A0A060WT73_ONCMY Loading...

Stress-associated endoplasmic reticulum protein

Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins. Interacts with target proteins during translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation and facilitate correct glycosylation.

AlphaFold DB , UniProt , Accession A0A060WT73, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 66 aa.

						>A0A060WT73_ONCMY|A0A060WT73
MVAKQRIRMANEKHSKNITQRGNVAKSTRNPQDDKVAVGPWLLALFIFVVCGSAIFQIIQSIRMGM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.8	Low	68.9	Low	224 Å²	224	129.3 Å²	129.3	100%	1.103	64%	0.641	S	S	*	*				0	58	0	-70.1	-173.3	-87.8	0	0	112.2
2	V	59.1	Low	69.8	Low	85 Å²	85	126 Å²	126	52%	0.515	62%	0.622	S	S	.	*			trans	-121.9	-35.9	-177.8	177.3	0	0	0	0	112.3	K4 Q5 R6	V2-K4 PolarHBondContact O-N 3.29Å; V2-Q5 PolarHBondContact O-N 3.29Å; V2-R6 WeakPolarHBondContact O-CG 3.47Å; V2-R6 PolarHBondContact O-N 3.47Å
3	A	62.2	Low	70.4	Confident	70 Å²	70	126.8 Å²	126.8	58%	0.579	62%	0.62	S	S	*	*	H	α-helix	trans	-62.9	-42.2	179.6	0	0	0	0	0	113.4	Q5 R6 I7	A3-Q5 VanDerWaalsContact C-N 3.27Å; A3-Q5 PolarHBondContact O-N 3.11Å; A3-R6 PolarHBondContact O-N 3.3Å; A3-I7 WeakPolarHBondContact O-CG1 3.48Å; A3-I7 PolarHBondContact O-N 3.31Å; A3-I7 VanDerWaalsContact O-N 3.11Å
4	K	61.5	Low	70.8	Confident	188 Å²	188	126.8 Å²	126.8	82%	0.817	62%	0.618	S	S	*	*	H	α-helix	trans	-59.4	-35.5	176.5	-90.4	-170.7	174.8	-169.9	0	113	V2 R8	V2-K4 PolarHBondContact O-N 3.29Å; K4-R8 WeakPolarHBondContact O-CB 3.47Å; K4-R8 PolarHBondContact O-N 3.46Å
5	Q	67.8	Low	71.2	Confident	125 Å²	125	122.9 Å²	122.9	58%	0.584	61%	0.609	S	S	*	*	H	α-helix	trans	-74.4	-36.3	-177.8	-162.7	171.3	-10.1	0	0	111.6	V2 A3 R8 M9	V2-Q5 PolarHBondContact O-N 3.29Å; A3-Q5 VanDerWaalsContact C-N 3.27Å; A3-Q5 PolarHBondContact O-N 3.11Å; Q5-R8 PolarHBondContact O-N 3.48Å; Q5-M9 PolarHBondContact O-N 3.07Å; Q5-M9 VanDerWaalsContact O-N 3.09Å
6	R	67.3	Low	71.4	Confident	187 Å²	187	125.8 Å²	125.8	71%	0.706	62%	0.616	S	S	*	*	H	α-helix	trans	-66.7	-42.4	175.1	-64.8	-179.1	177.4	-165.1	-1	112	V2 A3 M9 A10	V2-R6 WeakPolarHBondContact O-CG 3.47Å; V2-R6 PolarHBondContact O-N 3.47Å; A3-R6 PolarHBondContact O-N 3.3Å; R6-M9 PolarHBondContact O-N 3.27Å; R6-A10 WeakPolarHBondContact O-CB 3.49Å; R6-A10 PolarHBondContact O-N 3.45Å
7	I	74.1	Confident	71.2	Confident	108 Å²	108	125.7 Å²	125.7	55%	0.554	62%	0.619	S	S	*	*	H	α-helix	trans	-66.1	-39.9	176	-65.6	-177.4	0	0	0	111.1	A3 M9 A10 N11	A3-I7 WeakPolarHBondContact O-CG1 3.48Å; A3-I7 PolarHBondContact O-N 3.31Å; A3-I7 VanDerWaalsContact O-N 3.11Å; I7-M9 PolarHBondContact O-N 2.94Å; I7-A10 PolarHBondContact O-N 2.93Å; I7-N11 PolarHBondContact O-N 3.41Å
8	R	77.1	Confident	71.3	Confident	159 Å²	159	122.7 Å²	122.7	60%	0.6	61%	0.605	S	S	*	*	H	α-helix	trans	-61.1	-45.7	176.7	-159	177.8	81.9	-147.8	4.9	111.9	K4 Q5 A10 N11 E12	K4-R8 WeakPolarHBondContact O-CB 3.47Å; K4-R8 PolarHBondContact O-N 3.46Å; Q5-R8 PolarHBondContact O-N 3.48Å; R8-A10 VanDerWaalsContact C-N 3.35Å; R8-A10 PolarHBondContact O-N 3.31Å; R8-N11 PolarHBondContact O-N 3.09Å; R8-E12 IonicContact NE-OE1 3.41Å; R8-E12 PolarHBondContact NE-OE1 3.44Å; R8-E12 WeakPolarHBondContact O-CG 3.33Å; R8-E12 PolarHBondContact O-N 3.03Å
9	M	78.6	Confident	71.5	Confident	115 Å²	115	122.8 Å²	122.8	57%	0.567	61%	0.614	S	S	*	*	H	α-helix	trans	-66.3	-35.6	178.4	-170.1	-179.8	-107.6	0	0	112.4	Q5 R6 I7 K13	Q5-M9 PolarHBondContact O-N 3.07Å; Q5-M9 VanDerWaalsContact O-N 3.09Å; R6-M9 PolarHBondContact O-N 3.27Å; I7-M9 PolarHBondContact O-N 2.94Å; M9-K13 WeakPolarHBondContact O-CG 3.44Å; M9-K13 PolarHBondContact O-N 2.92Å; M9-K13 VanDerWaalsContact O-N 3.07Å
10	A	75.9	Confident	71.3	Confident	55 Å²	55	122.9 Å²	122.9	46%	0.455	61%	0.612	S	S	.	*	H	α-helix	trans	-66.1	-43.6	174.2	0	0	0	0	0	111.8	R6 I7 R8 K13 H14	R6-A10 WeakPolarHBondContact O-CB 3.49Å; R6-A10 PolarHBondContact O-N 3.45Å; I7-A10 PolarHBondContact O-N 2.93Å; R8-A10 VanDerWaalsContact C-N 3.35Å; R8-A10 PolarHBondContact O-N 3.31Å; A10-K13 PolarHBondContact O-N 2.82Å; A10-H14 WeakPolarHBondContact O-CB 3.23Å; A10-H14 PolarHBondContact O-N 3.3Å
11	N	79.2	Confident	71.3	Confident	106 Å²	106	127 Å²	127	57%	0.567	62%	0.621	S	S	*	*	H	α-helix	trans	-64.8	-39.3	176.1	-78.7	9.5	0	0	0	112.2	I7 R8 H14 S15	I7-N11 PolarHBondContact O-N 3.41Å; R8-N11 PolarHBondContact O-N 3.09Å; N11-H14 PolarHBondContact O-N 3.07Å; N11-S15 VanDerWaalsContact O-CB 3.23Å; N11-S15 WeakPolarHBondContact O-CB 3.41Å; N11-S15 PolarHBondContact O-N 3.38Å
12	E	79.6	Confident	72	Confident	90 Å²	90	119.1 Å²	119.1	42%	0.421	60%	0.597	S	S	.	*	H	α-helix	trans	-64.4	-38.6	175.6	-75.3	169.7	-165.2	0	0	111.9	R8 K16	R8-E12 IonicContact NE-OE1 3.41Å; R8-E12 PolarHBondContact NE-OE1 3.44Å; R8-E12 WeakPolarHBondContact O-CG 3.33Å; R8-E12 PolarHBondContact O-N 3.03Å; E12-K16 VanDerWaalsContact O-CG 3.27Å; E12-K16 WeakPolarHBondContact O-CG 3.27Å; E12-K16 PolarHBondContact O-N 3.3Å
13	K	78	Confident	72.4	Confident	136 Å²	136	120.4 Å²	120.4	59%	0.591	60%	0.6	S	S	*	*	H	α-helix	trans	-67.3	-44.5	173.7	-75.1	179.9	180	-174	0	111.8	M9 A10 K16 N17	M9-K13 WeakPolarHBondContact O-CG 3.44Å; M9-K13 PolarHBondContact O-N 2.92Å; M9-K13 VanDerWaalsContact O-N 3.07Å; A10-K13 PolarHBondContact O-N 2.82Å; K13-K16 PolarHBondContact O-N 3.43Å; K13-N17 PolarHBondContact O-ND2 3.36Å
14	H	75.8	Confident	72.7	Confident	127 Å²	127	122.3 Å²	122.3	59%	0.588	61%	0.605	S	S	*	*	H	α-helix	trans	-64.9	-42.3	178.9	-172.2	-104.4	0	0	0	111.5	A10 N11 K16 N17	A10-H14 WeakPolarHBondContact O-CB 3.23Å; A10-H14 PolarHBondContact O-N 3.3Å; N11-H14 PolarHBondContact O-N 3.07Å; H14-K16 VanDerWaalsContact C-N 3.27Å; H14-K16 PolarHBondContact O-N 3.17Å; H14-N17 PolarHBondContact O-N 3.29Å
15	S	77.3	Confident	72.9	Confident	69 Å²	69	118 Å²	118	48%	0.483	60%	0.604	S	S	.	*	H	α-helix	trans	-64.1	-28.7	-179.7	-168.9	0	0	0	0	113.6	N11 N17	N11-S15 VanDerWaalsContact O-CB 3.23Å; N11-S15 WeakPolarHBondContact O-CB 3.41Å; N11-S15 PolarHBondContact O-N 3.38Å; S15-N17 VanDerWaalsContact C-N 3.33Å
16	K	74.9	Confident	72.9	Confident	169 Å²	169	121.8 Å²	121.8	74%	0.735	62%	0.619	S	S	*	*	H	α-helix	trans	-73.7	-23.5	177.7	-72.3	171.7	-174.2	-170.6	0	113.3	E12 K13 H14	E12-K16 VanDerWaalsContact O-CG 3.27Å; E12-K16 WeakPolarHBondContact O-CG 3.27Å; E12-K16 PolarHBondContact O-N 3.3Å; K13-K16 PolarHBondContact O-N 3.43Å; H14-K16 VanDerWaalsContact C-N 3.27Å; H14-K16 PolarHBondContact O-N 3.17Å
17	N	67.4	Low	73	Confident	124 Å²	124	116.6 Å²	116.6	66%	0.663	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91	-4.4	178.7	-67.2	-40.7	0	0	0	113.2	K13 H14 S15 T19	K13-N17 PolarHBondContact O-ND2 3.36Å; H14-N17 PolarHBondContact O-N 3.29Å; S15-N17 VanDerWaalsContact C-N 3.33Å; N17-T19 VanDerWaalsContact C-N 3.31Å; N17-T19 PolarHBondContact O-N 3.12Å
18	I	72.6	Confident	72.4	Confident	71 Å²	71	118.7 Å²	118.7	36%	0.364	63%	0.629	S	S	.	*			trans	-79.8	83.3	172.7	-49.9	-75.9	0	0	0	108.3	Q20 R21	I18-Q20 VanDerWaalsContact C-N 3.28Å; I18-Q20 PolarHBondContact O-N 3.06Å; I18-R21 HydrophobicContact CB-CB 4.38Å; I18-R21 HydrophobicContact CG2-CB 3.51Å; I18-R21 HydrophobicContact CG2-CG 3.89Å
19	T	76.1	Confident	71.5	Confident	125 Å²	125	118.8 Å²	118.8	77%	0.767	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.6	-17	178.9	53.9	0	0	0	0	113.4	N17	N17-T19 VanDerWaalsContact C-N 3.31Å; N17-T19 PolarHBondContact O-N 3.12Å
20	Q	66.6	Low	70.6	Confident	125 Å²	125	118.2 Å²	118.2	58%	0.584	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110	17.8	-174.6	-63.4	-86.7	76	0	0	112.4	I18 G22 N23	I18-Q20 VanDerWaalsContact C-N 3.28Å; I18-Q20 PolarHBondContact O-N 3.06Å; Q20-G22 PolarHBondContact O-N 2.94Å; Q20-N23 HydrophobicContact CB-CB 4.23Å; Q20-N23 PolarHBondContact O-N 2.98Å; Q20-N23 PolarHBondContact OE1-ND2 3.01Å
21	R	71.3	Confident	69.7	Low	210 Å²	210	120.7 Å²	120.7	79%	0.792	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65	110.9	-177.8	-149.8	174.4	-164.3	-124	0.9	109.1	I18	I18-R21 HydrophobicContact CB-CB 4.38Å; I18-R21 HydrophobicContact CG2-CB 3.51Å; I18-R21 HydrophobicContact CG2-CG 3.89Å
22	G	69.8	Low	68.6	Low	58 Å²	58	121.5 Å²	121.5	60%	0.598	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	84.9	5.9	-176.9	0	0	0	0	0	114.8	Q20 V24	Q20-G22 PolarHBondContact O-N 2.94Å; G22-V24 PolarHBondContact O-N 3.48Å
23	N	66.9	Low	67.5	Low	111 Å²	111	123.4 Å²	123.4	59%	0.594	65%	0.654	S	S	*	*			trans	-80	53.9	169.6	-161.3	58.2	0	0	0	111.2	Q20	Q20-N23 HydrophobicContact CB-CB 4.23Å; Q20-N23 PolarHBondContact O-N 2.98Å; Q20-N23 PolarHBondContact OE1-ND2 3.01Å
24	V	68.6	Low	66.5	Low	110 Å²	110	122.4 Å²	122.4	67%	0.667	66%	0.655	S	S	*	*	S	Bend	trans	-107.3	131.4	171.9	-67.2	0	0	0	0	107.5	G22 K26	G22-V24 PolarHBondContact O-N 3.48Å; V24-K26 PolarHBondContact O-N 3.02Å
25	A	66.1	Low	65.8	Low	98 Å²	98	123.1 Å²	123.1	81%	0.81	66%	0.656	S	S	*	*			trans	-57.7	116.8	176.3	0	0	0	0	0	108.5	S27	A25-S27 PolarHBondContact O-N 3.08Å; A25-S27 VanDerWaalsContact O-N 3.12Å
26	K	68.8	Low	65.1	Low	204 Å²	204	125.1 Å²	125.1	89%	0.887	67%	0.665	S	S	*	*	S	Bend	trans	-72.7	-0.6	-172.6	-67.1	-170.3	-178.6	-177.3	0	114.1	V24	V24-K26 PolarHBondContact O-N 3.02Å
27	S	67.8	Low	64.8	Low	78 Å²	78	122.4 Å²	122.4	55%	0.545	67%	0.674	S	S	.	*			trans	-171.4	141.4	173.8	-175.6	0	0	0	0	109	A25 R29	A25-S27 PolarHBondContact O-N 3.08Å; A25-S27 VanDerWaalsContact O-N 3.12Å; S27-R29 WeakPolarHBondContact OG-CB 3.38Å; S27-R29 PolarHBondContact OG-N 3.25Å; S27-R29 VanDerWaalsContact OG-N 3.08Å
28	T	62.5	Low	65.1	Low	152 Å²	152	119.3 Å²	119.3	93%	0.933	66%	0.66	S	S	*	*	S	Bend	trans	-76.7	-9.4	168.1	-25.3	0	0	0	0	112	N30	T28-N30 PolarHBondContact O-N 3.3Å
29	R	58.5	Low	65.8	Low	162 Å²	162	117.9 Å²	117.9	61%	0.611	66%	0.662	S	S	*	*	S	Bend	trans	-82.2	105.6	179.2	-171.2	176.6	173.4	111.4	-0.2	108.7	S27 P31 D34	S27-R29 WeakPolarHBondContact OG-CB 3.38Å; S27-R29 PolarHBondContact OG-N 3.25Å; S27-R29 VanDerWaalsContact OG-N 3.08Å; R29-P31 VanDerWaalsContact O-CD 3.32Å; R29-P31 WeakPolarHBondContact O-CD 3.32Å; R29-D34 IonicContact CZ-OD2 3.77Å; R29-D34 IonicContact NE-OD2 3.73Å; R29-D34 IonicContact NH2-OD1 3.56Å; R29-D34 IonicContact NH2-OD2 2.92Å; R29-D34 PolarHBondContact NH2-OD2 3.37Å
30	N	59.8	Low	66.3	Low	103 Å²	103	117.3 Å²	117.3	55%	0.551	66%	0.66	S	S	*	*			trans	-54.4	119.7	166.9	-107.9	25.9	0	0	0	108.3	T28 Q32 D33	T28-N30 PolarHBondContact O-N 3.3Å; N30-Q32 PolarHBondContact O-N 2.92Å; N30-D33 PolarHBondContact O-N 2.98Å
31	P	57.3	Low	67.3	Low	107 Å²	107	121.9 Å²	121.9	70%	0.695	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.4	-1.2	174.2	26.8	-33.1	0	0	0	112.8	R29	R29-P31 VanDerWaalsContact O-CD 3.32Å; R29-P31 WeakPolarHBondContact O-CD 3.32Å
32	Q	55.9	Low	68.2	Low	123 Å²	123	117.2 Å²	117.2	58%	0.575	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.3	-19.2	176.6	-129.2	84.2	24.8	0	0	113.6	N30 D34 K35	N30-Q32 PolarHBondContact O-N 2.92Å; Q32-D34 PolarHBondContact O-N 3.25Å; Q32-K35 WeakPolarHBondContact O-CB 3.48Å; Q32-K35 PolarHBondContact O-N 3.33Å; Q32-K35 VanDerWaalsContact O-N 3.15Å
33	D	55.9	Low	69.2	Low	130 Å²	130	118 Å²	118	70%	0.695	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.9	-18.3	-175.5	-110.2	-92.9	0	0	0	113.5	N30 K35	N30-D33 PolarHBondContact O-N 2.98Å; D33-K35 VanDerWaalsContact C-N 3.27Å; D33-K35 PolarHBondContact O-N 3.5Å
34	D	57.5	Low	70.3	Confident	115 Å²	115	115.6 Å²	115.6	62%	0.615	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.2	1.3	175.2	-75.8	-74	0	0	0	112.6	R29 Q32 V36	R29-D34 IonicContact CZ-OD2 3.77Å; R29-D34 IonicContact NE-OD2 3.73Å; R29-D34 IonicContact NH2-OD1 3.56Å; R29-D34 IonicContact NH2-OD2 2.92Å; R29-D34 PolarHBondContact NH2-OD2 3.37Å; Q32-D34 PolarHBondContact O-N 3.25Å; D34-V36 PolarHBondContact O-N 3.15Å
35	K	59.9	Low	71.6	Confident	142 Å²	142	114.9 Å²	114.9	62%	0.617	64%	0.64	S	S	*	*	S	Bend	trans	-85.5	107.2	169.6	-66.3	-166.8	-171.8	-67.6	0	108	Q32 D33 A37	Q32-K35 WeakPolarHBondContact O-CB 3.48Å; Q32-K35 PolarHBondContact O-N 3.33Å; Q32-K35 VanDerWaalsContact O-N 3.15Å; D33-K35 VanDerWaalsContact C-N 3.27Å; D33-K35 PolarHBondContact O-N 3.5Å; K35-A37 PolarHBondContact O-N 2.73Å; K35-A37 VanDerWaalsContact O-N 3.11Å
36	V	62.5	Low	72.9	Confident	111 Å²	111	116.8 Å²	116.8	67%	0.673	63%	0.63	S	S	*	*			trans	-24.4	117.1	162.8	-154.9	0	0	0	0	108.9	D34 V38	D34-V36 PolarHBondContact O-N 3.15Å; V36-V38 HydrophobicContact CG1-CG2 3.92Å; V36-V38 CarbonylContact O-C 3.52Å; V36-V38 PolarHBondContact O-N 3.11Å; V36-V38 VanDerWaalsContact O-O 3.11Å
37	A	69.9	Low	74	Confident	111 Å²	111	111.4 Å²	111.4	92%	0.917	61%	0.61	S	S	*	*	S	Bend	trans	-57.9	-2.9	-169.8	0	0	0	0	0	114.6	K35	K35-A37 PolarHBondContact O-N 2.73Å; K35-A37 VanDerWaalsContact O-N 3.11Å
38	V	73.9	Confident	75.3	Confident	60 Å²	60	114.6 Å²	114.6	36%	0.364	62%	0.615	S	S	.	*	S	Bend	trans	-113.9	128.2	175.5	-65.2	0	0	0	0	110.2	V36 L42 L43	V36-V38 HydrophobicContact CG1-CG2 3.92Å; V36-V38 CarbonylContact O-C 3.52Å; V36-V38 PolarHBondContact O-N 3.11Å; V36-V38 VanDerWaalsContact O-O 3.11Å; V38-L42 HydrophobicContact CB-CD2 4.23Å; V38-L42 HydrophobicContact CG1-CD2 4.16Å; V38-L43 HydrophobicContact CG2-CD1 4.2Å
39	G	86.6	Confident	76.8	Confident	40 Å²	40	111.1 Å²	111.1	41%	0.412	59%	0.593	S	S	.	*			trans	-62.3	149.8	179.9	0	0	0	0	0	112.2	W41 L42 L43	G39-W41 PolarHBondContact O-N 2.95Å; G39-W41 VanDerWaalsContact O-N 3.11Å; G39-L42 WeakPolarHBondContact O-CB 3.46Å; G39-L42 PolarHBondContact O-N 3.11Å; G39-L43 PolarHBondContact O-N 2.97Å
40	P	85.7	Confident	78.5	Confident	113 Å²	113	107 Å²	107	73%	0.734	59%	0.585	S	S	*	*	H	α-helix	trans	-53	-36.4	-180	-27.1	33.8	0	0	0	113.7	A44	P40-A44 WeakPolarHBondContact O-CB 3.27Å; P40-A44 PolarHBondContact O-N 2.88Å
41	W	88.9	Confident	80.2	Confident	222 Å²	222	105.6 Å²	105.6	84%	0.841	58%	0.583	S	S	*	*	H	α-helix	trans	-65.4	-44.9	175.9	-116.8	65.3	0	0	0	112.5	G39 L43 A44 L45	G39-W41 PolarHBondContact O-N 2.95Å; G39-W41 VanDerWaalsContact O-N 3.11Å; W41-L43 VanDerWaalsContact C-N 3.33Å; W41-A44 PolarHBondContact O-N 3.47Å; W41-L45 WeakPolarHBondContact O-CB 3.38Å; W41-L45 PolarHBondContact O-N 2.97Å
42	L	90	Very high	81.9	Confident	111 Å²	111	101.1 Å²	101.1	58%	0.581	56%	0.556	S	S	*	*	H	α-helix	trans	-65	-40.9	178.1	-156.7	93	0	0	0	110.6	V38 G39 L45 F46	V38-L42 HydrophobicContact CB-CD2 4.23Å; V38-L42 HydrophobicContact CG1-CD2 4.16Å; G39-L42 WeakPolarHBondContact O-CB 3.46Å; G39-L42 PolarHBondContact O-N 3.11Å; L42-L45 PolarHBondContact O-N 3.45Å; L42-F46 WeakPolarHBondContact O-CB 3.32Å; L42-F46 PolarHBondContact O-N 3.48Å
43	L	89.9	Confident	83.7	Confident	76 Å²	76	97.8 Å²	97.8	40%	0.398	55%	0.547	S	S	.	.	H	α-helix	trans	-64.4	-44.5	177.5	-171	67.1	0	0	0	111.6	V38 G39 W41 F46 I47	V38-L43 HydrophobicContact CG2-CD1 4.2Å; G39-L43 PolarHBondContact O-N 2.97Å; W41-L43 VanDerWaalsContact C-N 3.33Å; L43-F46 PolarHBondContact O-N 3.4Å; L43-I47 HydrophobicContact CD1-CD1 4.46Å; L43-I47 HydrophobicContact CG-CD1 4.14Å; L43-I47 VanDerWaalsContact O-CG1 3.31Å; L43-I47 WeakPolarHBondContact O-CG1 3.31Å; L43-I47 PolarHBondContact O-N 2.92Å
44	A	91.4	Very high	85.3	Confident	59 Å²	59	93.8 Å²	93.8	49%	0.488	53%	0.531	S	S	.	.	H	α-helix	trans	-62.6	-44.2	176	0	0	0	0	0	111.9	P40 W41 I47 F48	P40-A44 WeakPolarHBondContact O-CB 3.27Å; P40-A44 PolarHBondContact O-N 2.88Å; W41-A44 PolarHBondContact O-N 3.47Å; A44-I47 PolarHBondContact O-N 2.95Å; A44-F48 VanDerWaalsContact O-CB 3.3Å; A44-F48 WeakPolarHBondContact O-CB 3.19Å; A44-F48 PolarHBondContact O-N 2.97Å
45	L	94.1	Very high	87	Confident	95 Å²	95	92.9 Å²	92.9	50%	0.497	53%	0.526	S	S	.	.	H	α-helix	trans	-65.9	-40.8	178.5	-148.9	162	0	0	0	110.9	W41 L42 F48 V49	W41-L45 WeakPolarHBondContact O-CB 3.38Å; W41-L45 PolarHBondContact O-N 2.97Å; L42-L45 PolarHBondContact O-N 3.45Å; L45-F48 PolarHBondContact O-N 3.07Å; L45-V49 HydrophobicContact CD2-CG2 3.79Å; L45-V49 WeakPolarHBondContact O-CB 3.3Å; L45-V49 WeakPolarHBondContact O-CG2 3.37Å; L45-V49 PolarHBondContact O-N 2.76Å
46	F	93.4	Very high	88.4	Confident	138 Å²	138	92.1 Å²	92.1	61%	0.605	52%	0.522	S	S	*	.	H	α-helix	trans	-60.7	-50.1	175.7	-176.7	-102.5	0	0	0	111.9	L42 L43 F48 V49 V50	L42-F46 WeakPolarHBondContact O-CB 3.32Å; L42-F46 PolarHBondContact O-N 3.48Å; L43-F46 PolarHBondContact O-N 3.4Å; F46-F48 PolarHBondContact O-N 2.83Å; F46-V49 PolarHBondContact O-N 3.42Å; F46-V50 HydrophobicContact CD2-CG2 4.28Å; F46-V50 HydrophobicContact CE1-CG2 4.35Å; F46-V50 HydrophobicContact CE2-CG2 4.02Å; F46-V50 HydrophobicContact CZ-CG2 4.06Å; F46-V50 WeakPolarHBondContact O-CB 3.45Å; F46-V50 VanDerWaalsContact O-CG2 3.27Å; F46-V50 WeakPolarHBondContact O-CG2 3.07Å; F46-V50 PolarHBondContact O-N 2.95Å
47	I	93.7	Very high	89.7	Confident	92 Å²	92	93.1 Å²	93.1	47%	0.472	52%	0.52	S	S	.	.	H	α-helix	trans	-63	-43	177.6	-66	166.7	0	0	0	110.8	L43 A44 C51	L43-I47 HydrophobicContact CD1-CD1 4.46Å; L43-I47 HydrophobicContact CG-CD1 4.14Å; L43-I47 VanDerWaalsContact O-CG1 3.31Å; L43-I47 WeakPolarHBondContact O-CG1 3.31Å; L43-I47 PolarHBondContact O-N 2.92Å; A44-I47 PolarHBondContact O-N 2.95Å; I47-C51 VanDerWaalsContact O-CB 3.32Å; I47-C51 WeakPolarHBondContact O-CB 3.42Å; I47-C51 PolarHBondContact O-N 3.41Å
48	F	95	Very high	90.6	Very high	144 Å²	144	92.4 Å²	92.4	63%	0.632	50%	0.5	S	S	*	.	H	α-helix	trans	-62.2	-46.1	179	176.2	-100	0	0	0	112.3	A44 L45 F46 G52	A44-F48 VanDerWaalsContact O-CB 3.3Å; A44-F48 WeakPolarHBondContact O-CB 3.19Å; A44-F48 PolarHBondContact O-N 2.97Å; L45-F48 PolarHBondContact O-N 3.07Å; F46-F48 PolarHBondContact O-N 2.83Å; F48-G52 WeakPolarHBondContact O-CA 3.12Å; F48-G52 PolarHBondContact O-N 3.19Å
49	V	94.1	Very high	91.3	Very high	79 Å²	79	93.7 Å²	93.7	48%	0.479	50%	0.504	S	S	.	.	H	α-helix	trans	-67.5	-46.9	179.3	166.3	0	0	0	0	111	L45 F46 S53	L45-V49 HydrophobicContact CD2-CG2 3.79Å; L45-V49 WeakPolarHBondContact O-CB 3.3Å; L45-V49 WeakPolarHBondContact O-CG2 3.37Å; L45-V49 PolarHBondContact O-N 2.76Å; F46-V49 PolarHBondContact O-N 3.42Å; V49-S53 WeakPolarHBondContact O-CB 3.33Å; V49-S53 PolarHBondContact O-N 3.22Å; V49-S53 VanDerWaalsContact O-N 3.07Å; V49-S53 PolarHBondContact O-OG 3.41Å
50	V	93.6	Very high	91.3	Very high	75 Å²	75	96.8 Å²	96.8	46%	0.455	51%	0.507	S	S	.	.	H	α-helix	trans	-69.7	-55.2	-176.3	176.1	0	0	0	0	111.4	F46 S53	F46-V50 HydrophobicContact CD2-CG2 4.28Å; F46-V50 HydrophobicContact CE1-CG2 4.35Å; F46-V50 HydrophobicContact CE2-CG2 4.02Å; F46-V50 HydrophobicContact CZ-CG2 4.06Å; F46-V50 WeakPolarHBondContact O-CB 3.45Å; F46-V50 VanDerWaalsContact O-CG2 3.27Å; F46-V50 WeakPolarHBondContact O-CG2 3.07Å; F46-V50 PolarHBondContact O-N 2.95Å; V50-S53 PolarHBondContact O-OG 3.38Å; V50-S53 VanDerWaalsContact O-OG 3.07Å
51	C	94.8	Very high	91.2	Very high	75 Å²	75	94.4 Å²	94.4	51%	0.507	49%	0.493	S	S	.	.	H	α-helix	trans	-73.8	-37.9	179.8	-74.6	0	0	0	0	112.4	I47 A54 I55	I47-C51 VanDerWaalsContact O-CB 3.32Å; I47-C51 WeakPolarHBondContact O-CB 3.42Å; I47-C51 PolarHBondContact O-N 3.41Å; C51-A54 PolarHBondContact O-N 3.07Å; C51-I55 WeakPolarHBondContact O-CG1 3.43Å; C51-I55 PolarHBondContact O-N 2.91Å
52	G	93	Very high	91	Very high	12 Å²	12	90.1 Å²	90.1	12%	0.124	49%	0.486	C	S	.	.	H	α-helix	trans	-65.3	-41.1	-179.3	0	0	0	0	0	112.1	F48 A54 I55 F56	F48-G52 WeakPolarHBondContact O-CA 3.12Å; F48-G52 PolarHBondContact O-N 3.19Å; G52-A54 VanDerWaalsContact C-N 3.31Å; G52-A54 PolarHBondContact O-N 2.82Å; G52-I55 PolarHBondContact O-N 3.39Å; G52-F56 WeakPolarHBondContact O-CD2 3.46Å; G52-F56 PolarHBondContact O-N 2.9Å
53	S	93.2	Very high	90.4	Very high	54 Å²	54	95.4 Å²	95.4	38%	0.378	50%	0.498	S	S	.	.	H	α-helix	trans	-63	-36.1	178.4	62	0	0	0	0	113.1	V49 V50 F56 Q57	V49-S53 WeakPolarHBondContact O-CB 3.33Å; V49-S53 PolarHBondContact O-N 3.22Å; V49-S53 VanDerWaalsContact O-N 3.07Å; V49-S53 PolarHBondContact O-OG 3.41Å; V50-S53 PolarHBondContact O-OG 3.38Å; V50-S53 VanDerWaalsContact O-OG 3.07Å; S53-F56 PolarHBondContact O-N 3.26Å; S53-Q57 WeakPolarHBondContact O-CB 3.23Å; S53-Q57 PolarHBondContact O-N 2.85Å
54	A	91.2	Very high	89.4	Confident	45 Å²	45	98.1 Å²	98.1	37%	0.372	51%	0.51	S	S	.	.	H	α-helix	trans	-64.9	-43.7	174.1	0	0	0	0	0	111.5	C51 G52 Q57 I58	C51-A54 PolarHBondContact O-N 3.07Å; G52-A54 VanDerWaalsContact C-N 3.31Å; G52-A54 PolarHBondContact O-N 2.82Å; A54-Q57 PolarHBondContact O-N 3.47Å; A54-I58 WeakPolarHBondContact O-CD1 3.31Å; A54-I58 VanDerWaalsContact O-CG1 3.23Å; A54-I58 WeakPolarHBondContact O-CG1 3.16Å; A54-I58 PolarHBondContact O-N 2.89Å
55	I	92.4	Very high	88.2	Confident	97 Å²	97	96.9 Å²	96.9	50%	0.497	50%	0.503	S	S	.	.	H	α-helix	trans	-62.9	-45.6	176.4	-64.7	170.6	0	0	0	110.7	C51 G52 I58 I59	C51-I55 WeakPolarHBondContact O-CG1 3.43Å; C51-I55 PolarHBondContact O-N 2.91Å; G52-I55 PolarHBondContact O-N 3.39Å; I55-I58 PolarHBondContact O-N 2.9Å; I55-I59 HydrophobicContact CG2-CD1 3.72Å; I55-I59 HydrophobicContact CG2-CG1 4.39Å; I55-I59 VanDerWaalsContact O-CG1 3.31Å; I55-I59 WeakPolarHBondContact O-CG1 3.22Å; I55-I59 PolarHBondContact O-N 3.39Å
56	F	89.3	Confident	86.4	Confident	125 Å²	125	104.5 Å²	104.5	55%	0.548	54%	0.539	S	S	.	.	H	α-helix	trans	-64.1	-40.4	176.8	-81.4	-70.5	0	0	0	112.2	G52 S53 I59 Q60	G52-F56 WeakPolarHBondContact O-CD2 3.46Å; G52-F56 PolarHBondContact O-N 2.9Å; S53-F56 PolarHBondContact O-N 3.26Å; F56-I59 PolarHBondContact O-N 3.35Å; F56-Q60 WeakPolarHBondContact O-CB 3.23Å; F56-Q60 VanDerWaalsContact O-CG 3.25Å; F56-Q60 WeakPolarHBondContact O-CG 3.25Å; F56-Q60 PolarHBondContact O-N 2.91Å
57	Q	88.8	Confident	86	Confident	132 Å²	132	102.9 Å²	102.9	62%	0.617	54%	0.536	S	S	*	.	H	α-helix	trans	-60.1	-43.9	172.4	-90.1	178.1	65.8	0	0	111.9	S53 A54 Q60 S61	S53-Q57 WeakPolarHBondContact O-CB 3.23Å; S53-Q57 PolarHBondContact O-N 2.85Å; A54-Q57 PolarHBondContact O-N 3.47Å; Q57-Q60 PolarHBondContact O-N 3.48Å; Q57-S61 WeakPolarHBondContact O-CB 3.16Å; Q57-S61 PolarHBondContact O-N 3.21Å; Q57-S61 PolarHBondContact O-OG 2.73Å
58	I	90	Very high	85.6	Confident	96 Å²	96	103.4 Å²	103.4	49%	0.492	54%	0.539	S	S	.	.	H	α-helix	trans	-63.6	-50.6	178.1	-68.9	161.8	0	0	0	110.4	A54 I55 Q60 S61 I62	A54-I58 WeakPolarHBondContact O-CD1 3.31Å; A54-I58 VanDerWaalsContact O-CG1 3.23Å; A54-I58 WeakPolarHBondContact O-CG1 3.16Å; A54-I58 PolarHBondContact O-N 2.89Å; I55-I58 PolarHBondContact O-N 2.9Å; I58-Q60 VanDerWaalsContact C-N 3.3Å; I58-Q60 PolarHBondContact O-N 3.43Å; I58-S61 WeakPolarHBondContact CA-OG 3.35Å; I58-S61 PolarHBondContact O-N 3.23Å; I58-S61 PolarHBondContact O-OG 3.34Å; I58-I62 HydrophobicContact CG2-CD1 3.62Å; I58-I62 HydrophobicContact CG2-CG1 4.42Å; I58-I62 VanDerWaalsContact O-CG1 3.27Å; I58-I62 WeakPolarHBondContact O-CG1 3.36Å; I58-I62 PolarHBondContact O-N 3.37Å
59	I	88.9	Confident	85.1	Confident	88 Å²	88	101.2 Å²	101.2	45%	0.451	53%	0.534	S	S	.	.	H	α-helix	trans	-60.8	-42.3	178.7	-66.3	169.3	0	0	0	110.8	I55 F56 I62 R63	I55-I59 HydrophobicContact CG2-CD1 3.72Å; I55-I59 HydrophobicContact CG2-CG1 4.39Å; I55-I59 VanDerWaalsContact O-CG1 3.31Å; I55-I59 WeakPolarHBondContact O-CG1 3.22Å; I55-I59 PolarHBondContact O-N 3.39Å; F56-I59 PolarHBondContact O-N 3.35Å; I59-I62 PolarHBondContact O-N 3.42Å; I59-R63 WeakPolarHBondContact O-CB 3.09Å; I59-R63 PolarHBondContact O-N 3.47Å
60	Q	86.1	Confident	84.6	Confident	104 Å²	104	102.5 Å²	102.5	49%	0.486	54%	0.538	S	S	.	.	H	α-helix	trans	-65.3	-44.5	176	-79.8	-173.6	-4.6	0	0	111.9	F56 Q57 I58 I62 R63 M64	F56-Q60 WeakPolarHBondContact O-CB 3.23Å; F56-Q60 VanDerWaalsContact O-CG 3.25Å; F56-Q60 WeakPolarHBondContact O-CG 3.25Å; F56-Q60 PolarHBondContact O-N 2.91Å; Q57-Q60 PolarHBondContact O-N 3.48Å; I58-Q60 VanDerWaalsContact C-N 3.3Å; I58-Q60 PolarHBondContact O-N 3.43Å; Q60-I62 VanDerWaalsContact C-N 3.31Å; Q60-I62 PolarHBondContact O-N 2.83Å; Q60-R63 PolarHBondContact O-N 2.78Å; Q60-M64 HydrophobicContact CB-CE 3.43Å; Q60-M64 VanDerWaalsContact CB-CE 3.43Å; Q60-M64 HydrophobicContact CG-CE 3.51Å; Q60-M64 WeakPolarHBondContact O-CA 3.42Å; Q60-M64 VanDerWaalsContact O-CB 3.23Å; Q60-M64 WeakPolarHBondContact O-CB 3.27Å; Q60-M64 PolarHBondContact O-N 3.01Å
61	S	83.5	Confident	84	Confident	63 Å²	63	104.2 Å²	104.2	44%	0.441	54%	0.543	S	S	.	.	H	α-helix	trans	-66.1	-29.4	177.6	65.6	0	0	0	0	113.5	Q57 I58 G65 M66	Q57-S61 WeakPolarHBondContact O-CB 3.16Å; Q57-S61 PolarHBondContact O-N 3.21Å; Q57-S61 PolarHBondContact O-OG 2.73Å; I58-S61 WeakPolarHBondContact CA-OG 3.35Å; I58-S61 PolarHBondContact O-N 3.23Å; I58-S61 PolarHBondContact O-OG 3.34Å; S61-G65 CarbonylContact O-C 2.96Å; S61-G65 WeakPolarHBondContact O-CA 3.13Å; S61-G65 PolarHBondContact O-N 2.75Å; S61-M66 PolarHBondContact O-N 2.91Å
62	I	85.8	Confident	83.3	Confident	132 Å²	132	106.1 Å²	106.1	68%	0.677	55%	0.545	S	S	*	.	H	α-helix	trans	-80.7	-38.7	175.5	-64.3	168.1	0	0	0	110.7	I58 I59 Q60	I58-I62 HydrophobicContact CG2-CD1 3.62Å; I58-I62 HydrophobicContact CG2-CG1 4.42Å; I58-I62 VanDerWaalsContact O-CG1 3.27Å; I58-I62 WeakPolarHBondContact O-CG1 3.36Å; I58-I62 PolarHBondContact O-N 3.37Å; I59-I62 PolarHBondContact O-N 3.42Å; Q60-I62 VanDerWaalsContact C-N 3.31Å; Q60-I62 PolarHBondContact O-N 2.83Å
63	R	77.4	Confident	82.6	Confident	222 Å²	222	112.9 Å²	112.9	84%	0.838	58%	0.575	S	S	*	*	H	α-helix	trans	-84.3	-38.3	-175.1	-167.3	178.6	-172.2	179.7	2.9	113.7	I59 Q60	I59-R63 WeakPolarHBondContact O-CB 3.09Å; I59-R63 PolarHBondContact O-N 3.47Å; Q60-R63 PolarHBondContact O-N 2.78Å
64	M	67.6	Low	81.8	Confident	134 Å²	134	117.4 Å²	117.4	66%	0.66	59%	0.59	S	S	*	*	S	Bend	trans	-84.5	-2.9	170.2	-71.1	-176.2	-78.9	0	0	111.8	Q60	Q60-M64 HydrophobicContact CB-CE 3.43Å; Q60-M64 VanDerWaalsContact CB-CE 3.43Å; Q60-M64 HydrophobicContact CG-CE 3.51Å; Q60-M64 WeakPolarHBondContact O-CA 3.42Å; Q60-M64 VanDerWaalsContact O-CB 3.23Å; Q60-M64 WeakPolarHBondContact O-CB 3.27Å; Q60-M64 PolarHBondContact O-N 3.01Å
65	G	67.7	Low	81	Confident	33 Å²	33	123.4 Å²	123.4	34%	0.34	61%	0.609	S	S	.	*			trans	64.5	167.8	-171.3	0	0	0	0	0	110.9	S61	S61-G65 CarbonylContact O-C 2.96Å; S61-G65 WeakPolarHBondContact O-CA 3.13Å; S61-G65 PolarHBondContact O-N 2.75Å
66	M	54.9	Low	80	Confident	255 Å²	255	125.8 Å²	125.8	100%	1.256	62%	0.619	S	S	*	*			trans	-60.6	0	130	-65.6	-178.3	-67.2	0	0	108.5	S61	S61-M66 PolarHBondContact O-N 2.91Å

Retrieved 66 of 66 residues in 87.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).