A0A060WYM2_ONCMY Loading...

Cytochrome c oxidase subunit 7A2, mitochondrial

AlphaFold DB , UniProt , Accession A0A060WYM2, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110522088, Length 83 aa.

						>A0A060WYM2_ONCMY|A0A060WYM2|LOC110522088
MYRHIQALQQVSRRTLSTSARRQVENKVPHKQKHFQEDNGIPIHLKGGVSDAILYRATMALTILGSAYVIYELVCAAFPKKKE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.6	Low	74.3	Confident	190 Å²	190	130.8 Å²	130.8	94%	0.936	62%	0.623	S	S	*	*				0	-50.5	0	-128.5	167.4	79.3	0	0	113.4	R3 H4	M1-R3 PolarHBondContact O-N 3.33Å; M1-H4 PolarHBondContact O-N 3.37Å
2	Y	71.3	Confident	74.1	Confident	188 Å²	188	127.7 Å²	127.7	74%	0.737	63%	0.625	S	S	*	*	H	α-helix	trans	-57.5	-37.3	-178.3	-99.2	-96	0	0	0	115.9	H4 I5 Q6	Y2-H4 VanDerWaalsContact C-N 3.33Å; Y2-H4 PolarHBondContact O-N 3.24Å; Y2-I5 PolarHBondContact O-N 3.37Å; Y2-Q6 WeakPolarHBondContact O-CG 3.33Å; Y2-Q6 PolarHBondContact O-N 2.87Å
3	R	69.1	Low	73.5	Confident	212 Å²	212	133.4 Å²	133.4	80%	0.8	64%	0.636	S	S	*	*	H	α-helix	trans	-61.5	-36.9	177.9	-86.4	-179.9	164	179.2	-4.6	113.8	M1 A7	M1-R3 PolarHBondContact O-N 3.33Å; R3-A7 WeakPolarHBondContact O-CB 3.37Å; R3-A7 PolarHBondContact O-N 3.31Å
4	H	75.6	Confident	72.7	Confident	147 Å²	147	136.1 Å²	136.1	68%	0.681	64%	0.637	S	S	*	*	H	α-helix	trans	-72	-35.7	179.2	-59.5	-68.7	0	0	0	111.3	M1 Y2 A7 L8	M1-H4 PolarHBondContact O-N 3.37Å; Y2-H4 VanDerWaalsContact C-N 3.33Å; Y2-H4 PolarHBondContact O-N 3.24Å; H4-A7 PolarHBondContact O-N 3.31Å; H4-L8 WeakPolarHBondContact O-CB 3.25Å; H4-L8 PolarHBondContact O-N 3.26Å
5	I	80.5	Confident	72	Confident	81 Å²	81	135.6 Å²	135.6	42%	0.415	65%	0.647	S	S	.	*	H	α-helix	trans	-67.1	-43.9	176.6	-61	171.5	0	0	0	110.4	Y2 L8 Q9	Y2-I5 PolarHBondContact O-N 3.37Å; I5-L8 PolarHBondContact O-N 2.99Å; I5-Q9 WeakPolarHBondContact O-CG 3.3Å; I5-Q9 PolarHBondContact O-N 2.84Å
6	Q	79.3	Confident	71.4	Confident	110 Å²	110	137.4 Å²	137.4	51%	0.514	66%	0.66	S	S	.	*	H	α-helix	trans	-64.4	-41.5	175.7	-71.7	175.5	-27.8	0	0	112.2	Y2 L8 Q9 Q10	Y2-Q6 WeakPolarHBondContact O-CG 3.33Å; Y2-Q6 PolarHBondContact O-N 2.87Å; Q6-L8 VanDerWaalsContact C-N 3.32Å; Q6-L8 PolarHBondContact O-N 2.88Å; Q6-Q9 PolarHBondContact O-N 3.39Å; Q6-Q10 WeakPolarHBondContact O-CB 3.23Å; Q6-Q10 PolarHBondContact O-N 3.46Å
7	A	79.1	Confident	70.7	Confident	50 Å²	50	135.3 Å²	135.3	41%	0.413	66%	0.663	S	S	.	*	H	α-helix	trans	-62.3	-40.4	175.2	0	0	0	0	0	111.8	R3 H4 Q10 V11	R3-A7 WeakPolarHBondContact O-CB 3.37Å; R3-A7 PolarHBondContact O-N 3.31Å; H4-A7 PolarHBondContact O-N 3.31Å; A7-Q10 PolarHBondContact O-N 2.95Å; A7-V11 VanDerWaalsContact O-CG2 3.31Å; A7-V11 WeakPolarHBondContact O-CG2 3.36Å; A7-V11 PolarHBondContact O-N 3.48Å
8	L	76.9	Confident	70.2	Confident	132 Å²	132	134.3 Å²	134.3	69%	0.691	67%	0.667	S	S	*	*	H	α-helix	trans	-67.7	-41.6	178.1	-155	122.5	0	0	0	111.8	H4 I5 Q6 Q10 V11 S12	H4-L8 WeakPolarHBondContact O-CB 3.25Å; H4-L8 PolarHBondContact O-N 3.26Å; I5-L8 PolarHBondContact O-N 2.99Å; Q6-L8 VanDerWaalsContact C-N 3.32Å; Q6-L8 PolarHBondContact O-N 2.88Å; L8-Q10 VanDerWaalsContact C-N 3.3Å; L8-Q10 PolarHBondContact O-N 3.45Å; L8-V11 PolarHBondContact O-N 3.03Å; L8-S12 WeakPolarHBondContact O-CB 3.42Å; L8-S12 PolarHBondContact O-N 3.37Å
9	Q	75.5	Confident	69.4	Low	100 Å²	100	133.5 Å²	133.5	47%	0.467	68%	0.675	S	S	.	*	H	α-helix	trans	-62.7	-35.9	172.1	-74.9	-180	-22.7	0	0	112.5	I5 Q6 S12 R13	I5-Q9 WeakPolarHBondContact O-CG 3.3Å; I5-Q9 PolarHBondContact O-N 2.84Å; Q6-Q9 PolarHBondContact O-N 3.39Å; Q9-S12 PolarHBondContact O-OG 2.99Å; Q9-S12 VanDerWaalsContact O-OG 3.07Å; Q9-R13 WeakPolarHBondContact O-CB 3.37Å; Q9-R13 VanDerWaalsContact O-CG 3.23Å; Q9-R13 WeakPolarHBondContact O-CG 3.49Å; Q9-R13 PolarHBondContact O-N 3.25Å; Q9-R13 VanDerWaalsContact O-N 3.08Å
10	Q	74.2	Confident	69.1	Low	135 Å²	135	130.6 Å²	130.6	63%	0.631	67%	0.672	S	S	*	*	H	α-helix	trans	-72.7	-35.4	178.3	-166	168.8	0.1	0	0	111.7	Q6 A7 L8 R14	Q6-Q10 WeakPolarHBondContact O-CB 3.23Å; Q6-Q10 PolarHBondContact O-N 3.46Å; A7-Q10 PolarHBondContact O-N 2.95Å; L8-Q10 VanDerWaalsContact C-N 3.3Å; L8-Q10 PolarHBondContact O-N 3.45Å; Q10-R14 WeakPolarHBondContact O-CG 3.37Å; Q10-R14 PolarHBondContact O-N 3.19Å
11	V	73.2	Confident	68.7	Low	94 Å²	94	135.8 Å²	135.8	57%	0.57	68%	0.683	S	S	*	*	H	α-helix	trans	-70.1	-40.4	173.3	172.8	0	0	0	0	111.3	A7 L8 R13 R14	A7-V11 VanDerWaalsContact O-CG2 3.31Å; A7-V11 WeakPolarHBondContact O-CG2 3.36Å; A7-V11 PolarHBondContact O-N 3.48Å; L8-V11 PolarHBondContact O-N 3.03Å; V11-R13 VanDerWaalsContact C-N 3.28Å; V11-R13 PolarHBondContact O-N 3.01Å; V11-R14 WeakPolarHBondContact O-CB 3.44Å; V11-R14 PolarHBondContact O-N 3.36Å
12	S	71.6	Confident	68.7	Low	93 Å²	93	135 Å²	135	65%	0.65	67%	0.67	S	S	*	*	H	α-helix	trans	-68.3	-27	177.7	79.7	0	0	0	0	113.1	L8 Q9	L8-S12 WeakPolarHBondContact O-CB 3.42Å; L8-S12 PolarHBondContact O-N 3.37Å; Q9-S12 PolarHBondContact O-OG 2.99Å; Q9-S12 VanDerWaalsContact O-OG 3.07Å
13	R	66.6	Low	68.7	Low	202 Å²	202	135.5 Å²	135.5	76%	0.762	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86	-3.6	175.8	-72.3	179.3	-178.6	-155.9	1.6	113.9	Q9 V11 T15	Q9-R13 WeakPolarHBondContact O-CB 3.37Å; Q9-R13 VanDerWaalsContact O-CG 3.23Å; Q9-R13 WeakPolarHBondContact O-CG 3.49Å; Q9-R13 PolarHBondContact O-N 3.25Å; Q9-R13 VanDerWaalsContact O-N 3.08Å; V11-R13 VanDerWaalsContact C-N 3.28Å; V11-R13 PolarHBondContact O-N 3.01Å; R13-T15 PolarHBondContact O-N 3.46Å
14	R	62.4	Low	69.4	Low	172 Å²	172	130.7 Å²	130.7	65%	0.649	67%	0.673	S	S	*	*	S	Bend	trans	-69.3	106.6	169.2	-72.1	-179.1	-178.3	-174.3	-0.7	107.6	Q10 V11 L16	Q10-R14 WeakPolarHBondContact O-CG 3.37Å; Q10-R14 PolarHBondContact O-N 3.19Å; V11-R14 WeakPolarHBondContact O-CB 3.44Å; V11-R14 PolarHBondContact O-N 3.36Å; R14-L16 PolarHBondContact O-N 3.44Å; R14-L16 VanDerWaalsContact O-N 3.08Å
15	T	63	Low	70	Confident	128 Å²	128	129.4 Å²	129.4	79%	0.785	67%	0.667	S	S	*	*			trans	-46.2	120.6	162.1	-52.7	0	0	0	0	107.2	R13 S17	R13-T15 PolarHBondContact O-N 3.46Å; T15-S17 PolarHBondContact O-N 2.86Å
16	L	61.6	Low	70.4	Confident	164 Å²	164	128.7 Å²	128.7	86%	0.859	66%	0.664	S	S	*	*			trans	-67	72.8	174.2	-67.1	171	0	0	0	108.2	R14 T18	R14-L16 PolarHBondContact O-N 3.44Å; R14-L16 VanDerWaalsContact O-N 3.08Å; L16-T18 PolarHBondContact O-N 3.21Å; L16-T18 VanDerWaalsContact O-N 3.12Å
17	S	58.9	Low	71.2	Confident	102 Å²	102	128.2 Å²	128.2	71%	0.713	66%	0.66	S	S	*	*			trans	-77	95.4	171.5	-177.6	0	0	0	0	106.1	T15 S19	T15-S17 PolarHBondContact O-N 2.86Å; S17-S19 PolarHBondContact O-N 2.97Å
18	T	61.5	Low	72	Confident	118 Å²	118	129.7 Å²	129.7	72%	0.724	66%	0.664	S	S	*	*			trans	-66.6	109.4	174.3	87.8	0	0	0	0	106.9	L16 A20	L16-T18 PolarHBondContact O-N 3.21Å; L16-T18 VanDerWaalsContact O-N 3.12Å; T18-A20 PolarHBondContact O-N 2.94Å
19	S	56	Low	73	Confident	118 Å²	118	126.6 Å²	126.6	83%	0.825	65%	0.652	S	S	*	*			trans	-82.1	2.9	175.5	56.9	0	0	0	0	112.2	S17 R21	S17-S19 PolarHBondContact O-N 2.97Å; S19-R21 PolarHBondContact O-N 3.3Å; S19-R21 VanDerWaalsContact O-N 3.08Å
20	A	62.9	Low	74	Confident	75 Å²	75	127.3 Å²	127.3	62%	0.62	66%	0.655	S	S	*	*	S	Bend	trans	-58.1	116.5	172.3	0	0	0	0	0	107.9	T18 R22	T18-A20 PolarHBondContact O-N 2.94Å; A20-R22 PolarHBondContact O-N 3.32Å
21	R	60.3	Low	75	Confident	240 Å²	240	127 Å²	127	91%	0.906	65%	0.652	S	S	*	*			trans	-53.8	106.4	172.2	-73.8	-171.8	-179.2	-170.8	0.9	107.1	S19 Q23	S19-R21 PolarHBondContact O-N 3.3Å; S19-R21 VanDerWaalsContact O-N 3.08Å; R21-Q23 PolarHBondContact O-N 2.93Å
22	R	62.7	Low	76.2	Confident	173 Å²	173	127.2 Å²	127.2	65%	0.653	65%	0.646	S	S	*	*			trans	-59.9	108.7	172.6	-139.8	179.4	-176.6	172.4	-2.8	105.1	A20 V24 N26	A20-R22 PolarHBondContact O-N 3.32Å; R22-V24 WeakPolarHBondContact CB-O 3.41Å; R22-V24 VanDerWaalsContact CD-O 3.29Å; R22-V24 WeakPolarHBondContact CD-O 3.46Å; R22-V24 WeakPolarHBondContact CG-O 3.26Å; R22-V24 PolarHBondContact O-N 2.93Å; R22-N26 PolarHBondContact NH1-ND2 3.18Å
23	Q	71.4	Confident	77.5	Confident	200 Å²	200	130.9 Å²	130.9	94%	0.935	65%	0.651	S	S	*	*	S	Bend	trans	-57.8	-16.4	178.6	-75.2	178.4	-62.2	0	0	111.6	R21	R21-Q23 PolarHBondContact O-N 2.93Å
24	V	83.7	Confident	79	Confident	110 Å²	110	125 Å²	125	67%	0.667	63%	0.632	S	S	*	*	S	Bend	trans	-130.9	134.5	175.2	-176.1	0	0	0	0	109.7	R22	R22-V24 WeakPolarHBondContact CB-O 3.41Å; R22-V24 VanDerWaalsContact CD-O 3.29Å; R22-V24 WeakPolarHBondContact CD-O 3.46Å; R22-V24 WeakPolarHBondContact CG-O 3.26Å; R22-V24 PolarHBondContact O-N 2.93Å
25	E	88.3	Confident	80.6	Confident	121 Å²	121	120.5 Å²	120.5	57%	0.565	62%	0.617	S	S	*	*			trans	-65.4	146.9	176.7	-163.5	-165.9	138.6	0	0	111.9	K27	E25-K27 PolarHBondContact O-N 2.97Å; E25-K27 VanDerWaalsContact O-N 3.14Å; E25-K27 IonicContact OE1-NZ 2.78Å; E25-K27 PolarHBondContact OE1-NZ 3.43Å; E25-K27 WeakPolarHBondContact OE2-CE 3.46Å; E25-K27 IonicContact OE2-NZ 2.71Å; E25-K27 PolarHBondContact OE2-NZ 2.74Å
26	N	90.5	Very high	82.3	Confident	66 Å²	66	121.2 Å²	121.2	35%	0.353	61%	0.612	S	S	.	*			trans	-70	109	176	-165.4	-6.4	0	0	0	111.8	R22 V28	R22-N26 PolarHBondContact NH1-ND2 3.18Å; N26-V28 WeakPolarHBondContact OD1-CB 3.42Å; N26-V28 WeakPolarHBondContact OD1-CG2 3.34Å; N26-V28 PolarHBondContact OD1-N 3.46Å
27	K	94.4	Very high	84	Confident	99 Å²	99	118.5 Å²	118.5	43%	0.43	60%	0.595	S	S	.	*			trans	-97.3	2.4	174.6	-60.1	-56.6	-174.8	-170.9	0	114.7	E25 H30 K31	E25-K27 PolarHBondContact O-N 2.97Å; E25-K27 VanDerWaalsContact O-N 3.14Å; E25-K27 IonicContact OE1-NZ 2.78Å; E25-K27 PolarHBondContact OE1-NZ 3.43Å; E25-K27 WeakPolarHBondContact OE2-CE 3.46Å; E25-K27 IonicContact OE2-NZ 2.71Å; E25-K27 PolarHBondContact OE2-NZ 2.74Å; K27-H30 PolarHBondContact O-N 2.85Å; K27-K31 PolarHBondContact O-N 3.37Å; K27-K31 VanDerWaalsContact O-N 3.07Å
28	V	96.4	Very high	85.9	Confident	81 Å²	81	121.3 Å²	121.3	49%	0.491	60%	0.602	S	S	.	*	H	α-helix	trans	-57.9	-47.7	-178.9	175.3	0	0	0	0	112.6	N26 H30 K31 Q32	N26-V28 WeakPolarHBondContact OD1-CB 3.42Å; N26-V28 WeakPolarHBondContact OD1-CG2 3.34Å; N26-V28 PolarHBondContact OD1-N 3.46Å; V28-H30 VanDerWaalsContact C-N 3.27Å; V28-H30 PolarHBondContact O-N 3.41Å; V28-K31 PolarHBondContact O-N 2.95Å; V28-K31 VanDerWaalsContact O-N 3.14Å; V28-Q32 HydrophobicContact CG1-CG 4.1Å; V28-Q32 WeakPolarHBondContact O-CG 3.27Å; V28-Q32 PolarHBondContact O-N 3.43Å
29	P	97.1	Very high	87.5	Confident	68 Å²	68	118.6 Å²	118.6	44%	0.442	58%	0.583	S	S	.	*	H	α-helix	trans	-60.8	-36.1	179.8	-24.4	35.5	0	0	0	113	Q32 K33	P29-Q32 PolarHBondContact O-N 2.93Å; P29-K33 PolarHBondContact O-N 2.84Å
30	H	96.4	Very high	89.5	Confident	114 Å²	114	116.4 Å²	116.4	53%	0.528	58%	0.579	S	S	.	*	H	α-helix	trans	-66.8	-42.2	176.6	-63.5	-75	0	0	0	112	K27 V28 K33 H34	K27-H30 PolarHBondContact O-N 2.85Å; V28-H30 VanDerWaalsContact C-N 3.27Å; V28-H30 PolarHBondContact O-N 3.41Å; H30-K33 PolarHBondContact O-N 2.97Å; H30-H34 PolarHBondContact O-N 3.37Å; H30-H34 VanDerWaalsContact O-N 3.1Å
31	K	96.8	Very high	91.1	Very high	128 Å²	128	116.2 Å²	116.2	56%	0.557	57%	0.566	S	S	*	*	H	α-helix	trans	-68.2	-40.6	176.1	-67.6	-66.4	-174.5	177	0	111.6	K27 V28 K33 H34 F35	K27-K31 PolarHBondContact O-N 3.37Å; K27-K31 VanDerWaalsContact O-N 3.07Å; V28-K31 PolarHBondContact O-N 2.95Å; V28-K31 VanDerWaalsContact O-N 3.14Å; K31-K33 PolarHBondContact O-N 2.94Å; K31-H34 PolarHBondContact O-N 3.22Å; K31-F35 HydrophobicContact CD-CE2 4.35Å; K31-F35 WeakPolarHBondContact O-CD2 3.41Å; K31-F35 PolarHBondContact O-N 2.88Å
32	Q	98.3	Very high	92.9	Very high	99 Å²	99	107.8 Å²	107.8	46%	0.463	54%	0.543	S	S	.	.	H	α-helix	trans	-57.5	-48.5	173.6	-75.3	174.6	-33.7	0	0	111.1	V28 P29 H34 F35 Q36	V28-Q32 HydrophobicContact CG1-CG 4.1Å; V28-Q32 WeakPolarHBondContact O-CG 3.27Å; V28-Q32 PolarHBondContact O-N 3.43Å; P29-Q32 PolarHBondContact O-N 2.93Å; Q32-H34 VanDerWaalsContact C-N 3.32Å; Q32-H34 PolarHBondContact O-N 3.05Å; Q32-F35 PolarHBondContact O-N 3.48Å; Q32-Q36 WeakPolarHBondContact O-CB 3.32Å; Q32-Q36 WeakPolarHBondContact O-CG 3.45Å; Q32-Q36 PolarHBondContact O-N 3.43Å
33	K	97.9	Very high	94.6	Very high	171 Å²	171	105.4 Å²	105.4	74%	0.743	54%	0.542	S	S	*	.	H	α-helix	trans	-57.3	-44.5	176.4	-174.9	177.4	179.4	-179.3	0	112.3	P29 H30 K31 E37	P29-K33 PolarHBondContact O-N 2.84Å; H30-K33 PolarHBondContact O-N 2.97Å; K31-K33 PolarHBondContact O-N 2.94Å; K33-E37 PolarHBondContact O-N 2.92Å
34	H	97.5	Very high	95.8	Very high	77 Å²	77	101 Å²	101	36%	0.356	52%	0.521	S	S	.	.	H	α-helix	trans	-66.5	-49.5	-179.7	-178.8	59.3	0	0	0	112.8	H30 K31 Q32 Q36 E37 K46	H30-H34 PolarHBondContact O-N 3.37Å; H30-H34 VanDerWaalsContact O-N 3.1Å; K31-H34 PolarHBondContact O-N 3.22Å; Q32-H34 VanDerWaalsContact C-N 3.32Å; Q32-H34 PolarHBondContact O-N 3.05Å; H34-Q36 VanDerWaalsContact C-N 3.31Å; H34-Q36 PolarHBondContact O-N 3.34Å; H34-E37 WeakPolarHBondContact O-CB 3.2Å; H34-E37 PolarHBondContact O-N 3.49Å; H34-K46 PolarHBondContact NE2-O 3.42Å
35	F	97.9	Very high	96.5	Very high	78 Å²	78	98 Å²	98	34%	0.342	50%	0.501	S	S	.	.	H	α-helix	trans	-75.8	-17.9	-178.1	-77.7	-77.1	0	0	0	113.8	K31 Q32 I43 K46	K31-F35 HydrophobicContact CD-CE2 4.35Å; K31-F35 WeakPolarHBondContact O-CD2 3.41Å; K31-F35 PolarHBondContact O-N 2.88Å; Q32-F35 PolarHBondContact O-N 3.48Å; F35-I43 HydrophobicContact CD1-CD1 4.02Å; F35-K46 HydrophobicContact CD1-CB 3.89Å; F35-K46 HydrophobicContact CD1-CG 3.96Å; F35-K46 HydrophobicContact CE1-CB 4.1Å; F35-K46 VanDerWaalsContact O-CD 3.26Å; F35-K46 WeakPolarHBondContact O-CD 3.46Å; F35-K46 WeakPolarHBondContact O-CE 3.21Å; F35-K46 PolarHBondContact O-NZ 2.91Å
36	Q	98.3	Very high	97	Very high	144 Å²	144	93.7 Å²	93.7	67%	0.673	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.9	2	175.6	-62.7	174	14.5	0	0	113.4	Q32 H34 D38	Q32-Q36 WeakPolarHBondContact O-CB 3.32Å; Q32-Q36 WeakPolarHBondContact O-CG 3.45Å; Q32-Q36 PolarHBondContact O-N 3.43Å; H34-Q36 VanDerWaalsContact C-N 3.31Å; H34-Q36 PolarHBondContact O-N 3.34Å; Q36-D38 PolarHBondContact O-N 3.34Å
37	E	97.3	Very high	97.2	Very high	107 Å²	107	91.7 Å²	91.7	50%	0.5	48%	0.475	S	S	.	.			trans	-57.2	129.7	173.3	-174.5	174.9	-153.7	0	0	110.5	K33 H34 N39 K46	K33-E37 PolarHBondContact O-N 2.92Å; H34-E37 WeakPolarHBondContact O-CB 3.2Å; H34-E37 PolarHBondContact O-N 3.49Å; E37-N39 VanDerWaalsContact C-N 3.26Å; E37-N39 HydrophobicContact CG-CB 4.24Å; E37-N39 PolarHBondContact O-N 2.91Å; E37-N39 PolarHBondContact O-OD1 3.43Å; E37-N39 PolarHBondContact OE2-ND2 2.98Å; E37-K46 VanDerWaalsContact O-CE 3.27Å; E37-K46 WeakPolarHBondContact O-CE 3.27Å; E37-K46 PolarHBondContact O-NZ 2.95Å
38	D	97.3	Very high	97.4	Very high	161 Å²	161	88.6 Å²	88.6	86%	0.861	47%	0.471	S	S	*	.			trans	-84.5	69.7	-177.5	-168.9	19.1	0	0	0	111.1	Q36	Q36-D38 PolarHBondContact O-N 3.34Å
39	N	96.8	Very high	97.4	Very high	61 Å²	61	90 Å²	90	33%	0.326	48%	0.48	S	S	.	.	S	Bend	trans	-109.1	6.6	-177.3	56.2	18.1	0	0	0	113.1	E37 I41 K46	E37-N39 VanDerWaalsContact C-N 3.26Å; E37-N39 HydrophobicContact CG-CB 4.24Å; E37-N39 PolarHBondContact O-N 2.91Å; E37-N39 PolarHBondContact O-OD1 3.43Å; E37-N39 PolarHBondContact OE2-ND2 2.98Å; N39-I41 HydrophobicContact CB-CD1 4.37Å; N39-I41 HydrophobicContact CB-CG1 4.27Å; N39-I41 PolarHBondContact O-N 3.34Å; N39-I41 VanDerWaalsContact O-N 3.09Å; N39-I41 WeakPolarHBondContact OD1-CB 3.42Å; N39-I41 WeakPolarHBondContact OD1-CG1 3.38Å; N39-I41 PolarHBondContact OD1-N 2.72Å; N39-K46 WeakPolarHBondContact OD1-CE 3.45Å
40	G	97.3	Very high	97.5	Very high	72 Å²	72	90.4 Å²	90.4	74%	0.742	48%	0.484	S	S	*	.			trans	66.4	4.6	-178.7	0	0	0	0	0	115.4
41	I	97.5	Very high	97.6	Very high	71 Å²	71	87 Å²	87	36%	0.364	47%	0.47	S	S	.	.			trans	-74.7	130.8	-179.6	-57.7	177.2	0	0	0	109.2	N39 L45 K46	N39-I41 HydrophobicContact CB-CD1 4.37Å; N39-I41 HydrophobicContact CB-CG1 4.27Å; N39-I41 PolarHBondContact O-N 3.34Å; N39-I41 VanDerWaalsContact O-N 3.09Å; N39-I41 WeakPolarHBondContact OD1-CB 3.42Å; N39-I41 WeakPolarHBondContact OD1-CG1 3.38Å; N39-I41 PolarHBondContact OD1-N 2.72Å; I41-L45 HydrophobicContact CG2-CB 3.89Å; I41-K46 HydrophobicContact CG2-CB 4.35Å
42	P	97.4	Very high	97.6	Very high	62 Å²	62	82.4 Å²	82.4	40%	0.403	46%	0.456	S	S	.	.			trans	-65	148.6	177	28.4	-36.1	0	0	0	111.3	H44 L45 K46	P42-H44 PolarHBondContact O-N 3.31Å; P42-L45 HydrophobicContact CG-CB 4.3Å; P42-L45 HydrophobicContact CG-CD1 4.03Å; P42-L45 HydrophobicContact CG-CG 4.28Å; P42-L45 PolarHBondContact O-N 3.09Å; P42-K46 PolarHBondContact O-N 3.23Å
43	I	97.6	Very high	97.7	Very high	124 Å²	124	83 Å²	83	64%	0.636	46%	0.461	S	S	*	.	G	3₁₀ helix	trans	-55.5	-32.9	-171.2	-171.2	59	0	0	0	114.2	F35 L45 K46	F35-I43 HydrophobicContact CD1-CD1 4.02Å; I43-L45 VanDerWaalsContact C-N 3.27Å; I43-L45 PolarHBondContact O-N 3.22Å; I43-K46 HydrophobicContact CD1-CB 4.45Å; I43-K46 PolarHBondContact O-N 3.18Å
44	H	97.4	Very high	97.7	Very high	108 Å²	108	80.4 Å²	80.4	50%	0.5	46%	0.455	S	S	.	.	G	3₁₀ helix	trans	-78.1	-4.8	-179.5	65.3	-93.8	0	0	0	114.4	P42 D51	P42-H44 PolarHBondContact O-N 3.31Å; H44-D51 WeakPolarHBondContact O-CB 3.16Å
45	L	98.2	Very high	97.8	Very high	47 Å²	47	82.1 Å²	82.1	25%	0.246	46%	0.459	C	S	.	.	G	3₁₀ helix	trans	-118.3	0.6	171.6	-62.5	178	0	0	0	112.1	I41 P42 I43 G47 G48 D51 A52 Y55	I41-L45 HydrophobicContact CG2-CB 3.89Å; P42-L45 HydrophobicContact CG-CB 4.3Å; P42-L45 HydrophobicContact CG-CD1 4.03Å; P42-L45 HydrophobicContact CG-CG 4.28Å; P42-L45 PolarHBondContact O-N 3.09Å; I43-L45 VanDerWaalsContact C-N 3.27Å; I43-L45 PolarHBondContact O-N 3.22Å; L45-G47 VanDerWaalsContact C-N 3.27Å; L45-G47 PolarHBondContact O-N 2.93Å; L45-G48 PolarHBondContact O-N 3.38Å; L45-D51 HydrophobicContact CD2-CB 4.39Å; L45-A52 HydrophobicContact CD2-CB 4.43Å; L45-Y55 HydrophobicContact CD2-CG 4.37Å
46	K	98.1	Very high	97.8	Very high	29 Å²	29	87.2 Å²	87.2	13%	0.126	48%	0.476	C	S	.	.	T	Hydrogen-bonded Turn	trans	-75.3	-15.8	-166.9	-161.1	153.4	-166.9	178.9	0	113.6	H34 F35 E37 N39 I41 P42 I43	H34-K46 PolarHBondContact NE2-O 3.42Å; F35-K46 HydrophobicContact CD1-CB 3.89Å; F35-K46 HydrophobicContact CD1-CG 3.96Å; F35-K46 HydrophobicContact CE1-CB 4.1Å; F35-K46 VanDerWaalsContact O-CD 3.26Å; F35-K46 WeakPolarHBondContact O-CD 3.46Å; F35-K46 WeakPolarHBondContact O-CE 3.21Å; F35-K46 PolarHBondContact O-NZ 2.91Å; E37-K46 VanDerWaalsContact O-CE 3.27Å; E37-K46 WeakPolarHBondContact O-CE 3.27Å; E37-K46 PolarHBondContact O-NZ 2.95Å; N39-K46 WeakPolarHBondContact OD1-CE 3.45Å; I41-K46 HydrophobicContact CG2-CB 4.35Å; P42-K46 PolarHBondContact O-N 3.23Å; I43-K46 HydrophobicContact CD1-CB 4.45Å; I43-K46 PolarHBondContact O-N 3.18Å
47	G	96.5	Very high	97.8	Very high	24 Å²	24	83 Å²	83	25%	0.247	47%	0.465	C	S	.	.	T	Hydrogen-bonded Turn	trans	-77.1	-6.4	168.8	0	0	0	0	0	113.9	L45 D51	L45-G47 VanDerWaalsContact C-N 3.27Å; L45-G47 PolarHBondContact O-N 2.93Å; G47-D51 WeakPolarHBondContact CA-OD2 3.24Å; G47-D51 PolarHBondContact N-OD2 2.76Å
48	G	97	Very high	97.9	Very high	34 Å²	34	81.3 Å²	81.3	35%	0.351	46%	0.463	S	S	.	.			trans	97.9	-139.3	169.4	0	0	0	0	0	114.3	L45 S50 D51 A52	L45-G48 PolarHBondContact O-N 3.38Å; G48-S50 VanDerWaalsContact C-N 3.32Å; G48-S50 PolarHBondContact O-N 3.27Å; G48-D51 WeakPolarHBondContact O-CB 3Å; G48-D51 PolarHBondContact O-N 3.35Å; G48-D51 VanDerWaalsContact O-N 3.16Å; G48-A52 PolarHBondContact O-N 2.84Å
49	V	97.7	Very high	98	Very high	112 Å²	112	77.5 Å²	77.5	68%	0.679	44%	0.441	S	S	*	.	H	α-helix	trans	-63.2	-36.1	-168.8	177.8	0	0	0	0	112.5	D51 A52 I53	V49-D51 VanDerWaalsContact C-N 3.29Å; V49-D51 PolarHBondContact O-N 3.03Å; V49-A52 PolarHBondContact O-N 3.39Å; V49-I53 HydrophobicContact CG1-CD1 3.83Å; V49-I53 HydrophobicContact CG1-CG1 4.29Å; V49-I53 WeakPolarHBondContact O-CG1 3.26Å; V49-I53 PolarHBondContact O-N 3.32Å
50	S	98.1	Very high	98.1	Very high	75 Å²	75	77 Å²	77	52%	0.524	45%	0.445	S	S	.	.	H	α-helix	trans	-58.2	-44.2	176.3	51.7	0	0	0	0	111.8	G48 I53 L54	G48-S50 VanDerWaalsContact C-N 3.32Å; G48-S50 PolarHBondContact O-N 3.27Å; S50-I53 PolarHBondContact O-N 3.3Å; S50-L54 WeakPolarHBondContact O-CB 3.2Å; S50-L54 PolarHBondContact O-N 3.2Å
51	D	98.5	Very high	98.1	Very high	42 Å²	42	79.6 Å²	79.6	23%	0.225	44%	0.441	C	S	.	.	H	α-helix	trans	-67.4	-41.4	-178.1	-62.9	5.4	0	0	0	110.2	H44 L45 G47 G48 V49 L54 Y55	H44-D51 WeakPolarHBondContact O-CB 3.16Å; L45-D51 HydrophobicContact CD2-CB 4.39Å; G47-D51 WeakPolarHBondContact CA-OD2 3.24Å; G47-D51 PolarHBondContact N-OD2 2.76Å; G48-D51 WeakPolarHBondContact O-CB 3Å; G48-D51 PolarHBondContact O-N 3.35Å; G48-D51 VanDerWaalsContact O-N 3.16Å; V49-D51 VanDerWaalsContact C-N 3.29Å; V49-D51 PolarHBondContact O-N 3.03Å; D51-L54 PolarHBondContact O-N 3.05Å; D51-Y55 WeakPolarHBondContact O-CB 3.34Å; D51-Y55 PolarHBondContact O-N 3.44Å
52	A	98.2	Very high	98.2	Very high	32 Å²	32	79.8 Å²	79.8	26%	0.264	45%	0.446	S	S	.	.	H	α-helix	trans	-64.4	-41.6	177.1	0	0	0	0	0	112.8	L45 G48 V49 R56	L45-A52 HydrophobicContact CD2-CB 4.43Å; G48-A52 PolarHBondContact O-N 2.84Å; V49-A52 PolarHBondContact O-N 3.39Å; A52-R56 WeakPolarHBondContact O-CB 3.1Å; A52-R56 VanDerWaalsContact O-CG 3.24Å; A52-R56 WeakPolarHBondContact O-CG 3.37Å; A52-R56 PolarHBondContact O-N 2.96Å
53	I	98.7	Very high	98.3	Very high	112 Å²	112	81.8 Å²	81.8	57%	0.574	45%	0.452	S	S	*	.	H	α-helix	trans	-63.7	-48.9	175.6	-68.9	169.7	0	0	0	109.7	V49 S50 Y55 R56 A57	V49-I53 HydrophobicContact CG1-CD1 3.83Å; V49-I53 HydrophobicContact CG1-CG1 4.29Å; V49-I53 WeakPolarHBondContact O-CG1 3.26Å; V49-I53 PolarHBondContact O-N 3.32Å; S50-I53 PolarHBondContact O-N 3.3Å; I53-Y55 PolarHBondContact O-N 3.32Å; I53-R56 PolarHBondContact O-N 3.33Å; I53-A57 WeakPolarHBondContact O-CB 3.44Å; I53-A57 PolarHBondContact O-N 2.99Å
54	L	98.8	Very high	98.3	Very high	117 Å²	117	81.7 Å²	81.7	61%	0.613	45%	0.452	S	S	*	.	H	α-helix	trans	-60.5	-47.4	-179.3	-175.3	60.3	0	0	0	111	S50 D51 R56 A57 T58	S50-L54 WeakPolarHBondContact O-CB 3.2Å; S50-L54 PolarHBondContact O-N 3.2Å; D51-L54 PolarHBondContact O-N 3.05Å; L54-R56 PolarHBondContact O-N 3.47Å; L54-A57 PolarHBondContact O-N 3.07Å; L54-T58 PolarHBondContact O-N 3.31Å; L54-T58 PolarHBondContact O-OG1 3.4Å
55	Y	98.6	Very high	98.4	Very high	112 Å²	112	78.1 Å²	78.1	44%	0.439	44%	0.444	S	S	.	.	H	α-helix	trans	-56.4	-49.5	176.7	174.2	-100.1	0	0	0	112.4	L45 D51 I53 A57 T58 M59	L45-Y55 HydrophobicContact CD2-CG 4.37Å; D51-Y55 WeakPolarHBondContact O-CB 3.34Å; D51-Y55 PolarHBondContact O-N 3.44Å; I53-Y55 PolarHBondContact O-N 3.32Å; Y55-A57 PolarHBondContact O-N 2.94Å; Y55-T58 PolarHBondContact O-N 3.27Å; Y55-M59 HydrophobicContact CD1-SD 4.16Å; Y55-M59 HydrophobicContact CE1-CG 4.25Å; Y55-M59 HydrophobicContact CE1-SD 3.27Å; Y55-M59 WeakPolarHBondContact CE1-SD 3.38Å; Y55-M59 HydrophobicContact CE2-CG 4.4Å; Y55-M59 HydrophobicContact CE2-SD 4.19Å; Y55-M59 PolarHBondContact O-N 3.24Å; Y55-M59 PolarHBondContact OH-SD 3.44Å
56	R	98.6	Very high	98.4	Very high	185 Å²	185	79.3 Å²	79.3	70%	0.698	46%	0.456	S	S	*	.	H	α-helix	trans	-65.2	-40.6	-179.6	-72.1	172.9	-177.5	-124.2	1.5	112.1	A52 I53 L54 M59 A60	A52-R56 WeakPolarHBondContact O-CB 3.1Å; A52-R56 VanDerWaalsContact O-CG 3.24Å; A52-R56 WeakPolarHBondContact O-CG 3.37Å; A52-R56 PolarHBondContact O-N 2.96Å; I53-R56 PolarHBondContact O-N 3.33Å; L54-R56 PolarHBondContact O-N 3.47Å; R56-M59 PolarHBondContact O-N 3.25Å; R56-A60 WeakPolarHBondContact O-CB 3.47Å; R56-A60 PolarHBondContact O-N 3.37Å
57	A	98.8	Very high	98.4	Very high	55 Å²	55	80.6 Å²	80.6	46%	0.455	47%	0.473	S	S	.	.	H	α-helix	trans	-62.9	-44.9	176.2	0	0	0	0	0	111.3	I53 L54 Y55 A60 L61	I53-A57 WeakPolarHBondContact O-CB 3.44Å; I53-A57 PolarHBondContact O-N 2.99Å; L54-A57 PolarHBondContact O-N 3.07Å; Y55-A57 PolarHBondContact O-N 2.94Å; A57-A60 PolarHBondContact O-N 3.32Å; A57-L61 WeakPolarHBondContact O-CB 3.37Å; A57-L61 PolarHBondContact O-N 3.16Å
58	T	98.8	Very high	98.5	Very high	73 Å²	73	86.1 Å²	86.1	45%	0.448	49%	0.487	S	S	.	.	H	α-helix	trans	-64.3	-42.6	176.5	-56.3	0	0	0	0	111.9	L54 Y55 L61 T62	L54-T58 PolarHBondContact O-N 3.31Å; L54-T58 PolarHBondContact O-OG1 3.4Å; Y55-T58 PolarHBondContact O-N 3.27Å; T58-L61 PolarHBondContact O-N 3.41Å; T58-T62 HydrophobicContact CG2-CG2 4.42Å; T58-T62 WeakPolarHBondContact O-CB 3.36Å; T58-T62 WeakPolarHBondContact O-CG2 3.41Å; T58-T62 PolarHBondContact O-N 2.97Å; T58-T62 PolarHBondContact O-OG1 3.48Å
59	M	98.8	Very high	98.6	Very high	81 Å²	81	89 Å²	89	40%	0.399	50%	0.498	S	S	.	.	H	α-helix	trans	-58.9	-47.5	173.2	-95.4	-174.4	69.7	0	0	112	Y55 R56 L61 T62 I63	Y55-M59 HydrophobicContact CD1-SD 4.16Å; Y55-M59 HydrophobicContact CE1-CG 4.25Å; Y55-M59 HydrophobicContact CE1-SD 3.27Å; Y55-M59 WeakPolarHBondContact CE1-SD 3.38Å; Y55-M59 HydrophobicContact CE2-CG 4.4Å; Y55-M59 HydrophobicContact CE2-SD 4.19Å; Y55-M59 PolarHBondContact O-N 3.24Å; Y55-M59 PolarHBondContact OH-SD 3.44Å; R56-M59 PolarHBondContact O-N 3.25Å; M59-L61 PolarHBondContact O-N 3.1Å; M59-T62 WeakPolarHBondContact CA-OG1 3.43Å; M59-T62 PolarHBondContact O-N 2.98Å; M59-T62 PolarHBondContact O-OG1 2.92Å; M59-I63 HydrophobicContact CE-CD1 4.25Å; M59-I63 WeakPolarHBondContact O-CB 3.49Å; M59-I63 VanDerWaalsContact O-CG1 3.26Å; M59-I63 WeakPolarHBondContact O-CG1 3.36Å; M59-I63 PolarHBondContact O-N 2.84Å
60	A	98.8	Very high	98.7	Very high	49 Å²	49	88.8 Å²	88.8	41%	0.405	49%	0.491	S	S	.	.	H	α-helix	trans	-60.8	-47.4	179.6	0	0	0	0	0	111.1	R56 A57 T62 I63 L64	R56-A60 WeakPolarHBondContact O-CB 3.47Å; R56-A60 PolarHBondContact O-N 3.37Å; A57-A60 PolarHBondContact O-N 3.32Å; A60-T62 PolarHBondContact O-N 3.48Å; A60-I63 PolarHBondContact O-N 3.07Å; A60-L64 WeakPolarHBondContact O-CB 3.34Å; A60-L64 WeakPolarHBondContact O-CG 3.23Å; A60-L64 PolarHBondContact O-N 3.14Å
61	L	98.8	Very high	98.7	Very high	128 Å²	128	92 Å²	92	67%	0.67	49%	0.493	S	S	*	.	H	α-helix	trans	-60.7	-43.5	178.9	-178.6	63.2	0	0	0	112.2	A57 T58 M59 G65	A57-L61 WeakPolarHBondContact O-CB 3.37Å; A57-L61 PolarHBondContact O-N 3.16Å; T58-L61 PolarHBondContact O-N 3.41Å; M59-L61 PolarHBondContact O-N 3.1Å; L61-G65 PolarHBondContact O-N 3.02Å
62	T	98.8	Very high	98.6	Very high	75 Å²	75	93.7 Å²	93.7	46%	0.46	50%	0.5	S	S	.	.	H	α-helix	trans	-68.1	-44.4	-179.2	48.4	0	0	0	0	112	T58 M59 A60 G65 S66	T58-T62 HydrophobicContact CG2-CG2 4.42Å; T58-T62 WeakPolarHBondContact O-CB 3.36Å; T58-T62 WeakPolarHBondContact O-CG2 3.41Å; T58-T62 PolarHBondContact O-N 2.97Å; T58-T62 PolarHBondContact O-OG1 3.48Å; M59-T62 WeakPolarHBondContact CA-OG1 3.43Å; M59-T62 PolarHBondContact O-N 2.98Å; M59-T62 PolarHBondContact O-OG1 2.92Å; A60-T62 PolarHBondContact O-N 3.48Å; T62-G65 PolarHBondContact O-N 3.47Å; T62-S66 WeakPolarHBondContact O-CB 3.36Å; T62-S66 PolarHBondContact O-N 3.08Å; T62-S66 PolarHBondContact O-OG 2.95Å
63	I	98.8	Very high	98.6	Very high	103 Å²	103	97.7 Å²	97.7	53%	0.528	52%	0.516	S	S	.	.	H	α-helix	trans	-61.2	-48.8	176.4	-67.8	166.7	0	0	0	110.7	M59 A60 S66 A67	M59-I63 HydrophobicContact CE-CD1 4.25Å; M59-I63 WeakPolarHBondContact O-CB 3.49Å; M59-I63 VanDerWaalsContact O-CG1 3.26Å; M59-I63 WeakPolarHBondContact O-CG1 3.36Å; M59-I63 PolarHBondContact O-N 2.84Å; A60-I63 PolarHBondContact O-N 3.07Å; I63-S66 PolarHBondContact O-N 3.46Å; I63-A67 WeakPolarHBondContact O-CB 3.45Å; I63-A67 PolarHBondContact O-N 3.37Å
64	L	98.8	Very high	98.5	Very high	123 Å²	123	96 Å²	96	64%	0.644	51%	0.511	S	S	*	.	H	α-helix	trans	-63	-44.7	179	-69.3	173.5	0	0	0	111.6	A60 A67 Y68	A60-L64 WeakPolarHBondContact O-CB 3.34Å; A60-L64 WeakPolarHBondContact O-CG 3.23Å; A60-L64 PolarHBondContact O-N 3.14Å; L64-A67 PolarHBondContact O-N 3.45Å; L64-Y68 WeakPolarHBondContact O-CB 3.38Å; L64-Y68 PolarHBondContact O-N 3.08Å
65	G	98.8	Very high	98.4	Very high	32 Å²	32	92.3 Å²	92.3	33%	0.33	50%	0.495	S	S	.	.	H	α-helix	trans	-61.7	-45.4	177.6	0	0	0	0	0	112.4	L61 T62 Y68 V69	L61-G65 PolarHBondContact O-N 3.02Å; T62-G65 PolarHBondContact O-N 3.47Å; G65-Y68 PolarHBondContact O-N 2.94Å; G65-V69 WeakPolarHBondContact O-CG2 3.37Å; G65-V69 PolarHBondContact O-N 3.05Å
66	S	98.8	Very high	98.2	Very high	72 Å²	72	90.9 Å²	90.9	50%	0.503	51%	0.505	S	S	.	.	H	α-helix	trans	-63.1	-42.9	176.5	-64.3	0	0	0	0	112.2	T62 I63 Y68 V69 I70	T62-S66 WeakPolarHBondContact O-CB 3.36Å; T62-S66 PolarHBondContact O-N 3.08Å; T62-S66 PolarHBondContact O-OG 2.95Å; I63-S66 PolarHBondContact O-N 3.46Å; S66-Y68 VanDerWaalsContact C-N 3.32Å; S66-Y68 PolarHBondContact O-N 2.9Å; S66-V69 PolarHBondContact O-N 3.38Å; S66-I70 WeakPolarHBondContact O-CG1 3.47Å; S66-I70 PolarHBondContact O-N 3.34Å
67	A	98.8	Very high	98.1	Very high	57 Å²	57	85.3 Å²	85.3	47%	0.471	50%	0.499	S	S	.	.	H	α-helix	trans	-61.9	-41.7	175.8	0	0	0	0	0	111.7	I63 L64 I70 Y71	I63-A67 WeakPolarHBondContact O-CB 3.45Å; I63-A67 PolarHBondContact O-N 3.37Å; L64-A67 PolarHBondContact O-N 3.45Å; A67-I70 PolarHBondContact O-N 3.28Å; A67-Y71 PolarHBondContact O-N 3.39Å
68	Y	98.7	Very high	97.9	Very high	139 Å²	139	89.5 Å²	89.5	55%	0.545	51%	0.508	S	S	.	.	H	α-helix	trans	-64.5	-42.8	177.2	-176.7	-112.4	0	0	0	112.3	L64 G65 S66 I70 Y71 E72	L64-Y68 WeakPolarHBondContact O-CB 3.38Å; L64-Y68 PolarHBondContact O-N 3.08Å; G65-Y68 PolarHBondContact O-N 2.94Å; S66-Y68 VanDerWaalsContact C-N 3.32Å; S66-Y68 PolarHBondContact O-N 2.9Å; Y68-I70 VanDerWaalsContact C-N 3.32Å; Y68-I70 PolarHBondContact O-N 3.39Å; Y68-Y71 HydrophobicContact CD2-CD1 4.44Å; Y68-Y71 HydrophobicContact CE2-CD1 4.3Å; Y68-Y71 WeakPolarHBondContact O-CB 3.36Å; Y68-Y71 PolarHBondContact O-N 3.03Å; Y68-E72 HydrophobicContact CD1-CG 4.41Å; Y68-E72 HydrophobicContact CE1-CG 3.89Å; Y68-E72 HydrophobicContact CE2-CG 3.96Å; Y68-E72 WeakPolarHBondContact CE2-OE1 3.29Å; Y68-E72 VanDerWaalsContact CZ-OE1 3.3Å; Y68-E72 PolarHBondContact O-N 2.99Å; Y68-E72 PolarHBondContact OH-OE1 2.96Å
69	V	98.6	Very high	97.5	Very high	95 Å²	95	92 Å²	92	58%	0.576	53%	0.525	S	S	*	.	H	α-helix	trans	-60.8	-41.8	174.6	169	0	0	0	0	111.5	G65 S66 Y71 E72 L73	G65-V69 WeakPolarHBondContact O-CG2 3.37Å; G65-V69 PolarHBondContact O-N 3.05Å; S66-V69 PolarHBondContact O-N 3.38Å; V69-Y71 VanDerWaalsContact C-N 3.34Å; V69-E72 PolarHBondContact O-N 3.22Å; V69-L73 VanDerWaalsContact O-CB 3.25Å; V69-L73 WeakPolarHBondContact O-CB 3.17Å; V69-L73 PolarHBondContact O-N 3.27Å
70	I	98.6	Very high	96.9	Very high	107 Å²	107	96 Å²	96	55%	0.549	54%	0.54	S	S	.	.	H	α-helix	trans	-63.1	-43.1	176.2	-68.5	166.3	0	0	0	110.7	S66 A67 Y68 L73 V74	S66-I70 WeakPolarHBondContact O-CG1 3.47Å; S66-I70 PolarHBondContact O-N 3.34Å; A67-I70 PolarHBondContact O-N 3.28Å; Y68-I70 VanDerWaalsContact C-N 3.32Å; Y68-I70 PolarHBondContact O-N 3.39Å; I70-L73 PolarHBondContact O-N 2.9Å; I70-V74 WeakPolarHBondContact O-CG2 3.47Å; I70-V74 PolarHBondContact O-N 3.31Å
71	Y	97.8	Very high	95.9	Very high	142 Å²	142	103.6 Å²	103.6	56%	0.557	56%	0.564	S	S	*	*	H	α-helix	trans	-58.4	-52.3	176.2	169.9	-96.7	0	0	0	111.7	A67 Y68 V69 L73 V74 C75	A67-Y71 PolarHBondContact O-N 3.39Å; Y68-Y71 HydrophobicContact CD2-CD1 4.44Å; Y68-Y71 HydrophobicContact CE2-CD1 4.3Å; Y68-Y71 WeakPolarHBondContact O-CB 3.36Å; Y68-Y71 PolarHBondContact O-N 3.03Å; V69-Y71 VanDerWaalsContact C-N 3.34Å; Y71-L73 VanDerWaalsContact C-N 3.31Å; Y71-L73 PolarHBondContact O-N 3.23Å; Y71-V74 PolarHBondContact O-N 3.14Å; Y71-C75 VanDerWaalsContact CZ-SG 3.57Å; Y71-C75 PolarHBondContact O-N 2.68Å; Y71-C75 PolarHBondContact O-SG 3.45Å
72	E	97.6	Very high	94.5	Very high	79 Å²	79	107.2 Å²	107.2	37%	0.369	57%	0.574	S	S	.	*	H	α-helix	trans	-61.5	-39.8	178.5	-73.3	-63.7	155.9	0	0	111.8	Y68 V69 V74 C75 A76	Y68-E72 HydrophobicContact CD1-CG 4.41Å; Y68-E72 HydrophobicContact CE1-CG 3.89Å; Y68-E72 HydrophobicContact CE2-CG 3.96Å; Y68-E72 WeakPolarHBondContact CE2-OE1 3.29Å; Y68-E72 VanDerWaalsContact CZ-OE1 3.3Å; Y68-E72 PolarHBondContact O-N 2.99Å; Y68-E72 PolarHBondContact OH-OE1 2.96Å; V69-E72 PolarHBondContact O-N 3.22Å; E72-V74 VanDerWaalsContact C-N 3.35Å; E72-V74 PolarHBondContact O-N 3.24Å; E72-C75 PolarHBondContact O-N 3.12Å; E72-A76 VanDerWaalsContact O-CB 3.3Å; E72-A76 WeakPolarHBondContact O-CB 3.31Å; E72-A76 PolarHBondContact O-N 3.05Å
73	L	98.1	Very high	92.7	Very high	115 Å²	115	116.1 Å²	116.1	60%	0.602	61%	0.611	S	S	*	*	H	α-helix	trans	-60.1	-44.6	175.9	-179.7	64	0	0	0	111.4	V69 I70 Y71 A76 A77	V69-L73 VanDerWaalsContact O-CB 3.25Å; V69-L73 WeakPolarHBondContact O-CB 3.17Å; V69-L73 PolarHBondContact O-N 3.27Å; I70-L73 PolarHBondContact O-N 2.9Å; Y71-L73 VanDerWaalsContact C-N 3.31Å; Y71-L73 PolarHBondContact O-N 3.23Å; L73-A76 PolarHBondContact O-N 2.71Å; L73-A77 VanDerWaalsContact O-CB 3.23Å; L73-A77 WeakPolarHBondContact O-CB 3.46Å; L73-A77 PolarHBondContact O-N 3.47Å
74	V	97	Very high	92.4	Very high	77 Å²	77	116.8 Å²	116.8	47%	0.467	62%	0.615	S	S	.	*	H	α-helix	trans	-63.3	-45.8	175.7	170.9	0	0	0	0	110.6	I70 Y71 E72 A76 A77 F78	I70-V74 WeakPolarHBondContact O-CG2 3.47Å; I70-V74 PolarHBondContact O-N 3.31Å; Y71-V74 PolarHBondContact O-N 3.14Å; E72-V74 VanDerWaalsContact C-N 3.35Å; E72-V74 PolarHBondContact O-N 3.24Å; V74-A76 PolarHBondContact O-N 2.78Å; V74-A77 PolarHBondContact O-N 2.93Å; V74-F78 HydrophobicContact CG1-CD2 4.11Å; V74-F78 HydrophobicContact CG1-CE2 4.22Å; V74-F78 WeakPolarHBondContact O-CD2 3.33Å; V74-F78 PolarHBondContact O-N 2.98Å
75	C	95.5	Very high	92	Very high	40 Å²	40	116.4 Å²	116.4	27%	0.27	61%	0.613	S	S	.	*	H	α-helix	trans	-62.7	-29.7	177.4	-72.7	0	0	0	0	113.5	Y71 E72	Y71-C75 VanDerWaalsContact CZ-SG 3.57Å; Y71-C75 PolarHBondContact O-N 2.68Å; Y71-C75 PolarHBondContact O-SG 3.45Å; E72-C75 PolarHBondContact O-N 3.12Å
76	A	95.6	Very high	91.7	Very high	81 Å²	81	121.1 Å²	121.1	67%	0.669	63%	0.629	S	S	*	*	H	α-helix	trans	-82.8	-31.3	176.3	0	0	0	0	0	112.9	E72 L73 V74	E72-A76 VanDerWaalsContact O-CB 3.3Å; E72-A76 WeakPolarHBondContact O-CB 3.31Å; E72-A76 PolarHBondContact O-N 3.05Å; L73-A76 PolarHBondContact O-N 2.71Å; V74-A76 PolarHBondContact O-N 2.78Å
77	A	96.7	Very high	91.2	Very high	69 Å²	69	124 Å²	124	57%	0.57	64%	0.636	S	S	*	*	H	α-helix	trans	-73.7	-27.7	-176.7	0	0	0	0	0	113.6	L73 V74	L73-A77 VanDerWaalsContact O-CB 3.23Å; L73-A77 WeakPolarHBondContact O-CB 3.46Å; L73-A77 PolarHBondContact O-N 3.47Å; V74-A77 PolarHBondContact O-N 2.93Å
78	F	93.9	Very high	90.8	Very high	143 Å²	143	128.2 Å²	128.2	63%	0.627	65%	0.647	S	S	*	*	S	Bend	trans	-106.9	141.4	-178.9	-65.2	-75.7	0	0	0	112.3	V74 K80	V74-F78 HydrophobicContact CG1-CD2 4.11Å; V74-F78 HydrophobicContact CG1-CE2 4.22Å; V74-F78 WeakPolarHBondContact O-CD2 3.33Å; V74-F78 PolarHBondContact O-N 2.98Å; F78-K80 PolarHBondContact O-N 2.84Å
79	P	91	Very high	90.3	Very high	124 Å²	124	127.5 Å²	127.5	81%	0.805	65%	0.653	S	S	*	*	P	Polyproline II helix	trans	-63.5	129.1	178.2	26.4	-33.4	0	0	0	110.4
80	K	84.6	Confident	89.7	Confident	166 Å²	166	129.8 Å²	129.8	72%	0.722	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-72.8	133.3	173.1	-60.3	-177.1	-178.5	-177.4	0	108.3	F78 K82	F78-K80 PolarHBondContact O-N 2.84Å; K80-K82 PolarHBondContact O-N 3.08Å
81	K	78.5	Confident	89	Confident	209 Å²	209	131.5 Å²	131.5	91%	0.909	67%	0.667	S	S	*	*	P	Polyproline II helix	trans	-57.6	128.9	172	-70.3	-173.2	180	-176.1	0	107.8
82	K	70.5	Confident	88.2	Confident	203 Å²	203	130.7 Å²	130.7	88%	0.883	68%	0.676	S	S	*	*	P	Polyproline II helix	trans	-78.4	129.9	168.8	-64.1	-179.2	-179.8	-179	0	106.3	K80	K80-K82 PolarHBondContact O-N 3.08Å
83	E	59.9	Low	87.4	Confident	262 Å²	262	135.4 Å²	135.4	100%	1.224	70%	0.704	S	S	*	*			trans	-53.9	0	162.1	-59.7	-80	139.7	0	0	109.5

Retrieved 83 of 83 residues in 101.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).