OE2-CZ 3.61Å; E43-R46 IonicContact OE2-NE 3.15Å; E43-R46 PolarHBondContact OE2-NE 2.88Å; E43-V47 WeakPolarHBondContact O-CG2 3.36Å; E43-V47 PolarHBondContact O-N 3.2Å
44	K	87.5	Confident	87.2	Confident	102 Å²	102	93.8 Å²	93.8	44%	0.443	43%	0.432	S	S	.	.	H	α-helix	trans	-54.9	-45.2	171.4	-80.5	173.8	-174.8	-168.6	0	111.7	L21 E25 K40 R41 A48	L21-K44 HydrophobicContact CD1-CG 3.67Å; E25-K44 IonicContact OE1-NZ 2.87Å; E25-K44 PolarHBondContact OE1-NZ 3.27Å; K40-K44 WeakPolarHBondContact O-CB 3.33Å; K40-K44 WeakPolarHBondContact O-CG 3.45Å; K40-K44 PolarHBondContact O-N 3.5Å; R41-K44 PolarHBondContact O-N 3.36Å; K44-A48 WeakPolarHBondContact O-CB 3.35Å; K44-A48 PolarHBondContact O-N 2.97Å
45	N	91.3	Very high	88.3	Confident	111 Å²	111	95.6 Å²	95.6	59%	0.594	43%	0.434	S	S	*	.	H	α-helix	trans	-67.3	-39.1	176.6	-175.6	-95.1	0	0	0	112.5	R41 R42 E43 V47 A48 A49	R41-N45 WeakPolarHBondContact O-CB 3.42Å; R41-N45 PolarHBondContact O-N 3.23Å; R42-N45 PolarHBondContact O-N 3.03Å; E43-N45 VanDerWaalsContact C-N 3.3Å; E43-N45 PolarHBondContact O-N 3.48Å; N45-V47 PolarHBondContact O-N 3.48Å; N45-A48 PolarHBondContact O-N 3.2Å; N45-A49 WeakPolarHBondContact O-CB 3.31Å; N45-A49 PolarHBondContact O-N 3.38Å
46	R	92.4	Very high	89.2	Confident	100 Å²	100	97.1 Å²	97.1	38%	0.377	44%	0.442	S	S	.	.	H	α-helix	trans	-59.9	-46.6	177.3	-165.7	-167.3	69.9	74.5	23.2	111	R42 E43 A49 K50	R42-R46 WeakPolarHBondContact O-CB 3.23Å; R42-R46 PolarHBondContact O-N 2.89Å; E43-R46 VanDerWaalsContact CD-NE 3.27Å; E43-R46 WeakPolarHBondContact O-CB 3.36Å; E43-R46 PolarHBondContact O-N 3.28Å; E43-R46 VanDerWaalsContact O-N 3.11Å; E43-R46 IonicContact OE1-CZ 3.83Å; E43-R46 IonicContact OE1-NE 3.12Å; E43-R46 PolarHBondContact OE1-NE 2.97Å; E43-R46 IonicContact OE1-NH2 3.86Å; E43-R46 PolarHBondContact OE1-NH2 3.47Å; E43-R46 WeakPolarHBondContact OE2-CD 3.39Å; E43-R46 IonicContact OE2-CZ 3.61Å; E43-R46 IonicContact OE2-NE 3.15Å; E43-R46 PolarHBondContact OE2-NE 2.88Å; R46-A49 PolarHBondContact O-N 3.1Å; R46-K50 WeakPolarHBondContact O-CB 3.34Å; R46-K50 PolarHBondContact O-N 3.48Å
47	V	88.3	Confident	90	Very high	13 Å²	13	98.9 Å²	98.9	8%	0.079	45%	0.454	C	S	.	.	H	α-helix	trans	-64.3	-45.3	175.4	175	0	0	0	0	110.9	N17 E43 N45 A49 K50 N51	N17-V47 HydrophobicContact CB-CG1 4.09Å; E43-V47 WeakPolarHBondContact O-CG2 3.36Å; E43-V47 PolarHBondContact O-N 3.2Å; N45-V47 PolarHBondContact O-N 3.48Å; V47-A49 PolarHBondContact O-N 3.32Å; V47-K50 PolarHBondContact O-N 2.89Å; V47-N51 WeakPolarHBondContact O-CB 3.46Å; V47-N51 PolarHBondContact O-N 3.02Å
48	A	87.6	Confident	90.6	Very high	54 Å²	54	93.6 Å²	93.6	45%	0.446	44%	0.437	S	S	.	.	H	α-helix	trans	-60.2	-44.1	177.5	0	0	0	0	0	112.4	K44 N45 N51 S52	K44-A48 WeakPolarHBondContact O-CB 3.35Å; K44-A48 PolarHBondContact O-N 2.97Å; N45-A48 PolarHBondContact O-N 3.2Å; A48-N51 PolarHBondContact O-N 2.88Å; A48-S52 WeakPolarHBondContact O-CB 3.32Å; A48-S52 PolarHBondContact O-N 3.48Å
49	A	93.4	Very high	91.1	Very high	28 Å²	28	96.8 Å²	96.8	23%	0.231	45%	0.449	C	S	.	.	H	α-helix	trans	-65.5	-41.5	177.7	0	0	0	0	0	112	N45 R46 V47 S52 R53	N45-A49 WeakPolarHBondContact O-CB 3.31Å; N45-A49 PolarHBondContact O-N 3.38Å; R46-A49 PolarHBondContact O-N 3.1Å; V47-A49 PolarHBondContact O-N 3.32Å; A49-S52 PolarHBondContact O-N 2.82Å; A49-R53 WeakPolarHBondContact O-CG 3.48Å; A49-R53 PolarHBondContact O-N 3.49Å
50	K	91.5	Very high	91.7	Very high	74 Å²	74	94.3 Å²	94.3	32%	0.322	45%	0.445	S	S	.	.	H	α-helix	trans	-62	-45.7	174	-176.7	-176	173.6	-167.4	0	111.3	N17 R46 V47 R53 K54	N17-K50 PolarHBondContact OD1-NZ 3.34Å; R46-K50 WeakPolarHBondContact O-CB 3.34Å; R46-K50 PolarHBondContact O-N 3.48Å; V47-K50 PolarHBondContact O-N 2.89Å; K50-R53 PolarHBondContact O-N 3.3Å; K50-K54 WeakPolarHBondContact O-CB 3.5Å; K50-K54 PolarHBondContact O-N 2.96Å
51	N	87.9	Confident	92.4	Very high	71 Å²	71	95.7 Å²	95.7	38%	0.38	46%	0.455	S	S	.	.	H	α-helix	trans	-66	-39.2	178.4	-73.8	-18.3	0	0	0	112.1	N17 V47 A48 K54 K55	N17-N51 PolarHBondContact ND2-OD1 2.9Å; V47-N51 WeakPolarHBondContact O-CB 3.46Å; V47-N51 PolarHBondContact O-N 3.02Å; A48-N51 PolarHBondContact O-N 2.88Å; N51-K54 PolarHBondContact O-N 3.4Å; N51-K55 WeakPolarHBondContact O-CB 3.39Å; N51-K55 PolarHBondContact O-N 3.47Å
52	S	93.6	Very high	92.7	Very high	76 Å²	76	91.2 Å²	91.2	53%	0.531	44%	0.442	S	S	.	.	H	α-helix	trans	-62.1	-48.6	175.1	175.5	0	0	0	0	111.3	A48 A49 K54 K55 Q56	A48-S52 WeakPolarHBondContact O-CB 3.32Å; A48-S52 PolarHBondContact O-N 3.48Å; A49-S52 PolarHBondContact O-N 2.82Å; S52-K54 PolarHBondContact O-N 2.98Å; S52-K55 PolarHBondContact O-N 3.23Å; S52-Q56 PolarHBondContact O-N 2.98Å
53	R	96.6	Very high	93.1	Very high	147 Å²	147	90.1 Å²	90.1	56%	0.555	45%	0.447	S	S	*	.	H	α-helix	trans	-58.3	-47.2	174.4	-74.4	-171.4	-69.6	-92.2	3.4	111.8	A49 K50 K55 Q56 T57	A49-R53 WeakPolarHBondContact O-CG 3.48Å; A49-R53 PolarHBondContact O-N 3.49Å; K50-R53 PolarHBondContact O-N 3.3Å; R53-K55 PolarHBondContact O-N 2.84Å; R53-Q56 WeakPolarHBondContact O-CB 3.41Å; R53-Q56 PolarHBondContact O-N 2.69Å; R53-Q56 VanDerWaalsContact O-N 3.15Å; R53-T57 PolarHBondContact O-N 3.49Å; R53-T57 PolarHBondContact O-OG1 2.9Å
54	K	91.9	Very high	93.7	Very high	68 Å²	68	93.8 Å²	93.8	30%	0.296	46%	0.464	S	S	.	.	H	α-helix	trans	-59.4	-45.2	177.9	-172.7	178.2	-175.5	178	0	111.9	S13 K50 N51 S52 Q56 T57 Q58	S13-K54 VanDerWaalsContact CB-NZ 3.33Å; S13-K54 PolarHBondContact OG-NZ 3.39Å; K50-K54 WeakPolarHBondContact O-CB 3.5Å; K50-K54 PolarHBondContact O-N 2.96Å; N51-K54 PolarHBondContact O-N 3.4Å; S52-K54 PolarHBondContact O-N 2.98Å; K54-Q56 VanDerWaalsContact C-N 3.27Å; K54-Q56 PolarHBondContact O-N 2.9Å; K54-T57 PolarHBondContact O-N 3.12Å; K54-Q58 WeakPolarHBondContact O-CB 3.36Å; K54-Q58 PolarHBondContact O-N 3.49Å
55	K	94.4	Very high	94.2	Very high	160 Å²	160	94.5 Å²	94.5	70%	0.696	47%	0.469	S	S	*	.	H	α-helix	trans	-62.9	-36.1	177.6	-172.8	175.4	-178	178.9	0	111.7	N51 S52 R53 R59	N51-K55 WeakPolarHBondContact O-CB 3.39Å; N51-K55 PolarHBondContact O-N 3.47Å; S52-K55 PolarHBondContact O-N 3.23Å; R53-K55 PolarHBondContact O-N 2.84Å; K55-R59 WeakPolarHBondContact O-CB 3.39Å; K55-R59 PolarHBondContact O-N 3.29Å
56	Q	96	Very high	94.5	Very high	140 Å²	140	91.6 Å²	91.6	65%	0.654	46%	0.46	S	S	*	.	H	α-helix	trans	-67.2	-47	175.8	-173.9	173.8	14.4	0	0	111.8	S52 R53 K54 R59 A60	S52-Q56 PolarHBondContact O-N 2.98Å; R53-Q56 WeakPolarHBondContact O-CB 3.41Å; R53-Q56 PolarHBondContact O-N 2.69Å; R53-Q56 VanDerWaalsContact O-N 3.15Å; K54-Q56 VanDerWaalsContact C-N 3.27Å; K54-Q56 PolarHBondContact O-N 2.9Å; Q56-R59 PolarHBondContact O-N 3.17Å; Q56-A60 PolarHBondContact O-N 2.82Å; Q56-A60 VanDerWaalsContact O-N 3.11Å
57	T	96	Very high	94.8	Very high	83 Å²	83	93 Å²	93	51%	0.509	47%	0.466	S	S	.	.	H	α-helix	trans	-60.2	-50.1	175.4	-56.5	0	0	0	0	111	R53 K54 R59 A60 D61	R53-T57 PolarHBondContact O-N 3.49Å; R53-T57 PolarHBondContact O-OG1 2.9Å; K54-T57 PolarHBondContact O-N 3.12Å; T57-R59 VanDerWaalsContact C-N 3.28Å; T57-R59 PolarHBondContact O-N 3.07Å; T57-A60 WeakPolarHBondContact O-CA 3.48Å; T57-A60 WeakPolarHBondContact O-CB 3.33Å; T57-A60 PolarHBondContact O-N 3.03Å; T57-D61 VanDerWaalsContact O-CG 3.28Å; T57-D61 PolarHBondContact O-N 2.95Å
58	Q	95.3	Very high	95.3	Very high	74 Å²	74	97 Å²	97	35%	0.346	48%	0.484	S	S	.	.	H	α-helix	trans	-58	-41.1	179.7	-168.8	-171	-6.7	0	0	112.1	K54 A60 D61 E62	K54-Q58 WeakPolarHBondContact O-CB 3.36Å; K54-Q58 PolarHBondContact O-N 3.49Å; Q58-A60 VanDerWaalsContact C-N 3.3Å; Q58-A60 PolarHBondContact O-N 3.34Å; Q58-D61 PolarHBondContact O-N 3.28Å; Q58-E62 HydrophobicContact CG-CG 4.47Å; Q58-E62 WeakPolarHBondContact CG-OE1 3.41Å; Q58-E62 PolarHBondContact NE2-OE1 3.42Å; Q58-E62 WeakPolarHBondContact O-CB 3.5Å; Q58-E62 VanDerWaalsContact O-CG 3.31Å; Q58-E62 WeakPolarHBondContact O-CG 3.35Å; Q58-E62 PolarHBondContact O-N 2.97Å
59	R	95.4	Very high	95.8	Very high	192 Å²	192	96.9 Å²	96.9	73%	0.725	48%	0.479	S	S	*	.	H	α-helix	trans	-64	-35.6	176	-175.9	178.1	-178.1	-177.6	1.6	112.3	K55 Q56 T57 L63	K55-R59 WeakPolarHBondContact O-CB 3.39Å; K55-R59 PolarHBondContact O-N 3.29Å; Q56-R59 PolarHBondContact O-N 3.17Å; T57-R59 VanDerWaalsContact C-N 3.28Å; T57-R59 PolarHBondContact O-N 3.07Å; R59-L63 WeakPolarHBondContact O-CB 3.44Å; R59-L63 PolarHBondContact O-N 3.48Å; R59-L63 VanDerWaalsContact O-N 3.14Å
60	A	97.1	Very high	96	Very high	57 Å²	57	101 Å²	101	47%	0.471	50%	0.497	S	S	.	.	H	α-helix	trans	-67.8	-42.1	176	0	0	0	0	0	110.9	Q56 T57 Q58 L63 H64	Q56-A60 PolarHBondContact O-N 2.82Å; Q56-A60 VanDerWaalsContact O-N 3.11Å; T57-A60 WeakPolarHBondContact O-CA 3.48Å; T57-A60 WeakPolarHBondContact O-CB 3.33Å; T57-A60 PolarHBondContact O-N 3.03Å; Q58-A60 VanDerWaalsContact C-N 3.3Å; Q58-A60 PolarHBondContact O-N 3.34Å; A60-L63 PolarHBondContact O-N 3.39Å; A60-H64 WeakPolarHBondContact O-CB 3.34Å; A60-H64 PolarHBondContact O-N 3.11Å
61	D	97.3	Very high	96.4	Very high	82 Å²	82	100.9 Å²	100.9	44%	0.439	50%	0.497	S	S	.	.	H	α-helix	trans	-63.8	-49.4	177.7	-57.6	-26.3	0	0	0	111	T57 Q58 L63 H64 E65	T57-D61 VanDerWaalsContact O-CG 3.28Å; T57-D61 PolarHBondContact O-N 2.95Å; Q58-D61 PolarHBondContact O-N 3.28Å; D61-L63 VanDerWaalsContact C-N 3.26Å; D61-L63 PolarHBondContact O-N 3.36Å; D61-H64 WeakPolarHBondContact O-CB 3.49Å; D61-H64 PolarHBondContact O-N 3.03Å; D61-E65 WeakPolarHBondContact O-CG 3.45Å; D61-E65 PolarHBondContact O-N 3.37Å
62	E	96.8	Very high	96.9	Very high	104 Å²	104	103.5 Å²	103.5	49%	0.486	51%	0.507	S	S	.	.	H	α-helix	trans	-57.2	-39.5	176.4	-73.8	169.1	-169	0	0	112	Q58 A66	Q58-E62 HydrophobicContact CG-CG 4.47Å; Q58-E62 WeakPolarHBondContact CG-OE1 3.41Å; Q58-E62 PolarHBondContact NE2-OE1 3.42Å; Q58-E62 WeakPolarHBondContact O-CB 3.5Å; Q58-E62 VanDerWaalsContact O-CG 3.31Å; Q58-E62 WeakPolarHBondContact O-CG 3.35Å; Q58-E62 PolarHBondContact O-N 2.97Å; E62-A66 WeakPolarHBondContact O-CB 3.37Å; E62-A66 PolarHBondContact O-N 2.94Å; E62-A66 VanDerWaalsContact O-N 3.08Å
63	L	98.4	Very high	97.1	Very high	126 Å²	126	105.5 Å²	105.5	66%	0.66	51%	0.506	S	S	*	.	H	α-helix	trans	-68.2	-39.1	176.8	-175.5	66.2	0	0	0	111.7	R59 A60 D61 Y67	R59-L63 WeakPolarHBondContact O-CB 3.44Å; R59-L63 PolarHBondContact O-N 3.48Å; R59-L63 VanDerWaalsContact O-N 3.14Å; A60-L63 PolarHBondContact O-N 3.39Å; D61-L63 VanDerWaalsContact C-N 3.26Å; D61-L63 PolarHBondContact O-N 3.36Å; L63-Y67 WeakPolarHBondContact O-CB 3.46Å; L63-Y67 PolarHBondContact O-N 2.91Å
64	H	98.3	Very high	97.2	Very high	107 Å²	107	102.1 Å²	102.1	50%	0.495	50%	0.499	S	S	.	.	H	α-helix	trans	-66.3	-47.9	178.6	-170.3	62.5	0	0	0	111.3	A60 D61 A66 Y67 E68	A60-H64 WeakPolarHBondContact O-CB 3.34Å; A60-H64 PolarHBondContact O-N 3.11Å; D61-H64 WeakPolarHBondContact O-CB 3.49Å; D61-H64 PolarHBondContact O-N 3.03Å; H64-A66 VanDerWaalsContact C-N 3.31Å; H64-A66 PolarHBondContact O-N 3.27Å; H64-Y67 WeakPolarHBondContact O-CB 3.35Å; H64-Y67 PolarHBondContact O-N 3.05Å; H64-Y67 VanDerWaalsContact O-N 3.12Å; H64-E68 IonicContact CD2-OE2 2.69Å; H64-E68 IonicContact NE2-OE1 3.9Å; H64-E68 IonicContact NE2-OE2 3.71Å; H64-E68 WeakPolarHBondContact O-CG 3.46Å; H64-E68 PolarHBondContact O-N 3.24Å
65	E	98.3	Very high	97.6	Very high	118 Å²	118	104.5 Å²	104.5	55%	0.551	51%	0.507	S	S	*	.	H	α-helix	trans	-58.7	-43.3	176.1	-70.5	176.4	-175.8	0	0	111.7	D61 Y67 E68 C69	D61-E65 WeakPolarHBondContact O-CG 3.45Å; D61-E65 PolarHBondContact O-N 3.37Å; E65-Y67 PolarHBondContact O-N 3.08Å; E65-E68 PolarHBondContact O-N 2.94Å; E65-C69 WeakPolarHBondContact O-CB 3.45Å; E65-C69 PolarHBondContact O-N 2.92Å
66	A	98	Very high	97.8	Very high	49 Å²	49	101.6 Å²	101.6	41%	0.405	50%	0.495	S	S	.	.	H	α-helix	trans	-62.8	-41.9	176.1	0	0	0	0	0	112	E62 H64 L70	E62-A66 WeakPolarHBondContact O-CB 3.37Å; E62-A66 PolarHBondContact O-N 2.94Å; E62-A66 VanDerWaalsContact O-N 3.08Å; H64-A66 VanDerWaalsContact C-N 3.31Å; H64-A66 PolarHBondContact O-N 3.27Å; A66-L70 WeakPolarHBondContact O-CB 3.41Å; A66-L70 WeakPolarHBondContact O-CG 3.32Å; A66-L70 PolarHBondContact O-N 3.14Å
67	Y	98.6	Very high	97.9	Very high	130 Å²	130	100.1 Å²	100.1	51%	0.51	49%	0.491	S	S	.	.	H	α-helix	trans	-60.3	-50.3	175	169.4	-90	0	0	0	111.3	L63 H64 E65 C69 L70 E71	L63-Y67 WeakPolarHBondContact O-CB 3.46Å; L63-Y67 PolarHBondContact O-N 2.91Å; H64-Y67 WeakPolarHBondContact O-CB 3.35Å; H64-Y67 PolarHBondContact O-N 3.05Å; H64-Y67 VanDerWaalsContact O-N 3.12Å; E65-Y67 PolarHBondContact O-N 3.08Å; Y67-C69 VanDerWaalsContact C-N 3.32Å; Y67-C69 PolarHBondContact O-N 3.46Å; Y67-L70 PolarHBondContact O-N 2.9Å; Y67-L70 VanDerWaalsContact O-N 3.17Å; Y67-E71 HydrophobicContact CE1-CB 4.36Å; Y67-E71 WeakPolarHBondContact O-CB 3.31Å; Y67-E71 PolarHBondContact O-N 2.98Å; Y67-E71 PolarHBondContact OH-OE1 3.44Å; Y67-E71 VanDerWaalsContact OH-OE1 3.1Å
68	E	98.7	Very high	98	Very high	97 Å²	97	102.1 Å²	102.1	45%	0.453	49%	0.493	S	S	.	.	H	α-helix	trans	-62	-41.4	-178.6	-69.7	-170.3	120.6	0	0	111.7	H64 E65 L70 E71 Q72	H64-E68 IonicContact CD2-OE2 2.69Å; H64-E68 IonicContact NE2-OE1 3.9Å; H64-E68 IonicContact NE2-OE2 3.71Å; H64-E68 WeakPolarHBondContact O-CG 3.46Å; H64-E68 PolarHBondContact O-N 3.24Å; E65-E68 PolarHBondContact O-N 2.94Å; E68-L70 PolarHBondContact O-N 3.33Å; E68-E71 PolarHBondContact O-N 3.42Å; E68-Q72 WeakPolarHBondContact O-CB 3.36Å; E68-Q72 PolarHBondContact O-N 3.25Å
69	C	98.3	Very high	98.2	Very high	51 Å²	51	104.7 Å²	104.7	35%	0.345	50%	0.503	S	S	.	.	H	α-helix	trans	-60.6	-44.8	175.1	-174.5	0	0	0	0	111.8	E65 Y67 Q72 K73	E65-C69 WeakPolarHBondContact O-CB 3.45Å; E65-C69 PolarHBondContact O-N 2.92Å; Y67-C69 VanDerWaalsContact C-N 3.32Å; Y67-C69 PolarHBondContact O-N 3.46Å; C69-Q72 PolarHBondContact O-N 2.95Å; C69-K73 WeakPolarHBondContact O-CG 3.33Å; C69-K73 PolarHBondContact O-N 3.28Å; C69-K73 VanDerWaalsContact O-N 3.07Å; C69-K73 VanDerWaalsContact SG-CE 3.55Å; C69-K73 PolarHBondContact SG-NZ 3.4Å
70	L	98.8	Very high	98.4	Very high	115 Å²	115	98.6 Å²	98.6	60%	0.602	49%	0.485	S	S	*	.	H	α-helix	trans	-65.9	-40.2	176.5	-74.5	172.7	0	0	0	111.9	A66 Y67 E68 K73 N74	A66-L70 WeakPolarHBondContact O-CB 3.41Å; A66-L70 WeakPolarHBondContact O-CG 3.32Å; A66-L70 PolarHBondContact O-N 3.14Å; Y67-L70 PolarHBondContact O-N 2.9Å; Y67-L70 VanDerWaalsContact O-N 3.17Å; E68-L70 PolarHBondContact O-N 3.33Å; L70-K73 PolarHBondContact O-N 3.15Å; L70-N74 VanDerWaalsContact O-CB 3.31Å; L70-N74 WeakPolarHBondContact O-CB 3.46Å; L70-N74 PolarHBondContact O-N 2.84Å
71	E	98.7	Very high	98.4	Very high	72 Å²	72	100.1 Å²	100.1	34%	0.336	49%	0.488	S	S	.	.	H	α-helix	trans	-64	-42.4	178.1	-164.4	-167.5	-138.8	0	0	111.1	Y67 E68 N74 R75	Y67-E71 HydrophobicContact CE1-CB 4.36Å; Y67-E71 WeakPolarHBondContact O-CB 3.31Å; Y67-E71 PolarHBondContact O-N 2.98Å; Y67-E71 PolarHBondContact OH-OE1 3.44Å; Y67-E71 VanDerWaalsContact OH-OE1 3.1Å; E68-E71 PolarHBondContact O-N 3.42Å; E71-N74 PolarHBondContact O-N 2.88Å; E71-R75 WeakPolarHBondContact O-CG 3.43Å; E71-R75 PolarHBondContact O-N 2.87Å; E71-R75 IonicContact OE1-NH1 2.67Å; E71-R75 IonicContact OE2-CZ 2.85Å; E71-R75 IonicContact OE2-NH1 3.84Å; E71-R75 PolarHBondContact OE2-NH1 3.11Å; E71-R75 IonicContact OE2-NH2 3.2Å
72	Q	98.8	Very high	98.5	Very high	125 Å²	125	102.1 Å²	102.1	58%	0.584	50%	0.495	S	S	*	.	H	α-helix	trans	-61.3	-47.1	174.4	-173.4	-179.6	17.6	0	0	111.8	E68 C69 N74 R75 Q76	E68-Q72 WeakPolarHBondContact O-CB 3.36Å; E68-Q72 PolarHBondContact O-N 3.25Å; C69-Q72 PolarHBondContact O-N 2.95Å; Q72-N74 VanDerWaalsContact C-N 3.33Å; Q72-N74 PolarHBondContact O-N 3.41Å; Q72-R75 PolarHBondContact O-N 2.88Å; Q72-Q76 PolarHBondContact O-N 2.83Å
73	K	98.6	Very high	98.6	Very high	118 Å²	118	103.4 Å²	103.4	51%	0.513	50%	0.499	S	S	.	.	H	α-helix	trans	-60.9	-42.9	175.9	-72.7	168.6	-178.9	165.1	0	111.4	C69 L70 R75 Q76 L77	C69-K73 WeakPolarHBondContact O-CG 3.33Å; C69-K73 PolarHBondContact O-N 3.28Å; C69-K73 VanDerWaalsContact O-N 3.07Å; C69-K73 VanDerWaalsContact SG-CE 3.55Å; C69-K73 PolarHBondContact SG-NZ 3.4Å; L70-K73 PolarHBondContact O-N 3.15Å; K73-R75 PolarHBondContact O-N 3.45Å; K73-Q76 PolarHBondContact O-N 2.95Å; K73-L77 WeakPolarHBondContact O-CB 3.37Å; K73-L77 WeakPolarHBondContact O-CG 3.43Å; K73-L77 PolarHBondContact O-N 3.31Å
74	N	98.7	Very high	98.6	Very high	77 Å²	77	102.7 Å²	102.7	41%	0.412	50%	0.495	S	S	.	.	H	α-helix	trans	-62.1	-43.5	177.4	-170.5	-88.8	0	0	0	111.6	L70 E71 Q72 Q76 L77 K78	L70-N74 VanDerWaalsContact O-CB 3.31Å; L70-N74 WeakPolarHBondContact O-CB 3.46Å; L70-N74 PolarHBondContact O-N 2.84Å; E71-N74 PolarHBondContact O-N 2.88Å; Q72-N74 VanDerWaalsContact C-N 3.33Å; Q72-N74 PolarHBondContact O-N 3.41Å; N74-Q76 VanDerWaalsContact C-N 3.34Å; N74-Q76 PolarHBondContact O-N 3.35Å; N74-L77 PolarHBondContact O-N 2.97Å; N74-K78 WeakPolarHBondContact O-CB 3.36Å; N74-K78 WeakPolarHBondContact O-CG 3.41Å; N74-K78 PolarHBondContact O-N 3.48Å; N74-K78 WeakPolarHBondContact OD1-CD 3.43Å; N74-K78 WeakPolarHBondContact OD1-CE 3.34Å; N74-K78 PolarHBondContact OD1-NZ 3.45Å
75	R	98.7	Very high	98.6	Very high	118 Å²	118	100.5 Å²	100.5	45%	0.445	49%	0.492	S	S	.	.	H	α-helix	trans	-59.6	-43.9	173.8	-75.4	-168.4	-64.5	-98.4	-1	111.8	E71 Q72 K73 K78 K79	E71-R75 WeakPolarHBondContact O-CG 3.43Å; E71-R75 PolarHBondContact O-N 2.87Å; E71-R75 IonicContact OE1-NH1 2.67Å; E71-R75 IonicContact OE2-CZ 2.85Å; E71-R75 IonicContact OE2-NH1 3.84Å; E71-R75 PolarHBondContact OE2-NH1 3.11Å; E71-R75 IonicContact OE2-NH2 3.2Å; Q72-R75 PolarHBondContact O-N 2.88Å; K73-R75 PolarHBondContact O-N 3.45Å; R75-K78 PolarHBondContact O-N 3.31Å; R75-K79 WeakPolarHBondContact O-CG 3.39Å; R75-K79 PolarHBondContact O-N 3.5Å
76	Q	98.8	Very high	98.7	Very high	99 Å²	99	99 Å²	99	46%	0.463	49%	0.485	S	S	.	.	H	α-helix	trans	-64.1	-50.5	178.6	-173.3	58.2	48.7	0	0	111.3	Q72 K73 N74 K78 K79 D80	Q72-Q76 PolarHBondContact O-N 2.83Å; K73-Q76 PolarHBondContact O-N 2.95Å; N74-Q76 VanDerWaalsContact C-N 3.34Å; N74-Q76 PolarHBondContact O-N 3.35Å; Q76-K78 VanDerWaalsContact C-N 3.28Å; Q76-K78 PolarHBondContact O-N 3Å; Q76-K79 WeakPolarHBondContact O-CB 3.46Å; Q76-K79 PolarHBondContact O-N 2.81Å; Q76-D80 PolarHBondContact NE2-OD1 3.06Å; Q76-D80 VanDerWaalsContact O-CG 3.32Å; Q76-D80 PolarHBondContact O-N 2.89Å
77	L	98.8	Very high	98.7	Very high	109 Å²	109	100.5 Å²	100.5	57%	0.571	48%	0.483	S	S	*	.	H	α-helix	trans	-58.1	-39.5	178.5	-71.4	171	0	0	0	112.3	K73 N74 K79 D80 V81	K73-L77 WeakPolarHBondContact O-CB 3.37Å; K73-L77 WeakPolarHBondContact O-CG 3.43Å; K73-L77 PolarHBondContact O-N 3.31Å; N74-L77 PolarHBondContact O-N 2.97Å; L77-K79 VanDerWaalsContact C-N 3.34Å; L77-K79 PolarHBondContact O-N 3.37Å; L77-D80 PolarHBondContact O-N 3.48Å; L77-V81 WeakPolarHBondContact O-CB 3.5Å; L77-V81 VanDerWaalsContact O-CG2 3.3Å; L77-V81 WeakPolarHBondContact O-CG2 3.5Å; L77-V81 PolarHBondContact O-N 3.19Å
78	K	98.7	Very high	98.7	Very high	125 Å²	125	100.2 Å²	100.2	54%	0.543	49%	0.487	S	S	.	.	H	α-helix	trans	-61.2	-41.1	175	-79.6	172.6	172.1	161.8	0	112.5	N74 R75 Q76 Q82	N74-K78 WeakPolarHBondContact O-CB 3.36Å; N74-K78 WeakPolarHBondContact O-CG 3.41Å; N74-K78 PolarHBondContact O-N 3.48Å; N74-K78 WeakPolarHBondContact OD1-CD 3.43Å; N74-K78 WeakPolarHBondContact OD1-CE 3.34Å; N74-K78 PolarHBondContact OD1-NZ 3.45Å; R75-K78 PolarHBondContact O-N 3.31Å; Q76-K78 VanDerWaalsContact C-N 3.28Å; Q76-K78 PolarHBondContact O-N 3Å; K78-Q82 WeakPolarHBondContact O-CG 3.45Å; K78-Q82 PolarHBondContact O-N 2.95Å
79	K	98.8	Very high	98.7	Very high	127 Å²	127	101.3 Å²	101.3	55%	0.552	49%	0.487	S	S	*	.	H	α-helix	trans	-64.4	-44	175	-70.2	176.8	179.5	-178	0	111.2	R75 Q76 L77 V81 Q82 F83	R75-K79 WeakPolarHBondContact O-CG 3.39Å; R75-K79 PolarHBondContact O-N 3.5Å; Q76-K79 WeakPolarHBondContact O-CB 3.46Å; Q76-K79 PolarHBondContact O-N 2.81Å; L77-K79 VanDerWaalsContact C-N 3.34Å; L77-K79 PolarHBondContact O-N 3.37Å; K79-V81 VanDerWaalsContact C-N 3.34Å; K79-V81 PolarHBondContact O-N 3.12Å; K79-Q82 PolarHBondContact O-N 3.17Å; K79-F83 WeakPolarHBondContact O-CB 3.41Å; K79-F83 PolarHBondContact O-N 3.25Å
80	D	98.8	Very high	98.7	Very high	65 Å²	65	105.1 Å²	105.1	35%	0.348	49%	0.494	S	S	.	.	H	α-helix	trans	-63.5	-42.5	179.6	-59.7	-16.3	0	0	0	110.8	Q76 L77 Q82 F83 L84	Q76-D80 PolarHBondContact NE2-OD1 3.06Å; Q76-D80 VanDerWaalsContact O-CG 3.32Å; Q76-D80 PolarHBondContact O-N 2.89Å; L77-D80 PolarHBondContact O-N 3.48Å; D80-Q82 PolarHBondContact O-N 3.4Å; D80-F83 PolarHBondContact O-N 3.14Å; D80-L84 WeakPolarHBondContact O-CB 3.39Å; D80-L84 VanDerWaalsContact O-CG 3.23Å; D80-L84 WeakPolarHBondContact O-CG 3.39Å; D80-L84 PolarHBondContact O-N 2.97Å
81	V	98.8	Very high	98.7	Very high	88 Å²	88	104.1 Å²	104.1	53%	0.533	49%	0.489	S	S	.	.	H	α-helix	trans	-60.1	-45.3	174.1	168	0	0	0	0	111.4	L77 K79 S85	L77-V81 WeakPolarHBondContact O-CB 3.5Å; L77-V81 VanDerWaalsContact O-CG2 3.3Å; L77-V81 WeakPolarHBondContact O-CG2 3.5Å; L77-V81 PolarHBondContact O-N 3.19Å; K79-V81 VanDerWaalsContact C-N 3.34Å; K79-V81 PolarHBondContact O-N 3.12Å; V81-S85 VanDerWaalsContact O-CB 3.27Å; V81-S85 WeakPolarHBondContact O-CB 3.48Å; V81-S85 PolarHBondContact O-N 2.87Å; V81-S85 PolarHBondContact O-OG 2.86Å
82	Q	98.7	Very high	98.6	Very high	124 Å²	124	103.4 Å²	103.4	58%	0.579	49%	0.49	S	S	*	.	H	α-helix	trans	-61.3	-49.3	177.3	-76	175.9	-8.2	0	0	111.4	K78 K79 D80 L84 S85 E86	K78-Q82 WeakPolarHBondContact O-CG 3.45Å; K78-Q82 PolarHBondContact O-N 2.95Å; K79-Q82 PolarHBondContact O-N 3.17Å; D80-Q82 PolarHBondContact O-N 3.4Å; Q82-L84 PolarHBondContact O-N 3.42Å; Q82-S85 PolarHBondContact O-N 3Å; Q82-E86 WeakPolarHBondContact O-CG 3.33Å; Q82-E86 PolarHBondContact O-N 3.3Å
83	F	98.7	Very high	98.6	Very high	131 Å²	131	102 Å²	102	58%	0.575	48%	0.483	S	S	*	.	H	α-helix	trans	-57.7	-49.4	178.2	176.2	-96.8	0	0	0	112.1	K79 D80 S85 E86 E87	K79-F83 WeakPolarHBondContact O-CB 3.41Å; K79-F83 PolarHBondContact O-N 3.25Å; D80-F83 PolarHBondContact O-N 3.14Å; F83-S85 VanDerWaalsContact C-N 3.33Å; F83-S85 PolarHBondContact O-N 2.92Å; F83-E86 PolarHBondContact O-N 2.85Å; F83-E87 PolarHBondContact O-N 2.97Å
84	L	98.8	Very high	98.5	Very high	111 Å²	111	99.3 Å²	99.3	58%	0.581	48%	0.483	S	S	*	.	H	α-helix	trans	-65.8	-36.4	180	-69.8	173	0	0	0	112.3	D80 Q82 E87 Q88	D80-L84 WeakPolarHBondContact O-CB 3.39Å; D80-L84 VanDerWaalsContact O-CG 3.23Å; D80-L84 WeakPolarHBondContact O-CG 3.39Å; D80-L84 PolarHBondContact O-N 2.97Å; Q82-L84 PolarHBondContact O-N 3.42Å; L84-E87 PolarHBondContact O-N 3.35Å; L84-Q88 WeakPolarHBondContact O-CB 3.2Å; L84-Q88 PolarHBondContact O-N 3.38Å
85	S	98.6	Very high	98.4	Very high	61 Å²	61	101.4 Å²	101.4	43%	0.427	49%	0.493	S	S	.	.	H	α-helix	trans	-66.2	-40.5	176.4	-59.3	0	0	0	0	111.5	V81 Q82 F83 R89	V81-S85 VanDerWaalsContact O-CB 3.27Å; V81-S85 WeakPolarHBondContact O-CB 3.48Å; V81-S85 PolarHBondContact O-N 2.87Å; V81-S85 PolarHBondContact O-OG 2.86Å; Q82-S85 PolarHBondContact O-N 3Å; F83-S85 VanDerWaalsContact C-N 3.33Å; F83-S85 PolarHBondContact O-N 2.92Å; S85-R89 WeakPolarHBondContact O-CB 3.4Å; S85-R89 PolarHBondContact O-N 3.45Å
86	E	98.7	Very high	98.2	Very high	88 Å²	88	102.2 Å²	102.2	41%	0.411	50%	0.5	S	S	.	.	H	α-helix	trans	-64.1	-43.1	173.6	-75.4	-177.2	-157.2	0	0	112	Q82 F83 R89 R90	Q82-E86 WeakPolarHBondContact O-CG 3.33Å; Q82-E86 PolarHBondContact O-N 3.3Å; F83-E86 PolarHBondContact O-N 2.85Å; E86-R89 WeakPolarHBondContact O-CB 3.39Å; E86-R89 PolarHBondContact O-N 2.65Å; E86-R90 VanDerWaalsContact O-CG 3.3Å; E86-R90 WeakPolarHBondContact O-CG 3.41Å; E86-R90 PolarHBondContact O-N 2.96Å; E86-R90 IonicContact OE2-NH2 3.92Å; E86-R90 PolarHBondContact OE2-NH2 3.1Å
87	E	98.6	Very high	98	Very high	79 Å²	79	100.8 Å²	100.8	37%	0.369	51%	0.505	S	S	.	.	H	α-helix	trans	-64.7	-44.8	178.9	-171.5	60.6	-168.1	0	0	111.4	F83 L84 R89 R90 L91	F83-E87 PolarHBondContact O-N 2.97Å; L84-E87 PolarHBondContact O-N 3.35Å; E87-R89 VanDerWaalsContact C-N 3.3Å; E87-R89 PolarHBondContact O-N 3Å; E87-R90 PolarHBondContact O-N 3.38Å; E87-L91 HydrophobicContact CG-CD1 4.17Å; E87-L91 WeakPolarHBondContact O-CG 3.23Å; E87-L91 PolarHBondContact O-N 3.04Å
88	Q	98.6	Very high	97.7	Very high	125 Å²	125	100.4 Å²	100.4	58%	0.584	50%	0.5	S	S	*	.	H	α-helix	trans	-56.6	-45.3	173.4	-174.6	-173.7	33.3	0	0	111.4	L84 T92	L84-Q88 WeakPolarHBondContact O-CB 3.2Å; L84-Q88 PolarHBondContact O-N 3.38Å; Q88-T92 VanDerWaalsContact O-CB 3.29Å; Q88-T92 WeakPolarHBondContact O-CB 3.48Å; Q88-T92 PolarHBondContact O-N 2.95Å; Q88-T92 PolarHBondContact O-OG1 2.77Å
89	R	98.6	Very high	97.3	Very high	119 Å²	119	99.4 Å²	99.4	45%	0.449	50%	0.498	S	S	.	.	H	α-helix	trans	-60.4	-48.8	177.3	-175.4	-172.9	63.7	77.7	4.4	111.1	S85 E86 E87 L91 T92 E93	S85-R89 WeakPolarHBondContact O-CB 3.4Å; S85-R89 PolarHBondContact O-N 3.45Å; E86-R89 WeakPolarHBondContact O-CB 3.39Å; E86-R89 PolarHBondContact O-N 2.65Å; E87-R89 VanDerWaalsContact C-N 3.3Å; E87-R89 PolarHBondContact O-N 3Å; R89-L91 PolarHBondContact O-N 3.09Å; R89-T92 PolarHBondContact O-N 3.15Å; R89-E93 WeakPolarHBondContact CG-OE1 3.37Å; R89-E93 IonicContact CZ-OE1 2.65Å; R89-E93 IonicContact CZ-OE2 3.71Å; R89-E93 IonicContact NH1-OE1 2.94Å; R89-E93 PolarHBondContact NH1-OE1 2.89Å; R89-E93 IonicContact NH1-OE2 2.67Å; R89-E93 PolarHBondContact NH1-OE2 3.48Å; R89-E93 WeakPolarHBondContact O-CB 3.34Å; R89-E93 WeakPolarHBondContact O-CG 3.32Å; R89-E93 PolarHBondContact O-N 3.38Å
90	R	98.7	Very high	96.8	Very high	131 Å²	131	97.3 Å²	97.3	49%	0.494	50%	0.497	S	S	.	.	H	α-helix	trans	-59	-47.7	179.5	-71.2	172.8	-156.8	-128.8	6.3	111.8	E86 E87 T92 E93 A94	E86-R90 VanDerWaalsContact O-CG 3.3Å; E86-R90 WeakPolarHBondContact O-CG 3.41Å; E86-R90 PolarHBondContact O-N 2.96Å; E86-R90 IonicContact OE2-NH2 3.92Å; E86-R90 PolarHBondContact OE2-NH2 3.1Å; E87-R90 PolarHBondContact O-N 3.38Å; R90-T92 VanDerWaalsContact C-N 3.34Å; R90-T92 PolarHBondContact O-N 3.08Å; R90-E93 PolarHBondContact O-N 3.31Å; R90-A94 WeakPolarHBondContact O-CB 3.48Å; R90-A94 PolarHBondContact O-N 3.27Å
91	L	98.4	Very high	96.3	Very high	95 Å²	95	100.5 Å²	100.5	50%	0.497	51%	0.513	S	S	.	.	H	α-helix	trans	-64	-41.1	178.1	-67.9	173.4	0	0	0	111.5	E87 R89 E93 A94 L95	E87-L91 HydrophobicContact CG-CD1 4.17Å; E87-L91 WeakPolarHBondContact O-CG 3.23Å; E87-L91 PolarHBondContact O-N 3.04Å; R89-L91 PolarHBondContact O-N 3.09Å; L91-E93 PolarHBondContact O-N 3.47Å; L91-A94 PolarHBondContact O-N 3.18Å; L91-L95 WeakPolarHBondContact O-CG 3.36Å; L91-L95 PolarHBondContact O-N 2.98Å
92	T	97.8	Very high	95.7	Very high	57 Å²	57	97.1 Å²	97.1	35%	0.35	49%	0.493	S	S	.	.	H	α-helix	trans	-62.9	-42.7	176.4	-57.8	0	0	0	0	111.5	Q88 R89 R90 L95 K96	Q88-T92 VanDerWaalsContact O-CB 3.29Å; Q88-T92 WeakPolarHBondContact O-CB 3.48Å; Q88-T92 PolarHBondContact O-N 2.95Å; Q88-T92 PolarHBondContact O-OG1 2.77Å; R89-T92 PolarHBondContact O-N 3.15Å; R90-T92 VanDerWaalsContact C-N 3.34Å; R90-T92 PolarHBondContact O-N 3.08Å; T92-L95 PolarHBondContact O-N 3.23Å; T92-K96 HydrophobicContact CG2-CD 4.26Å; T92-K96 WeakPolarHBondContact O-CB 3.26Å; T92-K96 WeakPolarHBondContact O-CG 3.12Å; T92-K96 PolarHBondContact O-N 3.26Å
93	E	98.1	Very high	94.9	Very high	94 Å²	94	95.4 Å²	95.4	44%	0.439	49%	0.493	S	S	.	.	H	α-helix	trans	-63.8	-42.9	175.8	-76	168.9	-171.8	0	0	111.8	R89 R90 L91 L95 K96 A97	R89-E93 WeakPolarHBondContact CG-OE1 3.37Å; R89-E93 IonicContact CZ-OE1 2.65Å; R89-E93 IonicContact CZ-OE2 3.71Å; R89-E93 IonicContact NH1-OE1 2.94Å; R89-E93 PolarHBondContact NH1-OE1 2.89Å; R89-E93 IonicContact NH1-OE2 2.67Å; R89-E93 PolarHBondContact NH1-OE2 3.48Å; R89-E93 WeakPolarHBondContact O-CB 3.34Å; R89-E93 WeakPolarHBondContact O-CG 3.32Å; R89-E93 PolarHBondContact O-N 3.38Å; R90-E93 PolarHBondContact O-N 3.31Å; L91-E93 PolarHBondContact O-N 3.47Å; E93-L95 VanDerWaalsContact C-N 3.34Å; E93-L95 PolarHBondContact O-N 3.06Å; E93-K96 PolarHBondContact O-N 2.87Å; E93-A97 WeakPolarHBondContact O-CB 3.25Å; E93-A97 PolarHBondContact O-N 3.35Å
94	A	97.3	Very high	94	Very high	62 Å²	62	95.4 Å²	95.4	51%	0.512	50%	0.497	S	S	.	.	H	α-helix	trans	-60.6	-43.2	175.8	0	0	0	0	0	111.9	R90 L91 A97 H98	R90-A94 WeakPolarHBondContact O-CB 3.48Å; R90-A94 PolarHBondContact O-N 3.27Å; L91-A94 PolarHBondContact O-N 3.18Å; A94-A97 PolarHBondContact O-N 2.99Å; A94-H98 WeakPolarHBondContact O-CB 3.41Å; A94-H98 PolarHBondContact O-N 2.63Å
95	L	95.9	Very high	92.5	Very high	121 Å²	121	94.5 Å²	94.5	63%	0.634	49%	0.491	S	S	*	.	H	α-helix	trans	-64.1	-45.3	175.7	-71.7	173	0	0	0	112	L91 T92 E93 A97 H98 E99	L91-L95 WeakPolarHBondContact O-CG 3.36Å; L91-L95 PolarHBondContact O-N 2.98Å; T92-L95 PolarHBondContact O-N 3.23Å; E93-L95 VanDerWaalsContact C-N 3.34Å; E93-L95 PolarHBondContact O-N 3.06Å; L95-A97 VanDerWaalsContact C-N 3.31Å; L95-A97 PolarHBondContact O-N 2.94Å; L95-H98 PolarHBondContact O-N 3.46Å; L95-H98 VanDerWaalsContact O-N 3.14Å; L95-E99 PolarHBondContact O-N 3.11Å
96	K	93.8	Very high	90.7	Very high	136 Å²	136	96.9 Å²	96.9	59%	0.591	50%	0.496	S	S	*	.	H	α-helix	trans	-61.2	-39	176.6	-75.5	176	178.6	179.4	0	112.4	T92 E93 H98 E99 P100	T92-K96 HydrophobicContact CG2-CD 4.26Å; T92-K96 WeakPolarHBondContact O-CB 3.26Å; T92-K96 WeakPolarHBondContact O-CG 3.12Å; T92-K96 PolarHBondContact O-N 3.26Å; E93-K96 PolarHBondContact O-N 2.87Å; K96-H98 VanDerWaalsContact C-N 3.31Å; K96-E99 PolarHBondContact O-N 3.27Å; K96-P100 WeakPolarHBondContact O-CD 3.38Å
97	A	94.4	Very high	88.6	Confident	69 Å²	69	96.6 Å²	96.6	57%	0.57	50%	0.502	S	S	*	.	H	α-helix	trans	-68.3	-32.3	176.4	0	0	0	0	0	112.3	E93 A94 L95 P100	E93-A97 WeakPolarHBondContact O-CB 3.25Å; E93-A97 PolarHBondContact O-N 3.35Å; A94-A97 PolarHBondContact O-N 2.99Å; L95-A97 VanDerWaalsContact C-N 3.31Å; L95-A97 PolarHBondContact O-N 2.94Å; A97-P100 WeakPolarHBondContact O-CD 3.41Å
98	H	93.4	Very high	86.5	Confident	101 Å²	101	97.2 Å²	97.2	47%	0.468	51%	0.511	S	S	.	.	H	α-helix	trans	-75.7	-33.2	175.6	174.1	-90	0	0	0	113.1	A94 L95 K96 P100 L101 C102	A94-H98 WeakPolarHBondContact O-CB 3.41Å; A94-H98 PolarHBondContact O-N 2.63Å; L95-H98 PolarHBondContact O-N 3.46Å; L95-H98 VanDerWaalsContact O-N 3.14Å; K96-H98 VanDerWaalsContact C-N 3.31Å; H98-P100 VanDerWaalsContact C-CD 3.48Å; H98-L101 WeakPolarHBondContact O-CA 3.43Å; H98-L101 WeakPolarHBondContact O-CB 3.27Å; H98-L101 PolarHBondContact O-N 2.67Å; H98-C102 PolarHBondContact O-N 2.94Å; H98-C102 VanDerWaalsContact O-N 3.14Å
99	E	89.9	Confident	84.4	Confident	104 Å²	104	94.9 Å²	94.9	49%	0.486	51%	0.513	S	S	.	.	G	3₁₀ helix	trans	-46.7	-47.5	-174.7	-166.2	143.9	-160.5	0	0	115.6	L95 K96 L101 C102	L95-E99 PolarHBondContact O-N 3.11Å; K96-E99 PolarHBondContact O-N 3.27Å; E99-L101 PolarHBondContact O-N 2.78Å; E99-C102 WeakPolarHBondContact O-CB 3.45Å; E99-C102 PolarHBondContact O-N 3.29Å
100	P	87.6	Confident	82.1	Confident	82 Å²	82	96.4 Å²	96.4	53%	0.532	53%	0.53	S	S	.	.	G	3₁₀ helix	trans	-72.2	-9.5	177.8	30.3	-37.9	0	0	0	114.9	K96 A97 H98 H106	K96-P100 WeakPolarHBondContact O-CD 3.38Å; A97-P100 WeakPolarHBondContact O-CD 3.41Å; H98-P100 VanDerWaalsContact C-CD 3.48Å; P100-H106 PolarHBondContact O-NE2 2.95Å
101	L	88.4	Confident	80	Confident	132 Å²	132	98 Å²	98	69%	0.691	55%	0.548	S	S	*	.	G	3₁₀ helix	trans	-101.6	-12	176.8	-57	178.7	0	0	0	111.8	H98 E99 P103	H98-L101 WeakPolarHBondContact O-CA 3.43Å; H98-L101 WeakPolarHBondContact O-CB 3.27Å; H98-L101 PolarHBondContact O-N 2.67Å; E99-L101 PolarHBondContact O-N 2.78Å; L101-P103 WeakPolarHBondContact O-CD 3.24Å; L101-P103 VanDerWaalsContact O-N 3.17Å
102	C	86.8	Confident	77.5	Confident	17 Å²	17	95.6 Å²	95.6	12%	0.115	55%	0.546	C	S	.	.			trans	-68.5	109.6	-172.4	-175.3	0	0	0	0	110.7	H98 E99 I104 M105 H106	H98-C102 PolarHBondContact O-N 2.94Å; H98-C102 VanDerWaalsContact O-N 3.14Å; E99-C102 WeakPolarHBondContact O-CB 3.45Å; E99-C102 PolarHBondContact O-N 3.29Å; C102-I104 PolarHBondContact O-N 3.43Å; C102-M105 HydrophobicContact CB-CB 4.11Å; C102-M105 HydrophobicContact CB-CG 4.06Å; C102-M105 PolarHBondContact O-N 3.05Å; C102-H106 PolarHBondContact O-CD2 2.95Å; C102-H106 PolarHBondContact O-N 2.95Å; C102-H106 VanDerWaalsContact O-N 3.12Å
103	P	82	Confident	75.2	Confident	89 Å²	89	99.8 Å²	99.8	58%	0.578	58%	0.577	S	S	*	*	H	α-helix	trans	-61	-37	-177.9	-22.2	34.9	0	0	0	110.8	L101 M105 H106 C107	L101-P103 WeakPolarHBondContact O-CD 3.24Å; L101-P103 VanDerWaalsContact O-N 3.17Å; P103-M105 VanDerWaalsContact C-N 3.34Å; P103-M105 PolarHBondContact O-N 3.46Å; P103-H106 CarbonylContact O-C 3.52Å; P103-H106 PolarHBondContact O-N 3.32Å; P103-H106 VanDerWaalsContact O-N 3.16Å; P103-C107 WeakPolarHBondContact O-CB 3.49Å; P103-C107 PolarHBondContact O-N 3.5Å; P103-C107 PolarHBondContact O-SG 3.22Å
104	I	80.4	Confident	72.8	Confident	130 Å²	130	97.8 Å²	97.8	67%	0.667	58%	0.582	S	S	*	*	H	α-helix	trans	-60.5	-41.8	-179.2	-58.3	173	0	0	0	111.3	C102 C107 V108	C102-I104 PolarHBondContact O-N 3.43Å; I104-C107 WeakPolarHBondContact O-CB 3.48Å; I104-C107 PolarHBondContact O-N 3.4Å; I104-V108 WeakPolarHBondContact O-CG2 3.18Å; I104-V108 PolarHBondContact O-N 3.02Å
105	M	66.7	Low	70.5	Confident	92 Å²	92	101.7 Å²	101.7	45%	0.453	60%	0.6	S	S	.	*	H	α-helix	trans	-72.4	-35.1	177.3	-67.4	-63.6	-73	0	0	112.2	C102 P103 C107 V108 A109	C102-M105 HydrophobicContact CB-CB 4.11Å; C102-M105 HydrophobicContact CB-CG 4.06Å; C102-M105 PolarHBondContact O-N 3.05Å; P103-M105 VanDerWaalsContact C-N 3.34Å; P103-M105 PolarHBondContact O-N 3.46Å; M105-C107 VanDerWaalsContact C-N 3.32Å; M105-V108 VanDerWaalsContact O-CG2 3.3Å; M105-V108 WeakPolarHBondContact O-CG2 3.4Å; M105-A109 PolarHBondContact O-N 2.85Å
106	H	60.9	Low	68.3	Low	112 Å²	112	104.1 Å²	104.1	52%	0.519	61%	0.613	S	S	.	*	H	α-helix	trans	-71.8	-24.4	173.3	-80.2	-106.7	0	0	0	113.1	P100 C102 P103	P100-H106 PolarHBondContact O-NE2 2.95Å; C102-H106 PolarHBondContact O-CD2 2.95Å; C102-H106 PolarHBondContact O-N 2.95Å; C102-H106 VanDerWaalsContact O-N 3.12Å; P103-H106 CarbonylContact O-C 3.52Å; P103-H106 PolarHBondContact O-N 3.32Å; P103-H106 VanDerWaalsContact O-N 3.16Å
107	C	53.8	Low	66.1	Low	81 Å²	81	100.2 Å²	100.2	55%	0.547	61%	0.611	S	S	.	*	H	α-helix	trans	-72.6	-43.3	175	-65.2	0	0	0	0	112.1	P103 I104 M105 N110	P103-C107 WeakPolarHBondContact O-CB 3.49Å; P103-C107 PolarHBondContact O-N 3.5Å; P103-C107 PolarHBondContact O-SG 3.22Å; I104-C107 WeakPolarHBondContact O-CB 3.48Å; I104-C107 PolarHBondContact O-N 3.4Å; M105-C107 VanDerWaalsContact C-N 3.32Å; C107-N110 PolarHBondContact O-N 3.4Å
108	V	54.2	Low	64	Low	92 Å²	92	103.2 Å²	103.2	56%	0.558	63%	0.625	S	S	*	*	H	α-helix	trans	-72.2	-29.4	179.9	-77.7	0	0	0	0	112.9	I104 M105 N110 L111 G112	I104-V108 WeakPolarHBondContact O-CG2 3.18Å; I104-V108 PolarHBondContact O-N 3.02Å; M105-V108 VanDerWaalsContact O-CG2 3.3Å; M105-V108 WeakPolarHBondContact O-CG2 3.4Å; V108-N110 PolarHBondContact O-N 2.92Å; V108-L111 PolarHBondContact O-N 3.43Å; V108-L111 VanDerWaalsContact O-N 3.16Å; V108-G112 PolarHBondContact O-N 2.93Å
109	A	54.9	Low	62.2	Low	76 Å²	76	109.2 Å²	109.2	63%	0.628	64%	0.644	S	S	*	*	H	α-helix	trans	-64.4	-24.1	174.9	0	0	0	0	0	113.5	M105	M105-A109 PolarHBondContact O-N 2.85Å
110	N	50	Low	60.1	Low	151 Å²	151	111.5 Å²	111.5	81%	0.807	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88	-8.5	175.8	-101.7	4.7	0	0	0	114.2	C107 V108	C107-N110 PolarHBondContact O-N 3.4Å; V108-N110 PolarHBondContact O-N 2.92Å
111	L	54.6	Low	58.5	Low	166 Å²	166	113.1 Å²	113.1	87%	0.869	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.3	-10.1	178.5	-109.2	78.6	0	0	0	114.5	V108	V108-L111 PolarHBondContact O-N 3.43Å; V108-L111 VanDerWaalsContact O-N 3.16Å
112	G	45.5	Very low	56.5	Low	44 Å²	44	109.4 Å²	109.4	45%	0.454	66%	0.661	S	S	.	*			trans	-147.5	91.3	-175.1	0	0	0	0	0	113.1	V108 G114	V108-G112 PolarHBondContact O-N 2.93Å; G112-G114 PolarHBondContact O-N 2.92Å
113	S	49.6	Very low	55	Low	144 Å²	144	114 Å²	114	100%	1.007	69%	0.689	S	S	*	*			trans	-61.3	90.3	149.6	-129.8	0	0	0	0	107.4
114	G	47.7	Very low	53.4	Low	53 Å²	53	113.8 Å²	113.8	55%	0.546	69%	0.687	S	S	.	*			trans	-160.1	95.8	-175.7	0	0	0	0	0	109.3	G112 L116	G112-G114 PolarHBondContact O-N 2.92Å; G114-L116 PolarHBondContact O-N 3.09Å; G114-L116 VanDerWaalsContact O-N 3.12Å
115	T	50.4	Low	52.3	Low	144 Å²	144	113.2 Å²	113.2	88%	0.883	70%	0.695	S	S	*	*			trans	-28.6	105.5	172.2	53.2	0	0	0	0	114.3
116	L	49	Very low	52.2	Low	171 Å²	171	117.9 Å²	117.9	90%	0.895	71%	0.709	S	S	*	*			trans	-119.2	99.1	159.2	-72.5	174.9	0	0	0	107.3	G114	G114-L116 PolarHBondContact O-N 3.09Å; G114-L116 VanDerWaalsContact O-N 3.12Å
117	G	48.4	Very low	51.8	Low	55 Å²	55	120.6 Å²	120.6	57%	0.567	73%	0.726	S	S	*	*			trans	-58.7	163.4	173.4	0	0	0	0	0	111.9	R119	G117-R119 PolarHBondContact O-N 3.17Å; G117-R119 VanDerWaalsContact O-N 3.14Å
118	P	50.2	Low	52.2	Low	132 Å²	132	122.8 Å²	122.8	86%	0.857	74%	0.739	S	S	*	*			trans	-56.2	122.3	-177	22.4	-31.6	0	0	0	109.7	D120	P118-D120 PolarHBondContact O-N 3.47Å
119	R	55.5	Low	52.2	Low	227 Å²	227	133.6 Å²	133.6	86%	0.857	77%	0.77	S	S	*	*			trans	-69.8	91	170.4	-58.4	-170	94.6	-127.9	4.7	106.8	G117 V121	G117-R119 PolarHBondContact O-N 3.17Å; G117-R119 VanDerWaalsContact O-N 3.14Å; R119-V121 PolarHBondContact O-N 3.39Å
120	D	45	Very low	52.1	Low	151 Å²	151	136.5 Å²	136.5	81%	0.807	78%	0.777	S	S	*	*			trans	-63.1	99.6	167	-167	19.2	0	0	0	107.3	P118 G122	P118-D120 PolarHBondContact O-N 3.47Å; D120-G122 PolarHBondContact O-N 3.44Å
121	V	54.2	Low	52.2	Low	116 Å²	116	135.7 Å²	135.7	70%	0.703	78%	0.775	S	S	*	*			trans	-75.9	80.9	170.1	-175.8	0	0	0	0	105.4	R119 V123	R119-V121 PolarHBondContact O-N 3.39Å; V121-V123 PolarHBondContact O-N 2.85Å
122	G	46.8	Very low	52	Low	55 Å²	55	134 Å²	134	57%	0.567	77%	0.77	S	S	*	*			trans	-56.6	103.1	172.7	0	0	0	0	0	108.9	D120 P124	D120-G122 PolarHBondContact O-N 3.44Å; G122-P124 VanDerWaalsContact O-CD 3.26Å; G122-P124 WeakPolarHBondContact O-CD 3.43Å
123	V	55.2	Low	52.4	Low	114 Å²	114	139.3 Å²	139.3	69%	0.691	79%	0.789	S	S	*	*			trans	-73.5	115	164.6	178.1	0	0	0	0	105.8	V121 S125	V121-V123 PolarHBondContact O-N 2.85Å; V123-S125 PolarHBondContact O-N 3.44Å
124	P	48.4	Very low	52.6	Low	83 Å²	83	139 Å²	139	54%	0.539	78%	0.775	S	S	.	*			trans	-67.4	111.6	176.7	-16.5	31.6	0	0	0	108.7	G122 Y126	G122-P124 VanDerWaalsContact O-CD 3.26Å; G122-P124 WeakPolarHBondContact O-CD 3.43Å; P124-Y126 HydrophobicContact CB-CD1 3.89Å; P124-Y126 HydrophobicContact CB-CE1 3.51Å; P124-Y126 HydrophobicContact CG-CE1 4.28Å; P124-Y126 PolarHBondContact O-N 3.07Å
125	S	56.9	Low	52.9	Low	119 Å²	119	144.7 Å²	144.7	83%	0.832	79%	0.79	S	S	*	*			trans	-74.2	87.7	174	59.1	0	0	0	0	109.7	V123	V123-S125 PolarHBondContact O-N 3.44Å
126	Y	64	Low	53.1	Low	190 Å²	190	144.8 Å²	144.8	75%	0.745	78%	0.784	S	S	*	*			trans	-107.9	86.2	159.4	33.8	-103.6	0	0	0	109.4	P124	P124-Y126 HydrophobicContact CB-CD1 3.89Å; P124-Y126 HydrophobicContact CB-CE1 3.51Å; P124-Y126 HydrophobicContact CG-CE1 4.28Å; P124-Y126 PolarHBondContact O-N 3.07Å
127	L	53.5	Low	53.4	Low	169 Å²	169	142.8 Å²	142.8	89%	0.885	78%	0.775	S	S	*	*			trans	-117.7	123.2	156.3	-78.2	168.3	0	0	0	108.2
128	P	61.6	Low	53.8	Low	127 Å²	127	150.1 Å²	150.1	83%	0.825	79%	0.792	S	S	*	*			trans	-76.3	150.8	172.8	10.1	3.2	0	0	0	111.4
129	R	54.7	Low	54.2	Low	318 Å²	318	151.7 Å²	151.7	100%	1.2	79%	0.786	S	S	*	*			trans	-80.5	0	-179.4	-162.7	177.1	-165.7	-100.1	3.9	112.5

Retrieved 129 of 129 residues in 320.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).