A0A060X292_ONCMY Loading...

Eukaryotic translation initiation factor 1B

AlphaFold DB , UniProt , Accession A0A060X292, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene eif1b, Length 113 aa.

						>A0A060X292_ONCMY|A0A060X292|eif1b
MSSIQNLQSFDPFADATKGDDLLPAGTEDKIHIRIQQRNGRKTLTTVQGIAADYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLMEIGIVREEQLKVHGF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.3	Very low	62	Low	244 Å²	244	150.5 Å²	150.5	100%	1.202	81%	0.807	S	S	*	*				0	111.8	0	-70.8	-141.2	-134.8	0	0	107.6
2	S	56.3	Low	62.3	Low	124 Å²	124	145 Å²	145	87%	0.867	79%	0.786	S	S	*	*			trans	-77.7	121.1	-175.4	-49.3	0	0	0	0	109.9	I4	S2-I4 PolarHBondContact O-N 3.31Å
3	S	65.4	Low	61.9	Low	105 Å²	105	145.8 Å²	145.8	73%	0.734	78%	0.778	S	S	*	*			trans	-70.1	124.4	179.2	52.8	0	0	0	0	111.1	Q5	S3-Q5 PolarHBondContact O-N 2.69Å
4	I	65.7	Low	61.9	Low	147 Å²	147	138.9 Å²	138.9	75%	0.754	75%	0.751	S	S	*	*			trans	-72.5	113.3	176.9	-66.9	162.9	0	0	0	108.9	S2 N6	S2-I4 PolarHBondContact O-N 3.31Å; I4-N6 HydrophobicContact CG2-CB 4.22Å; I4-N6 PolarHBondContact O-N 3.28Å
5	Q	65.4	Low	61.4	Low	164 Å²	164	136.9 Å²	136.9	77%	0.766	74%	0.74	S	S	*	*	G	3₁₀ helix	trans	-72.7	-10.7	-176.1	-67.1	176.2	-18	0	0	114	S3 L7	S3-Q5 PolarHBondContact O-N 2.69Å; Q5-L7 PolarHBondContact O-N 3.27Å
6	N	63.3	Low	60.9	Low	156 Å²	156	133 Å²	133	83%	0.834	73%	0.732	S	S	*	*	G	3₁₀ helix	trans	-88.6	5.5	-170	-149.4	26.3	0	0	0	114.9	I4	I4-N6 HydrophobicContact CG2-CB 4.22Å; I4-N6 PolarHBondContact O-N 3.28Å
7	L	60	Low	60.4	Low	163 Å²	163	129.2 Å²	129.2	85%	0.853	71%	0.714	S	S	*	*	G	3₁₀ helix	trans	-107.8	26.8	172.7	-161.7	66.6	0	0	0	111.5	Q5 S9	Q5-L7 PolarHBondContact O-N 3.27Å; L7-S9 PolarHBondContact O-N 3.42Å
8	Q	64.2	Low	59.8	Low	165 Å²	165	130.3 Å²	130.3	77%	0.771	71%	0.71	S	S	*	*			trans	-72.2	107.9	161.7	-70.6	-178.8	-20.8	0	0	106.6	F10	Q8-F10 VanDerWaalsContact C-N 3.3Å; Q8-F10 PolarHBondContact O-N 3.49Å
9	S	65.9	Low	58.7	Low	118 Å²	118	126.8 Å²	126.8	83%	0.825	71%	0.707	S	S	*	*			trans	-59.5	95.4	171.1	51	0	0	0	0	108.2	L7 D11	L7-S9 PolarHBondContact O-N 3.42Å; S9-D11 PolarHBondContact O-N 3.34Å; S9-D11 VanDerWaalsContact O-N 3.09Å
10	F	63.6	Low	58	Low	176 Å²	176	127.9 Å²	127.9	77%	0.772	71%	0.712	S	S	*	*			trans	-68.8	104.1	175.4	-176.1	-99.8	0	0	0	107.6	Q8 P12	Q8-F10 VanDerWaalsContact C-N 3.3Å; Q8-F10 PolarHBondContact O-N 3.49Å; F10-P12 HydrophobicContact CE1-CB 4.47Å; F10-P12 VanDerWaalsContact O-CD 3.23Å; F10-P12 WeakPolarHBondContact O-CD 3.25Å
11	D	70.2	Confident	57.3	Low	93 Å²	93	128.3 Å²	128.3	50%	0.497	71%	0.713	S	S	.	*			trans	-85.3	106.5	174.2	-178	-2.6	0	0	0	109	S9 F13 A14	S9-D11 PolarHBondContact O-N 3.34Å; S9-D11 VanDerWaalsContact O-N 3.09Å; D11-F13 PolarHBondContact O-N 3.3Å; D11-F13 VanDerWaalsContact O-N 3.12Å; D11-F13 PolarHBondContact OD1-N 2.67Å; D11-A14 HydrophobicContact CB-CB 4.21Å; D11-A14 WeakPolarHBondContact O-CB 3.44Å; D11-A14 PolarHBondContact O-N 3.43Å; D11-A14 VanDerWaalsContact O-N 3.08Å
12	P	65.8	Low	57.3	Low	85 Å²	85	125.2 Å²	125.2	55%	0.552	70%	0.7	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.9	-9.5	-178.3	28	-34.2	0	0	0	113.7	F10	F10-P12 HydrophobicContact CE1-CB 4.47Å; F10-P12 VanDerWaalsContact O-CD 3.23Å; F10-P12 WeakPolarHBondContact O-CD 3.25Å
13	F	56.5	Low	56.7	Low	156 Å²	156	125 Å²	125	68%	0.684	69%	0.688	S	S	*	*	H	α-helix	trans	-92	-10.1	173.9	-68.2	-80.8	0	0	0	113.6	D11 D15	D11-F13 PolarHBondContact O-N 3.3Å; D11-F13 VanDerWaalsContact O-N 3.12Å; D11-F13 PolarHBondContact OD1-N 2.67Å; F13-D15 PolarHBondContact O-N 3.11Å
14	A	61.3	Low	55.6	Low	49 Å²	49	123.7 Å²	123.7	41%	0.405	68%	0.677	S	S	.	*	H	α-helix	trans	-69.9	-20.7	176.8	0	0	0	0	0	113.4	D11 T17	D11-A14 HydrophobicContact CB-CB 4.21Å; D11-A14 WeakPolarHBondContact O-CB 3.44Å; D11-A14 PolarHBondContact O-N 3.43Å; D11-A14 VanDerWaalsContact O-N 3.08Å; A14-T17 PolarHBondContact O-OG1 3.2Å
15	D	54.8	Low	54.6	Low	108 Å²	108	120.4 Å²	120.4	58%	0.578	67%	0.672	S	S	*	*	H	α-helix	trans	-95.5	-30.2	179.4	-127.4	-90.4	0	0	0	112.7	F13 T17 K18	F13-D15 PolarHBondContact O-N 3.11Å; D15-T17 PolarHBondContact O-N 3.24Å; D15-K18 PolarHBondContact O-N 3.37Å; D15-K18 VanDerWaalsContact O-N 3.11Å
16	A	53.5	Low	53.4	Low	75 Å²	75	114.5 Å²	114.5	62%	0.62	66%	0.656	S	S	*	*	H	α-helix	trans	-68.5	-17.9	178	0	0	0	0	0	113.7	K18	A16-K18 VanDerWaalsContact C-N 3.26Å; A16-K18 PolarHBondContact O-N 3.48Å
17	T	51.8	Low	52.5	Low	68 Å²	68	113.2 Å²	113.2	42%	0.417	65%	0.654	S	S	.	*	T	Hydrogen-bonded Turn	trans	-80.6	-3.6	174.1	43.3	0	0	0	0	113.7	A14 D15 A25	A14-T17 PolarHBondContact O-OG1 3.2Å; D15-T17 PolarHBondContact O-N 3.24Å; T17-A25 HydrophobicContact CG2-CB 3.33Å
18	K	51.1	Low	52.2	Low	149 Å²	149	112.2 Å²	112.2	65%	0.648	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.5	-3.4	-179.8	-62.9	178.5	-176.8	169	0	113.9	D15 A16	D15-K18 PolarHBondContact O-N 3.37Å; D15-K18 VanDerWaalsContact O-N 3.11Å; A16-K18 VanDerWaalsContact C-N 3.26Å; A16-K18 PolarHBondContact O-N 3.48Å
19	G	38.9	Very low	52.3	Low	64 Å²	64	108.7 Å²	108.7	66%	0.66	63%	0.631	S	S	*	*	S	Bend	trans	-105.4	-3.8	-159.1	0	0	0	0	0	118.9
20	D	43	Very low	53	Low	149 Å²	149	107.8 Å²	107.8	80%	0.797	61%	0.613	S	S	*	*	S	Bend	trans	-135.6	-3.5	-177.5	-160.6	60.9	0	0	0	115.9
21	D	44.6	Very low	54.1	Low	137 Å²	137	100.1 Å²	100.1	73%	0.733	58%	0.579	S	S	*	*	S	Bend	trans	-155	142.3	166.9	-95.8	-55.2	0	0	0	107.9	L23	D21-L23 PolarHBondContact O-N 2.93Å
22	L	42.3	Very low	55	Low	178 Å²	178	97.6 Å²	97.6	93%	0.932	57%	0.565	S	S	*	*	S	Bend	trans	-63.2	22.2	-173.3	-93.4	154.9	0	0	0	116.1
23	L	43	Very low	56.2	Low	119 Å²	119	93.6 Å²	93.6	62%	0.623	54%	0.539	S	S	*	.	S	Bend	trans	-143.5	137.8	178.8	-64.9	171.4	0	0	0	109.8	D21	D21-L23 PolarHBondContact O-N 2.93Å
24	P	42	Very low	57.8	Low	78 Å²	78	90.2 Å²	90.2	51%	0.506	52%	0.521	S	S	.	.			trans	-58.1	146.6	-175.8	26.5	-34.3	0	0	0	110.8	G26	P24-G26 PolarHBondContact O-N 3.17Å
25	A	45.6	Very low	59.3	Low	78 Å²	78	88.8 Å²	88.8	65%	0.645	51%	0.506	S	S	*	.	S	Bend	trans	-62.3	81.5	168	0	0	0	0	0	110.3	T17	T17-A25 HydrophobicContact CG2-CB 3.33Å
26	G	39.4	Very low	61	Low	41 Å²	41	89.3 Å²	89.3	42%	0.423	51%	0.506	S	S	.	.	S	Bend	trans	-148.9	146.9	178.1	0	0	0	0	0	106.6	P24 E28	P24-G26 PolarHBondContact O-N 3.17Å; G26-E28 PolarHBondContact O-N 3.13Å
27	T	45.7	Very low	62.8	Low	129 Å²	129	91.2 Å²	91.2	79%	0.791	50%	0.502	S	S	*	.	S	Bend	trans	-67	49.2	179.6	46.5	0	0	0	0	113.8
28	E	53.3	Low	64.6	Low	141 Å²	141	96.1 Å²	96.1	66%	0.659	51%	0.512	S	S	*	.			trans	-107.4	-6.4	-151.4	-64.2	-168.6	128.5	0	0	118.1	G26	G26-E28 PolarHBondContact O-N 3.13Å
29	D	66.5	Low	66.4	Low	92 Å²	92	94.9 Å²	94.9	49%	0.492	51%	0.513	S	S	.	.	S	Bend	trans	-129.6	33.5	173.7	-74.6	-56.2	0	0	0	113.9
30	K	80.6	Confident	68.7	Low	99 Å²	99	94 Å²	94	43%	0.43	50%	0.504	S	S	.	.			trans	-102.4	124.9	175.3	-69.5	175.5	-175.3	164	0	110.3	H32 Q107 K109	K30-H32 PolarHBondContact O-CD2 3.31Å; K30-H32 PolarHBondContact O-N 2.88Å; K30-Q107 CarbonylContact C-O 3.48Å; K30-Q107 VanDerWaalsContact CA-O 3.25Å; K30-Q107 WeakPolarHBondContact CA-O 3.46Å; K30-K109 HydrophobicContact CB-CG 4.47Å; K30-K109 HydrophobicContact CD-CG 4.35Å
31	I	87	Confident	70.7	Confident	14 Å²	14	98.9 Å²	98.9	7%	0.072	51%	0.511	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.5	115.4	173.5	-72.6	165.3	0	0	0	108.3	V47 Q48 G49 I50 L97 V103 Q107 K109	I31-V47 HydrophobicContact CG2-CG1 3.67Å; I31-Q48 WeakPolarHBondContact CA-O 3.39Å; I31-G49 VanDerWaalsContact CG1-O 3.27Å; I31-G49 WeakPolarHBondContact CG1-O 3.26Å; I31-I50 HydrophobicContact CD1-CG1 4.38Å; I31-L97 HydrophobicContact CG2-CD1 4.17Å; I31-V103 HydrophobicContact CD1-CB 4.18Å; I31-V103 HydrophobicContact CD1-CG1 3.8Å; I31-V103 HydrophobicContact CD1-CG2 3.23Å; I31-Q107 PolarHBondContact N-O 2.78Å; I31-K109 PolarHBondContact O-N 2.88Å
32	H	88.4	Confident	72.9	Confident	41 Å²	41	99.4 Å²	99.4	19%	0.19	51%	0.507	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	117.6	-179.9	-64.6	-70.7	0	0	0	110	K30 V47 Q48 K109 H111	K30-H32 PolarHBondContact O-CD2 3.31Å; K30-H32 PolarHBondContact O-N 2.88Å; H32-V47 WeakPolarHBondContact O-CA 3.39Å; H32-Q48 HydrophobicContact CB-CB 4.23Å; H32-Q48 PolarHBondContact N-O 2.9Å; H32-Q48 PolarHBondContact O-N 3.24Å; H32-K109 WeakPolarHBondContact CA-O 3.5Å; H32-K109 WeakPolarHBondContact ND1-CB 3.44Å; H32-H111 AromaticContact CE1-NE2 3.76Å; H32-H111 AromaticContact CG-NE2 3.71Å; H32-H111 AromaticContact ND1-CD2 3.72Å; H32-H111 AromaticContact ND1-CE1 3.98Å; H32-H111 AromaticContact ND1-NE2 2.92Å; H32-H111 PolarHBondContact ND1-NE2 3.02Å
33	I	91.3	Very high	75.3	Confident	1 Å²	1	92.3 Å²	92.3	1%	0.005	47%	0.471	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	110.2	170.9	-56.1	176.3	0	0	0	106.9	T45 T46 V47 R90 I93 L97 L108 K109 V110 H111	I33-T45 HydrophobicContact CG2-CG2 3.63Å; I33-T46 WeakPolarHBondContact CA-O 3.49Å; I33-V47 HydrophobicContact CG1-CG1 4.47Å; I33-R90 HydrophobicContact CG2-CB 4.27Å; I33-I93 HydrophobicContact CD1-CB 4.11Å; I33-I93 HydrophobicContact CD1-CG2 3.59Å; I33-I93 HydrophobicContact CG1-CG2 4.27Å; I33-L97 HydrophobicContact CD1-CD1 4.41Å; I33-L108 HydrophobicContact CD1-CD1 4.1Å; I33-L108 HydrophobicContact CD1-CD2 3.93Å; I33-L108 HydrophobicContact CD1-CG 4.14Å; I33-K109 PolarHBondContact N-O 2.71Å; I33-V110 HydrophobicContact CD1-CG2 4.47Å; I33-H111 PolarHBondContact O-N 2.75Å
34	R	90.5	Very high	77.6	Confident	84 Å²	84	88.5 Å²	88.5	32%	0.317	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	144.8	178.9	-53.9	178.7	-179.1	-89.2	2.4	110.2	T45 T46 H111	R34-T45 CarbonylContact O-C 3.46Å; R34-T45 WeakPolarHBondContact O-CA 3.47Å; R34-T46 PolarHBondContact N-O 2.84Å; R34-T46 PolarHBondContact O-N 3.09Å; R34-T46 PolarHBondContact O-OG1 2.79Å; R34-H111 HydrophobicContact CB-CB 4.44Å; R34-H111 HydrophobicContact CG-CB 4.02Å
35	I	92.8	Very high	80	Confident	19 Å²	19	84.8 Å²	84.8	10%	0.097	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	134.7	172.5	-170.3	167.8	0	0	0	110.3	T43 L44 D88 H111 F113	I35-T43 HydrophobicContact CD1-CG2 4.02Å; I35-T43 HydrophobicContact CG1-CG2 4.27Å; I35-L44 CarbonylContact C-O 3.57Å; I35-L44 WeakPolarHBondContact CA-O 3.35Å; I35-D88 HydrophobicContact CD1-CB 3.63Å; I35-H111 PolarHBondContact N-O 2.67Å; I35-F113 HydrophobicContact CG2-CD2 4.24Å
36	Q	90.3	Very high	82.2	Confident	120 Å²	120	81.7 Å²	81.7	56%	0.561	40%	0.4	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.1	135.5	175.8	-62.4	-69.5	72.3	0	0	109.1	T43 L44	Q36-T43 CarbonylContact O-C 3.6Å; Q36-T43 VanDerWaalsContact O-CA 3.26Å; Q36-T43 WeakPolarHBondContact O-CA 3.39Å; Q36-L44 PolarHBondContact N-O 2.91Å; Q36-L44 PolarHBondContact O-N 3.45Å
37	Q	91.4	Very high	84.6	Confident	115 Å²	115	79.8 Å²	79.8	54%	0.537	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.5	121.7	174.5	-163.8	173.7	34.1	0	0	109.5	G40 T43 F113	Q37-G40 WeakPolarHBondContact CG-O 3.43Å; Q37-G40 PolarHBondContact NE2-O 2.94Å; Q37-T43 HydrophobicContact CG-CG2 4.48Å; Q37-F113 HydrophobicContact CB-CE2 4.09Å; Q37-F113 HydrophobicContact CB-CZ 4.34Å
38	R	89.5	Confident	86.7	Confident	170 Å²	170	74.5 Å²	74.5	64%	0.642	35%	0.347	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.7	-49	178.6	-176.3	-178.7	176.1	-177.2	-0.2	111.5	K42 L44	R38-K42 HydrophobicContact CB-CB 4.46Å; R38-K42 PolarHBondContact N-O 3.45Å; R38-L44 HydrophobicContact CB-CD1 4.13Å; R38-L44 HydrophobicContact CB-CG 4.16Å; R38-L44 HydrophobicContact CG-CD1 4.35Å
39	N	88.1	Confident	88.1	Confident	123 Å²	123	70 Å²	70	66%	0.658	34%	0.337	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-162	116	178.5	-172.5	-7.7	0	0	0	110.1	R41 K42	N39-R41 PolarHBondContact O-N 3.49Å; N39-K42 PolarHBondContact N-O 3.37Å; N39-K42 WeakPolarHBondContact O-CB 3.18Å; N39-K42 PolarHBondContact O-N 3.12Å
40	G	86.4	Confident	88.9	Confident	46 Å²	46	66.2 Å²	66.2	47%	0.474	32%	0.317	S	S	.	.	T	Hydrogen-bonded Turn	trans	47	-105	177.8	0	0	0	0	0	111.9	Q37	Q37-G40 WeakPolarHBondContact CG-O 3.43Å; Q37-G40 PolarHBondContact NE2-O 2.94Å
41	R	86	Confident	88.8	Confident	251 Å²	251	63.5 Å²	63.5	95%	0.947	31%	0.313	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82	-10.1	-179.3	-59.2	-177.4	-176.6	-178.6	0.5	115.2	N39	N39-R41 PolarHBondContact O-N 3.49Å
42	K	91.1	Very high	88.1	Confident	149 Å²	149	66.6 Å²	66.6	65%	0.648	34%	0.341	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.6	125.3	-179.1	-62.7	-169.7	179.9	-176.4	0	110.2	R38 N39	R38-K42 HydrophobicContact CB-CB 4.46Å; R38-K42 PolarHBondContact N-O 3.45Å; N39-K42 PolarHBondContact N-O 3.37Å; N39-K42 WeakPolarHBondContact O-CB 3.18Å; N39-K42 PolarHBondContact O-N 3.12Å
43	T	92.4	Very high	87.7	Confident	28 Å²	28	72.1 Å²	72.1	17%	0.172	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	161.5	175.2	55.6	0	0	0	0	111.3	I35 Q36 Q37 G87 D88	I35-T43 HydrophobicContact CD1-CG2 4.02Å; I35-T43 HydrophobicContact CG1-CG2 4.27Å; Q36-T43 CarbonylContact O-C 3.6Å; Q36-T43 VanDerWaalsContact O-CA 3.26Å; Q36-T43 WeakPolarHBondContact O-CA 3.39Å; Q37-T43 HydrophobicContact CG-CG2 4.48Å; T43-G87 WeakPolarHBondContact O-CA 3.43Å; T43-G87 PolarHBondContact O-N 3.11Å; T43-G87 WeakPolarHBondContact OG1-CA 3.4Å; T43-D88 PolarHBondContact OG1-N 2.95Å
44	L	91.8	Very high	87.2	Confident	39 Å²	39	77.4 Å²	77.4	20%	0.204	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.1	128.4	173.1	-67.3	171.2	0	0	0	106.9	I35 Q36 R38 L85 Q86	I35-L44 CarbonylContact C-O 3.57Å; I35-L44 WeakPolarHBondContact CA-O 3.35Å; Q36-L44 PolarHBondContact N-O 2.91Å; Q36-L44 PolarHBondContact O-N 3.45Å; R38-L44 HydrophobicContact CB-CD1 4.13Å; R38-L44 HydrophobicContact CB-CG 4.16Å; R38-L44 HydrophobicContact CG-CD1 4.35Å; L44-L85 CarbonylContact C-O 3.58Å; L44-L85 WeakPolarHBondContact CA-O 3.25Å; L44-Q86 HydrophobicContact CD2-CG 4.3Å
45	T	92.7	Very high	86.9	Confident	0 Å²	0	78 Å²	78	0%	0	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	127.4	172.1	-56.3	0	0	0	0	108.2	I33 R34 Q84 L85 G87 Q89 I93	I33-T45 HydrophobicContact CG2-CG2 3.63Å; R34-T45 CarbonylContact O-C 3.46Å; R34-T45 WeakPolarHBondContact O-CA 3.47Å; T45-Q84 WeakPolarHBondContact O-CA 3.34Å; T45-L85 PolarHBondContact N-O 2.89Å; T45-L85 PolarHBondContact O-N 2.86Å; T45-G87 PolarHBondContact OG1-O 2.92Å; T45-Q89 PolarHBondContact OG1-N 3.2Å; T45-Q89 VanDerWaalsContact OG1-N 3.15Å; T45-I93 HydrophobicContact CG2-CD1 3.53Å
46	T	91.1	Very high	86.4	Confident	14 Å²	14	78 Å²	78	9%	0.086	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	133.8	177.2	63.1	0	0	0	0	109.6	I33 R34 I83 Q84	I33-T46 WeakPolarHBondContact CA-O 3.49Å; R34-T46 PolarHBondContact N-O 2.84Å; R34-T46 PolarHBondContact O-N 3.09Å; R34-T46 PolarHBondContact O-OG1 2.79Å; T46-I83 CarbonylContact C-O 3.56Å; T46-I83 WeakPolarHBondContact CA-O 3.48Å; T46-Q84 HydrophobicContact CG2-CG 3.96Å
47	V	89.7	Confident	86.3	Confident	1 Å²	1	80.3 Å²	80.3	1%	0.006	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	118.1	175.2	-171.6	0	0	0	0	107.5	I31 H32 I33 I50 I83 I93	I31-V47 HydrophobicContact CG2-CG1 3.67Å; H32-V47 WeakPolarHBondContact O-CA 3.39Å; I33-V47 HydrophobicContact CG1-CG1 4.47Å; V47-I50 HydrophobicContact CG1-CD1 3.99Å; V47-I50 HydrophobicContact CG1-CG1 4.07Å; V47-I83 HydrophobicContact CB-CB 4.43Å; V47-I83 PolarHBondContact N-O 2.98Å; V47-I83 PolarHBondContact O-N 2.86Å; V47-I83 VanDerWaalsContact O-N 3.07Å; V47-I93 HydrophobicContact CG2-CD1 3.94Å; V47-I93 HydrophobicContact CG2-CG2 3.94Å
48	Q	88.9	Confident	86.1	Confident	18 Å²	18	81.3 Å²	81.3	8%	0.084	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	153.7	-179.5	-51.3	176.6	-19.8	0	0	109.4	I31 H32 V82	I31-Q48 WeakPolarHBondContact CA-O 3.39Å; H32-Q48 HydrophobicContact CB-CB 4.23Å; H32-Q48 PolarHBondContact N-O 2.9Å; H32-Q48 PolarHBondContact O-N 3.24Å; Q48-V82 HydrophobicContact CB-CG1 4.39Å; Q48-V82 HydrophobicContact CG-CG1 3.89Å
49	G	83.6	Confident	86.1	Confident	45 Å²	45	74.1 Å²	74.1	46%	0.464	39%	0.386	S	S	.	.			trans	83.1	20.5	175	0	0	0	0	0	115	I31	I31-G49 VanDerWaalsContact CG1-O 3.27Å; I31-G49 WeakPolarHBondContact CG1-O 3.26Å
50	I	82.8	Confident	86.1	Confident	14 Å²	14	68.6 Å²	68.6	7%	0.072	36%	0.357	C	S	.	.			trans	-79.8	123.4	169.4	-62.4	-159.5	0	0	0	109	I31 V47 K56 L59 I83	I31-I50 HydrophobicContact CD1-CG1 4.38Å; V47-I50 HydrophobicContact CG1-CD1 3.99Å; V47-I50 HydrophobicContact CG1-CG1 4.07Å; I50-K56 HydrophobicContact CG2-CG 4.29Å; I50-K56 WeakPolarHBondContact O-CE 3.23Å; I50-L59 HydrophobicContact CD1-CD2 3.45Å; I50-L59 VanDerWaalsContact CD1-CD2 3.45Å; I50-I83 HydrophobicContact CD1-CD1 4.06Å
51	A	78.8	Confident	86.4	Confident	42 Å²	42	73.8 Å²	73.8	35%	0.347	37%	0.367	S	S	.	.			trans	-53.7	142.9	178.5	0	0	0	0	0	111.8	D53 Y54	A51-D53 PolarHBondContact O-N 3.08Å; A51-Y54 HydrophobicContact CB-CD2 4.01Å; A51-Y54 HydrophobicContact CB-CE2 4.32Å; A51-Y54 PolarHBondContact O-N 3.12Å
52	A	73.5	Confident	86.6	Confident	79 Å²	79	63.6 Å²	63.6	65%	0.653	34%	0.336	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66	-21.9	-177.6	0	0	0	0	0	113.2	Y54	A52-Y54 PolarHBondContact O-N 2.99Å
53	D	78.8	Confident	86.5	Confident	156 Å²	156	56.5 Å²	56.5	83%	0.834	31%	0.305	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.8	-21.9	178.7	-54.8	-51	0	0	0	112.9	A51	A51-D53 PolarHBondContact O-N 3.08Å
54	Y	80.1	Confident	86.4	Confident	113 Å²	113	59.1 Å²	59.1	44%	0.443	31%	0.314	S	S	.	.	S	Bend	trans	-82.1	136.7	176.1	-71.1	-75.5	0	0	0	111.7	A51 A52 K56 I102	A51-Y54 HydrophobicContact CB-CD2 4.01Å; A51-Y54 HydrophobicContact CB-CE2 4.32Å; A51-Y54 PolarHBondContact O-N 3.12Å; A52-Y54 PolarHBondContact O-N 2.99Å; Y54-K56 VanDerWaalsContact C-N 3.31Å; Y54-K56 PolarHBondContact O-N 3.47Å; Y54-I102 HydrophobicContact CD2-CG2 4.37Å; Y54-I102 HydrophobicContact CE1-CG1 4.24Å; Y54-I102 HydrophobicContact CE1-CG2 4.15Å; Y54-I102 HydrophobicContact CE2-CG2 3.91Å
55	D	84.1	Confident	86.3	Confident	95 Å²	95	66.5 Å²	66.5	51%	0.508	34%	0.344	S	S	.	.			trans	-66.3	83.7	172.7	-85.8	-48.6	0	0	0	111.8	K57 K58 L59	D55-K57 PolarHBondContact O-N 3.18Å; D55-K57 VanDerWaalsContact O-N 3.13Å; D55-K58 HydrophobicContact CB-CB 3.93Å; D55-K58 HydrophobicContact CB-CD 3.75Å; D55-K58 HydrophobicContact CB-CG 3.87Å; D55-K58 WeakPolarHBondContact O-CB 3.46Å; D55-K58 PolarHBondContact O-N 3.45Å; D55-K58 WeakPolarHBondContact OD2-CD 3.41Å; D55-K58 VanDerWaalsContact OD2-CE 3.25Å; D55-K58 WeakPolarHBondContact OD2-CE 2.87Å; D55-K58 IonicContact OD2-NZ 2.69Å; D55-K58 PolarHBondContact OD2-NZ 2.77Å; D55-L59 PolarHBondContact O-N 2.77Å
56	K	84.3	Confident	86.1	Confident	19 Å²	19	71.3 Å²	71.3	8%	0.083	37%	0.365	C	S	.	.	H	α-helix	trans	-54.8	-34.4	178.4	-68.8	161.5	-167.8	174	0	112.2	I50 Y54 K58 L59 V60 V73 E81 I83	I50-K56 HydrophobicContact CG2-CG 4.29Å; I50-K56 WeakPolarHBondContact O-CE 3.23Å; Y54-K56 VanDerWaalsContact C-N 3.31Å; Y54-K56 PolarHBondContact O-N 3.47Å; K56-K58 PolarHBondContact O-N 3.33Å; K56-L59 PolarHBondContact O-N 2.84Å; K56-V60 WeakPolarHBondContact O-CG2 3.37Å; K56-V60 PolarHBondContact O-N 3.39Å; K56-V73 HydrophobicContact CB-CG1 4.45Å; K56-V73 HydrophobicContact CB-CG2 4.04Å; K56-E81 HydrophobicContact CD-CB 4.04Å; K56-E81 WeakPolarHBondContact CD-OE2 3.12Å; K56-E81 WeakPolarHBondContact CE-OE2 3.5Å; K56-E81 VanDerWaalsContact NZ-CB 3.31Å; K56-E81 IonicContact NZ-OE2 2.91Å; K56-E81 PolarHBondContact NZ-OE2 2.82Å; K56-I83 HydrophobicContact CB-CD1 4.38Å; K56-I83 HydrophobicContact CG-CD1 4.47Å
57	K	86.5	Confident	85.9	Confident	169 Å²	169	71.8 Å²	71.8	74%	0.735	37%	0.366	S	S	*	.	H	α-helix	trans	-63.5	-39	175.1	-69.6	179.5	-177.6	170.8	0	112.8	D55 K61	D55-K57 PolarHBondContact O-N 3.18Å; D55-K57 VanDerWaalsContact O-N 3.13Å; K57-K61 WeakPolarHBondContact O-CG 3.27Å; K57-K61 PolarHBondContact O-N 3.47Å; K57-K61 VanDerWaalsContact O-N 3.17Å
58	K	88.7	Confident	85.9	Confident	136 Å²	136	76.3 Å²	76.3	59%	0.591	40%	0.404	S	S	*	.	H	α-helix	trans	-71.3	-40.3	175.5	-69.1	179.1	-174.2	156.1	0	110.4	D55 K56 V60 K61 A62	D55-K58 HydrophobicContact CB-CB 3.93Å; D55-K58 HydrophobicContact CB-CD 3.75Å; D55-K58 HydrophobicContact CB-CG 3.87Å; D55-K58 WeakPolarHBondContact O-CB 3.46Å; D55-K58 PolarHBondContact O-N 3.45Å; D55-K58 WeakPolarHBondContact OD2-CD 3.41Å; D55-K58 VanDerWaalsContact OD2-CE 3.25Å; D55-K58 WeakPolarHBondContact OD2-CE 2.87Å; D55-K58 IonicContact OD2-NZ 2.69Å; D55-K58 PolarHBondContact OD2-NZ 2.77Å; K56-K58 PolarHBondContact O-N 3.33Å; K58-V60 PolarHBondContact O-N 3.07Å; K58-K61 WeakPolarHBondContact O-CB 3.36Å; K58-K61 PolarHBondContact O-N 3.21Å; K58-A62 PolarHBondContact O-N 3.17Å
59	L	87.8	Confident	85.9	Confident	20 Å²	20	76.8 Å²	76.8	11%	0.105	41%	0.409	C	S	.	.	H	α-helix	trans	-59.4	-46.9	175.9	-154.3	81.8	0	0	0	111.4	I50 D55 K56 K61 A62 F63 I83 F96 I100 I102	I50-L59 HydrophobicContact CD1-CD2 3.45Å; I50-L59 VanDerWaalsContact CD1-CD2 3.45Å; D55-L59 PolarHBondContact O-N 2.77Å; K56-L59 PolarHBondContact O-N 2.84Å; L59-K61 VanDerWaalsContact C-N 3.33Å; L59-K61 PolarHBondContact O-N 3.38Å; L59-A62 WeakPolarHBondContact O-CB 3.38Å; L59-A62 PolarHBondContact O-N 3.42Å; L59-A62 VanDerWaalsContact O-N 3.12Å; L59-F63 HydrophobicContact CB-CE2 4.41Å; L59-F63 HydrophobicContact CD2-CD2 4.41Å; L59-F63 HydrophobicContact CD2-CE2 3.41Å; L59-F63 VanDerWaalsContact CD2-CE2 3.41Å; L59-F63 HydrophobicContact CD2-CZ 3.59Å; L59-F63 HydrophobicContact CG-CD2 4.21Å; L59-F63 HydrophobicContact CG-CE1 4.49Å; L59-F63 HydrophobicContact CG-CE2 3.59Å; L59-F63 HydrophobicContact CG-CZ 3.76Å; L59-F63 VanDerWaalsContact O-CD2 3.32Å; L59-F63 WeakPolarHBondContact O-CD2 3.27Å; L59-F63 VanDerWaalsContact O-CG 3.29Å; L59-F63 WeakPolarHBondContact O-CG 3.49Å; L59-F63 PolarHBondContact O-N 3.48Å; L59-I83 HydrophobicContact CB-CD1 4.41Å; L59-I83 HydrophobicContact CD2-CD1 3.65Å; L59-F96 HydrophobicContact CD1-CE1 4.34Å; L59-I100 HydrophobicContact CD1-CD1 4.33Å; L59-I102 HydrophobicContact CD1-CD1 3.88Å
60	V	90	Very high	86.3	Confident	7 Å²	7	78.8 Å²	78.8	4%	0.042	41%	0.409	C	S	.	.	H	α-helix	trans	-61.4	-38.9	175.6	171.4	0	0	0	0	112.2	K56 K58 A62 F63 K64 V73 I83	K56-V60 WeakPolarHBondContact O-CG2 3.37Å; K56-V60 PolarHBondContact O-N 3.39Å; K58-V60 PolarHBondContact O-N 3.07Å; V60-A62 VanDerWaalsContact C-N 3.35Å; V60-F63 PolarHBondContact O-N 2.92Å; V60-K64 HydrophobicContact CG1-CD 4.19Å; V60-K64 HydrophobicContact CG1-CG 4.48Å; V60-K64 WeakPolarHBondContact O-CB 3.34Å; V60-K64 VanDerWaalsContact O-CG 3.27Å; V60-K64 WeakPolarHBondContact O-CG 3.25Å; V60-K64 PolarHBondContact O-N 3.44Å; V60-V73 HydrophobicContact CG2-CG2 3.66Å; V60-I83 HydrophobicContact CG2-CB 4.48Å; V60-I83 HydrophobicContact CG2-CD1 4.04Å; V60-I83 HydrophobicContact CG2-CG1 4.07Å; V60-I83 HydrophobicContact CG2-CG2 3.68Å
61	K	90.9	Very high	86.7	Confident	155 Å²	155	78.3 Å²	78.3	67%	0.674	41%	0.408	S	S	*	.	H	α-helix	trans	-63.1	-41.5	173.9	-76.2	179.2	179.9	-178.7	0	111.8	K57 K58 L59 K64 K65	K57-K61 WeakPolarHBondContact O-CG 3.27Å; K57-K61 PolarHBondContact O-N 3.47Å; K57-K61 VanDerWaalsContact O-N 3.17Å; K58-K61 WeakPolarHBondContact O-CB 3.36Å; K58-K61 PolarHBondContact O-N 3.21Å; L59-K61 VanDerWaalsContact C-N 3.33Å; L59-K61 PolarHBondContact O-N 3.38Å; K61-K64 PolarHBondContact O-N 2.85Å; K61-K65 PolarHBondContact O-N 3.19Å; K61-K65 VanDerWaalsContact O-N 3.07Å
62	A	90.3	Very high	87.3	Confident	36 Å²	36	79.7 Å²	79.7	30%	0.298	41%	0.412	S	S	.	.	H	α-helix	trans	-66.2	-42.7	177.5	0	0	0	0	0	111.6	K58 L59 V60 K64 K65 K66 F96	K58-A62 PolarHBondContact O-N 3.17Å; L59-A62 WeakPolarHBondContact O-CB 3.38Å; L59-A62 PolarHBondContact O-N 3.42Å; L59-A62 VanDerWaalsContact O-N 3.12Å; V60-A62 VanDerWaalsContact C-N 3.35Å; A62-K64 PolarHBondContact O-N 2.85Å; A62-K65 PolarHBondContact O-N 3.41Å; A62-K66 WeakPolarHBondContact O-CB 3.44Å; A62-K66 PolarHBondContact O-N 2.91Å; A62-F96 HydrophobicContact CB-CE1 4.41Å; A62-F96 HydrophobicContact CB-CZ 3.73Å
63	F	89.5	Confident	88.1	Confident	0 Å²	0	77.8 Å²	77.8	0%	0	39%	0.392	C	S	.	.	H	α-helix	trans	-59.5	-45	173.4	-67.9	-37.4	0	0	0	112.5	L59 V60 K65 K66 F67 I83 L85 I93 F96	L59-F63 HydrophobicContact CB-CE2 4.41Å; L59-F63 HydrophobicContact CD2-CD2 4.41Å; L59-F63 HydrophobicContact CD2-CE2 3.41Å; L59-F63 VanDerWaalsContact CD2-CE2 3.41Å; L59-F63 HydrophobicContact CD2-CZ 3.59Å; L59-F63 HydrophobicContact CG-CD2 4.21Å; L59-F63 HydrophobicContact CG-CE1 4.49Å; L59-F63 HydrophobicContact CG-CE2 3.59Å; L59-F63 HydrophobicContact CG-CZ 3.76Å; L59-F63 VanDerWaalsContact O-CD2 3.32Å; L59-F63 WeakPolarHBondContact O-CD2 3.27Å; L59-F63 VanDerWaalsContact O-CG 3.29Å; L59-F63 WeakPolarHBondContact O-CG 3.49Å; L59-F63 PolarHBondContact O-N 3.48Å; V60-F63 PolarHBondContact O-N 2.92Å; F63-K65 VanDerWaalsContact C-N 3.3Å; F63-K65 PolarHBondContact O-N 3.42Å; F63-K66 PolarHBondContact O-N 2.88Å; F63-F67 HydrophobicContact CB-CD2 3.96Å; F63-F67 HydrophobicContact CB-CE2 4.08Å; F63-F67 AromaticContact CD1-CD2 3.97Å; F63-F67 HydrophobicContact CD1-CD2 3.97Å; F63-F67 AromaticContact CD1-CE2 3.2Å; F63-F67 HydrophobicContact CD1-CE2 3.2Å; F63-F67 AromaticContact CD1-CZ 3.82Å; F63-F67 HydrophobicContact CD1-CZ 3.82Å; F63-F67 AromaticContact CE1-CE2 3.76Å; F63-F67 HydrophobicContact CE1-CE2 3.76Å; F63-F67 HydrophobicContact CE1-CZ 4.18Å; F63-F67 HydrophobicContact CG-CD2 4.31Å; F63-F67 AromaticContact CG-CE2 3.93Å; F63-F67 HydrophobicContact CG-CE2 3.93Å; F63-F67 WeakPolarHBondContact O-CB 3.48Å; F63-F67 PolarHBondContact O-N 3.39Å; F63-I83 HydrophobicContact CD2-CG2 4.28Å; F63-I83 HydrophobicContact CE2-CD1 4.12Å; F63-I83 HydrophobicContact CE2-CG2 4.29Å; F63-L85 HydrophobicContact CB-CD1 4.47Å; F63-L85 HydrophobicContact CB-CD2 3.94Å; F63-L85 HydrophobicContact CD2-CD1 4.08Å; F63-L85 HydrophobicContact CD2-CD2 4.41Å; F63-L85 HydrophobicContact CE2-CD1 4.46Å; F63-L85 HydrophobicContact CG-CD1 4.28Å; F63-I93 HydrophobicContact CZ-CG2 4.48Å; F63-F96 AromaticContact CD1-CD1 3.7Å; F63-F96 HydrophobicContact CD1-CD1 3.7Å; F63-F96 AromaticContact CD1-CE1 3.62Å; F63-F96 HydrophobicContact CD1-CE1 3.62Å; F63-F96 HydrophobicContact CD1-CG 4.41Å; F63-F96 HydrophobicContact CD1-CZ 4.38Å; F63-F96 AromaticContact CE1-CD1 3.16Å; F63-F96 HydrophobicContact CE1-CD1 3.16Å; F63-F96 AromaticContact CE1-CE1 3.41Å; F63-F96 HydrophobicContact CE1-CE1 3.41Å; F63-F96 VanDerWaalsContact CE1-CE1 3.41Å; F63-F96 HydrophobicContact CE1-CG 4.06Å; F63-F96 HydrophobicContact CZ-CD1 4.11Å; F63-F96 HydrophobicContact CZ-CE1 4.25Å
64	K	90.4	Very high	88.6	Confident	84 Å²	84	72.9 Å²	72.9	37%	0.365	37%	0.365	S	S	.	.	H	α-helix	trans	-58	-42.9	175.2	-75.5	174.4	177.5	-175.7	0	111.9	V60 K61 A62 A68 C69 N70 G71	V60-K64 HydrophobicContact CG1-CD 4.19Å; V60-K64 HydrophobicContact CG1-CG 4.48Å; V60-K64 WeakPolarHBondContact O-CB 3.34Å; V60-K64 VanDerWaalsContact O-CG 3.27Å; V60-K64 WeakPolarHBondContact O-CG 3.25Å; V60-K64 PolarHBondContact O-N 3.44Å; K61-K64 PolarHBondContact O-N 2.85Å; A62-K64 PolarHBondContact O-N 2.85Å; K64-A68 WeakPolarHBondContact O-CA 3.32Å; K64-A68 PolarHBondContact O-N 2.91Å; K64-A68 VanDerWaalsContact O-N 3.17Å; K64-C69 WeakPolarHBondContact CA-O 3.29Å; K64-C69 WeakPolarHBondContact CG-O 3.49Å; K64-N70 WeakPolarHBondContact CE-OD1 3.23Å; K64-N70 PolarHBondContact NZ-OD1 3.1Å; K64-G71 VanDerWaalsContact CE-N 3.34Å; K64-G71 WeakPolarHBondContact CE-O 3.31Å; K64-G71 PolarHBondContact NZ-O 3.3Å
65	K	90.6	Very high	88.8	Confident	194 Å²	194	74.9 Å²	74.9	84%	0.843	38%	0.379	S	S	*	.	H	α-helix	trans	-70.6	-40.4	-179.1	-168.4	176.2	-178.9	-177.9	0	112.6	K61 A62 F63	K61-K65 PolarHBondContact O-N 3.19Å; K61-K65 VanDerWaalsContact O-N 3.07Å; A62-K65 PolarHBondContact O-N 3.41Å; F63-K65 VanDerWaalsContact C-N 3.3Å; F63-K65 PolarHBondContact O-N 3.42Å
66	K	88.8	Confident	88.6	Confident	100 Å²	100	73.7 Å²	73.7	44%	0.435	37%	0.37	S	S	.	.	H	α-helix	trans	-84.1	-36.5	-175.1	-163.7	160.9	-179.9	168.2	0	113.1	A62 F63 F96 E99	A62-K66 WeakPolarHBondContact O-CB 3.44Å; A62-K66 PolarHBondContact O-N 2.91Å; F63-K66 PolarHBondContact O-N 2.88Å; K66-F96 HydrophobicContact CD-CD2 3.48Å; K66-F96 VanDerWaalsContact CD-CD2 3.48Å; K66-F96 HydrophobicContact CD-CE2 3.61Å; K66-E99 IonicContact NZ-OE1 2.62Å; K66-E99 PolarHBondContact NZ-OE1 3.07Å; K66-E99 IonicContact NZ-OE2 2.67Å; K66-E99 PolarHBondContact NZ-OE2 3.42Å
67	F	87	Confident	88.3	Confident	24 Å²	24	79.4 Å²	79.4	11%	0.105	41%	0.409	C	S	.	.	H	α-helix	trans	-100.6	-4.1	-174.7	-50	-33.2	0	0	0	113.6	F63 C69 N92 I93 F96	F63-F67 HydrophobicContact CB-CD2 3.96Å; F63-F67 HydrophobicContact CB-CE2 4.08Å; F63-F67 AromaticContact CD1-CD2 3.97Å; F63-F67 HydrophobicContact CD1-CD2 3.97Å; F63-F67 AromaticContact CD1-CE2 3.2Å; F63-F67 HydrophobicContact CD1-CE2 3.2Å; F63-F67 AromaticContact CD1-CZ 3.82Å; F63-F67 HydrophobicContact CD1-CZ 3.82Å; F63-F67 AromaticContact CE1-CE2 3.76Å; F63-F67 HydrophobicContact CE1-CE2 3.76Å; F63-F67 HydrophobicContact CE1-CZ 4.18Å; F63-F67 HydrophobicContact CG-CD2 4.31Å; F63-F67 AromaticContact CG-CE2 3.93Å; F63-F67 HydrophobicContact CG-CE2 3.93Å; F63-F67 WeakPolarHBondContact O-CB 3.48Å; F63-F67 PolarHBondContact O-N 3.39Å; F67-C69 HydrophobicContact CB-CB 4.29Å; F67-C69 PolarHBondContact O-N 2.97Å; F67-C69 PolarHBondContact O-SG 3.08Å; F67-N92 HydrophobicContact CD1-CB 3.84Å; F67-N92 HydrophobicContact CE1-CB 3.58Å; F67-N92 HydrophobicContact CG-CB 4.48Å; F67-N92 HydrophobicContact CZ-CB 3.95Å; F67-N92 WeakPolarHBondContact CZ-O 3.48Å; F67-I93 HydrophobicContact CE2-CG1 3.85Å; F67-I93 HydrophobicContact CZ-CG1 4.43Å; F67-F96 HydrophobicContact CE1-CB 4.41Å; F67-F96 HydrophobicContact CZ-CB 3.79Å; F67-F96 HydrophobicContact CZ-CG 4.11Å
68	A	88.8	Confident	87.9	Confident	97 Å²	97	78.4 Å²	78.4	80%	0.802	41%	0.407	S	S	*	.			trans	50.4	29.2	-174.4	0	0	0	0	0	113.5	K64	K64-A68 WeakPolarHBondContact O-CA 3.32Å; K64-A68 PolarHBondContact O-N 2.91Å; K64-A68 VanDerWaalsContact O-N 3.17Å
69	C	89.3	Confident	86.9	Confident	28 Å²	28	77.1 Å²	77.1	19%	0.189	40%	0.399	C	S	.	.			trans	-112.4	152.1	-177.2	-71.8	0	0	0	0	110.6	K64 F67 Q86 Q89	K64-C69 WeakPolarHBondContact CA-O 3.29Å; K64-C69 WeakPolarHBondContact CG-O 3.49Å; F67-C69 HydrophobicContact CB-CB 4.29Å; F67-C69 PolarHBondContact O-N 2.97Å; F67-C69 PolarHBondContact O-SG 3.08Å; C69-Q86 PolarHBondContact SG-O 3.34Å; C69-Q89 PolarHBondContact SG-NE2 2.62Å
70	N	91.1	Very high	86.7	Confident	86 Å²	86	77.7 Å²	77.7	46%	0.46	41%	0.41	S	S	.	.			trans	-78.7	147.3	170.6	-161.2	7.2	0	0	0	110.5	K64 Q86	K64-N70 WeakPolarHBondContact CE-OD1 3.23Å; K64-N70 PolarHBondContact NZ-OD1 3.1Å; N70-Q86 HydrophobicContact CB-CG 4.25Å; N70-Q86 PolarHBondContact O-N 2.94Å
71	G	91.6	Very high	86.4	Confident	5 Å²	5	81.5 Å²	81.5	5%	0.052	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.4	150.1	-177.6	0	0	0	0	0	112.5	K64 Q84	K64-G71 VanDerWaalsContact CE-N 3.34Å; K64-G71 WeakPolarHBondContact CE-O 3.31Å; K64-G71 PolarHBondContact NZ-O 3.3Å; G71-Q84 CarbonylContact C-O 3.49Å; G71-Q84 WeakPolarHBondContact CA-O 3.45Å
72	T	91.2	Very high	86.3	Confident	70 Å²	70	74.2 Å²	74.2	43%	0.429	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.4	150.5	177.8	-171.4	0	0	0	0	110.1	I74 Q84	T72-I74 HydrophobicContact CG2-CD1 3.44Å; T72-I74 VanDerWaalsContact CG2-CD1 3.44Å; T72-I74 HydrophobicContact CG2-CG1 3.75Å; T72-Q84 HydrophobicContact CG2-CB 4.16Å; T72-Q84 PolarHBondContact N-O 3.03Å; T72-Q84 PolarHBondContact O-N 3.26Å
73	V	90.4	Very high	86.3	Confident	39 Å²	39	72.6 Å²	72.6	24%	0.236	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.3	130.1	164.8	-172.7	0	0	0	0	106.1	K56 V60 E81 V82 I83	K56-V73 HydrophobicContact CB-CG1 4.45Å; K56-V73 HydrophobicContact CB-CG2 4.04Å; V60-V73 HydrophobicContact CG2-CG2 3.66Å; V73-E81 HydrophobicContact CG1-CB 4.45Å; V73-V82 WeakPolarHBondContact CA-O 3.49Å; V73-I83 HydrophobicContact CG2-CG1 4.42Å
74	I	89	Confident	86.4	Confident	54 Å²	54	74.4 Å²	74.4	28%	0.277	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.4	136.8	176.8	-75.6	162.8	0	0	0	107.3	T72 V82 Q84	T72-I74 HydrophobicContact CG2-CD1 3.44Å; T72-I74 VanDerWaalsContact CG2-CD1 3.44Å; T72-I74 HydrophobicContact CG2-CG1 3.75Å; I74-V82 HydrophobicContact CB-CG2 4.27Å; I74-V82 PolarHBondContact N-O 3.07Å; I74-V82 WeakPolarHBondContact O-CG2 3.32Å; I74-V82 PolarHBondContact O-N 2.86Å; I74-V82 VanDerWaalsContact O-O 3.07Å; I74-Q84 HydrophobicContact CB-CG 4.46Å; I74-Q84 HydrophobicContact CD1-CB 4.27Å; I74-Q84 HydrophobicContact CD1-CG 3.8Å
75	E	85.6	Confident	86.5	Confident	155 Å²	155	70.4 Å²	70.4	72%	0.724	37%	0.373	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.4	121.8	171.7	-166.4	174.9	178.5	0	0	109.1	E81	E75-E81 HydrophobicContact CG-CG 4.4Å
76	H	78.8	Confident	86.6	Confident	69 Å²	69	65.6 Å²	65.6	32%	0.319	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	139	170.9	-91.5	-66	0	0	0	110.1	E78 Y79 G80 V82	H76-E78 VanDerWaalsContact C-N 3.25Å; H76-E78 PolarHBondContact O-N 2.84Å; H76-Y79 HydrophobicContact CB-CD2 4.43Å; H76-G80 PolarHBondContact N-O 2.88Å; H76-G80 VanDerWaalsContact O-CA 3.26Å; H76-G80 WeakPolarHBondContact O-CA 3.48Å; H76-G80 PolarHBondContact O-N 2.87Å; H76-V82 VanDerWaalsContact CD2-CG2 3.48Å; H76-V82 WeakPolarHBondContact CD2-CG2 3.33Å
77	P	78.8	Confident	86.7	Confident	139 Å²	139	62 Å²	62	90%	0.903	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.6	-25.9	-178.2	25.4	-34	0	0	0	113.7
78	E	76.6	Confident	86.8	Confident	149 Å²	149	64 Å²	64	70%	0.696	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97	-33.1	-178.4	-167.3	-176.8	150.5	0	0	113	H76	H76-E78 VanDerWaalsContact C-N 3.25Å; H76-E78 PolarHBondContact O-N 2.84Å
79	Y	69.4	Low	86.7	Confident	108 Å²	108	60.6 Å²	60.6	42%	0.424	32%	0.324	S	S	.	.	T	Hydrogen-bonded Turn	trans	-113.4	2.4	-171.2	-53	-58	0	0	0	113.7	H76	H76-Y79 HydrophobicContact CB-CD2 4.43Å
80	G	82.1	Confident	86.7	Confident	32 Å²	32	63.6 Å²	63.6	33%	0.33	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	67.3	-152.4	-175	0	0	0	0	0	113.1	H76 V82	H76-G80 PolarHBondContact N-O 2.88Å; H76-G80 VanDerWaalsContact O-CA 3.26Å; H76-G80 WeakPolarHBondContact O-CA 3.48Å; H76-G80 PolarHBondContact O-N 2.87Å; G80-V82 PolarHBondContact O-N 2.96Å
81	E	84	Confident	86.6	Confident	88 Å²	88	66.9 Å²	66.9	41%	0.411	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.5	114	177.3	-79.9	-171.3	138.9	0	0	112	K56 V73 E75	K56-E81 HydrophobicContact CD-CB 4.04Å; K56-E81 WeakPolarHBondContact CD-OE2 3.12Å; K56-E81 WeakPolarHBondContact CE-OE2 3.5Å; K56-E81 VanDerWaalsContact NZ-CB 3.31Å; K56-E81 IonicContact NZ-OE2 2.91Å; K56-E81 PolarHBondContact NZ-OE2 2.82Å; V73-E81 HydrophobicContact CG1-CB 4.45Å; E75-E81 HydrophobicContact CG-CG 4.4Å
82	V	88.7	Confident	86.5	Confident	1 Å²	1	69.9 Å²	69.9	1%	0.006	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	156.1	174.7	-53.9	0	0	0	0	111.2	Q48 V73 I74 H76 G80 Q84	Q48-V82 HydrophobicContact CB-CG1 4.39Å; Q48-V82 HydrophobicContact CG-CG1 3.89Å; V73-V82 WeakPolarHBondContact CA-O 3.49Å; I74-V82 HydrophobicContact CB-CG2 4.27Å; I74-V82 PolarHBondContact N-O 3.07Å; I74-V82 WeakPolarHBondContact O-CG2 3.32Å; I74-V82 PolarHBondContact O-N 2.86Å; I74-V82 VanDerWaalsContact O-O 3.07Å; H76-V82 VanDerWaalsContact CD2-CG2 3.48Å; H76-V82 WeakPolarHBondContact CD2-CG2 3.33Å; G80-V82 PolarHBondContact O-N 2.96Å; V82-Q84 HydrophobicContact CG2-CG 4.19Å
83	I	90.9	Very high	86.3	Confident	2 Å²	2	66.6 Å²	66.6	1%	0.01	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.7	125.4	170.3	-63.3	174.4	0	0	0	108.7	T46 V47 I50 K56 L59 V60 F63 V73 L85	T46-I83 CarbonylContact C-O 3.56Å; T46-I83 WeakPolarHBondContact CA-O 3.48Å; V47-I83 HydrophobicContact CB-CB 4.43Å; V47-I83 PolarHBondContact N-O 2.98Å; V47-I83 PolarHBondContact O-N 2.86Å; V47-I83 VanDerWaalsContact O-N 3.07Å; I50-I83 HydrophobicContact CD1-CD1 4.06Å; K56-I83 HydrophobicContact CB-CD1 4.38Å; K56-I83 HydrophobicContact CG-CD1 4.47Å; L59-I83 HydrophobicContact CB-CD1 4.41Å; L59-I83 HydrophobicContact CD2-CD1 3.65Å; V60-I83 HydrophobicContact CG2-CB 4.48Å; V60-I83 HydrophobicContact CG2-CD1 4.04Å; V60-I83 HydrophobicContact CG2-CG1 4.07Å; V60-I83 HydrophobicContact CG2-CG2 3.68Å; F63-I83 HydrophobicContact CD2-CG2 4.28Å; F63-I83 HydrophobicContact CE2-CD1 4.12Å; F63-I83 HydrophobicContact CE2-CG2 4.29Å; V73-I83 HydrophobicContact CG2-CG1 4.42Å; I83-L85 HydrophobicContact CG2-CG 4.22Å
84	Q	91.3	Very high	86.2	Confident	38 Å²	38	66 Å²	66	18%	0.178	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	132.1	172.8	-58.9	-162.8	-9.2	0	0	110.4	T45 T46 G71 T72 I74 V82	T45-Q84 WeakPolarHBondContact O-CA 3.34Å; T46-Q84 HydrophobicContact CG2-CG 3.96Å; G71-Q84 CarbonylContact C-O 3.49Å; G71-Q84 WeakPolarHBondContact CA-O 3.45Å; T72-Q84 HydrophobicContact CG2-CB 4.16Å; T72-Q84 PolarHBondContact N-O 3.03Å; T72-Q84 PolarHBondContact O-N 3.26Å; I74-Q84 HydrophobicContact CB-CG 4.46Å; I74-Q84 HydrophobicContact CD1-CB 4.27Å; I74-Q84 HydrophobicContact CD1-CG 3.8Å; V82-Q84 HydrophobicContact CG2-CG 4.19Å
85	L	93.3	Very high	86.2	Confident	0 Å²	0	69.4 Å²	69.4	0%	0	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	146.9	177.5	-68.5	164.1	0	0	0	109.9	L44 T45 F63 I83 I93	L44-L85 CarbonylContact C-O 3.58Å; L44-L85 WeakPolarHBondContact CA-O 3.25Å; T45-L85 PolarHBondContact N-O 2.89Å; T45-L85 PolarHBondContact O-N 2.86Å; F63-L85 HydrophobicContact CB-CD1 4.47Å; F63-L85 HydrophobicContact CB-CD2 3.94Å; F63-L85 HydrophobicContact CD2-CD1 4.08Å; F63-L85 HydrophobicContact CD2-CD2 4.41Å; F63-L85 HydrophobicContact CE2-CD1 4.46Å; F63-L85 HydrophobicContact CG-CD1 4.28Å; I83-L85 HydrophobicContact CG2-CG 4.22Å; L85-I93 HydrophobicContact CD1-CD1 3.5Å; L85-I93 HydrophobicContact CD1-CG1 3.88Å
86	Q	91.3	Very high	86.4	Confident	93 Å²	93	62.8 Å²	62.8	44%	0.435	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.5	137.8	175	-64.5	-175.6	-1	0	0	111.2	L44 C69 N70	L44-Q86 HydrophobicContact CD2-CG 4.3Å; C69-Q86 PolarHBondContact SG-O 3.34Å; N70-Q86 HydrophobicContact CB-CG 4.25Å; N70-Q86 PolarHBondContact O-N 2.94Å
87	G	90.8	Very high	86.7	Confident	25 Å²	25	59.5 Å²	59.5	26%	0.258	30%	0.302	S	S	.	.	S	Bend	trans	86.8	175.4	-178.7	0	0	0	0	0	114	T43 T45 Q89	T43-G87 WeakPolarHBondContact O-CA 3.43Å; T43-G87 PolarHBondContact O-N 3.11Å; T43-G87 WeakPolarHBondContact OG1-CA 3.4Å; T45-G87 PolarHBondContact OG1-O 2.92Å; G87-Q89 PolarHBondContact O-N 2.86Å
88	D	89.8	Confident	87	Confident	67 Å²	67	56.8 Å²	56.8	36%	0.358	28%	0.278	S	S	.	.			trans	-82.2	107.6	169.2	-177.9	3.5	0	0	0	108.4	I35 T43 R90	I35-D88 HydrophobicContact CD1-CB 3.63Å; T43-D88 PolarHBondContact OG1-N 2.95Å; D88-R90 WeakPolarHBondContact OD1-CB 3.39Å; D88-R90 WeakPolarHBondContact OD1-CD 3.42Å; D88-R90 WeakPolarHBondContact OD1-CG 3.45Å; D88-R90 PolarHBondContact OD1-N 3.11Å; D88-R90 IonicContact OD1-NE 3.53Å; D88-R90 IonicContact OD2-CZ 3.66Å; D88-R90 IonicContact OD2-NE 2.97Å; D88-R90 PolarHBondContact OD2-NE 3.15Å; D88-R90 IonicContact OD2-NH2 3.66Å
89	Q	86.1	Confident	87.5	Confident	24 Å²	24	55.6 Å²	55.6	11%	0.112	27%	0.273	C	S	.	.			trans	-118.9	17.3	179.2	-62.4	-61.6	-27.7	0	0	111.6	T45 C69 G87 K91 N92 I93	T45-Q89 PolarHBondContact OG1-N 3.2Å; T45-Q89 VanDerWaalsContact OG1-N 3.15Å; C69-Q89 PolarHBondContact SG-NE2 2.62Å; G87-Q89 PolarHBondContact O-N 2.86Å; Q89-K91 VanDerWaalsContact C-N 3.32Å; Q89-K91 PolarHBondContact O-N 3.37Å; Q89-N92 PolarHBondContact O-N 3.26Å; Q89-N92 VanDerWaalsContact O-N 3.15Å; Q89-N92 PolarHBondContact OE1-ND2 2.98Å; Q89-I93 HydrophobicContact CB-CD1 3.74Å; Q89-I93 HydrophobicContact CB-CG1 4.01Å; Q89-I93 WeakPolarHBondContact O-CB 3.25Å; Q89-I93 WeakPolarHBondContact O-CD1 3.37Å; Q89-I93 VanDerWaalsContact O-CG1 3.25Å; Q89-I93 WeakPolarHBondContact O-CG1 3.49Å; Q89-I93 PolarHBondContact O-N 2.87Å
90	R	89.5	Confident	88.1	Confident	91 Å²	91	54.3 Å²	54.3	34%	0.343	27%	0.273	S	S	.	.	H	α-helix	trans	-56.6	-43	-171.8	69	-166	158.8	149	-0.8	113.6	I33 D88 C94 V110	I33-R90 HydrophobicContact CG2-CB 4.27Å; D88-R90 WeakPolarHBondContact OD1-CB 3.39Å; D88-R90 WeakPolarHBondContact OD1-CD 3.42Å; D88-R90 WeakPolarHBondContact OD1-CG 3.45Å; D88-R90 PolarHBondContact OD1-N 3.11Å; D88-R90 IonicContact OD1-NE 3.53Å; D88-R90 IonicContact OD2-CZ 3.66Å; D88-R90 IonicContact OD2-NE 2.97Å; D88-R90 PolarHBondContact OD2-NE 3.15Å; D88-R90 IonicContact OD2-NH2 3.66Å; R90-C94 VanDerWaalsContact O-CB 3.25Å; R90-C94 WeakPolarHBondContact O-CB 3.45Å; R90-C94 PolarHBondContact O-N 2.86Å; R90-C94 VanDerWaalsContact O-N 3.11Å; R90-V110 HydrophobicContact CB-CG1 3.98Å; R90-V110 HydrophobicContact CG-CG1 4.44Å
91	K	88.7	Confident	87.9	Confident	156 Å²	156	55.7 Å²	55.7	68%	0.678	29%	0.287	S	S	*	.	H	α-helix	trans	-69.4	-44.1	179.2	-64.2	-174.8	178.7	-176.5	0	111.5	Q89 C94 Q95	Q89-K91 VanDerWaalsContact C-N 3.32Å; Q89-K91 PolarHBondContact O-N 3.37Å; K91-C94 PolarHBondContact O-N 3.15Å; K91-Q95 WeakPolarHBondContact O-CB 3.17Å; K91-Q95 PolarHBondContact O-N 3.46Å
92	N	89.5	Confident	87.3	Confident	68 Å²	68	53.2 Å²	53.2	36%	0.364	28%	0.276	S	S	.	.	H	α-helix	trans	-68.7	-40.4	-176.7	-66.6	-16.7	0	0	0	111.8	F67 Q89 F96	F67-N92 HydrophobicContact CD1-CB 3.84Å; F67-N92 HydrophobicContact CE1-CB 3.58Å; F67-N92 HydrophobicContact CG-CB 4.48Å; F67-N92 HydrophobicContact CZ-CB 3.95Å; F67-N92 WeakPolarHBondContact CZ-O 3.48Å; Q89-N92 PolarHBondContact O-N 3.26Å; Q89-N92 VanDerWaalsContact O-N 3.15Å; Q89-N92 PolarHBondContact OE1-ND2 2.98Å; N92-F96 VanDerWaalsContact O-CB 3.23Å; N92-F96 WeakPolarHBondContact O-CB 3.47Å; N92-F96 PolarHBondContact O-N 3.2Å
93	I	88.7	Confident	86.7	Confident	0 Å²	0	53.7 Å²	53.7	0%	0	28%	0.279	C	S	.	.	H	α-helix	trans	-66.7	-44.2	175.2	-64.4	161.3	0	0	0	110.1	I33 T45 V47 F63 F67 L85 Q89 Q95 F96 L97	I33-I93 HydrophobicContact CD1-CB 4.11Å; I33-I93 HydrophobicContact CD1-CG2 3.59Å; I33-I93 HydrophobicContact CG1-CG2 4.27Å; T45-I93 HydrophobicContact CG2-CD1 3.53Å; V47-I93 HydrophobicContact CG2-CD1 3.94Å; V47-I93 HydrophobicContact CG2-CG2 3.94Å; F63-I93 HydrophobicContact CZ-CG2 4.48Å; F67-I93 HydrophobicContact CE2-CG1 3.85Å; F67-I93 HydrophobicContact CZ-CG1 4.43Å; L85-I93 HydrophobicContact CD1-CD1 3.5Å; L85-I93 HydrophobicContact CD1-CG1 3.88Å; Q89-I93 HydrophobicContact CB-CD1 3.74Å; Q89-I93 HydrophobicContact CB-CG1 4.01Å; Q89-I93 WeakPolarHBondContact O-CB 3.25Å; Q89-I93 WeakPolarHBondContact O-CD1 3.37Å; Q89-I93 VanDerWaalsContact O-CG1 3.25Å; Q89-I93 WeakPolarHBondContact O-CG1 3.49Å; Q89-I93 PolarHBondContact O-N 2.87Å; I93-Q95 PolarHBondContact O-N 2.79Å; I93-F96 PolarHBondContact O-N 3.41Å; I93-L97 HydrophobicContact CG2-CD1 3.7Å; I93-L97 HydrophobicContact CG2-CG 4.14Å; I93-L97 WeakPolarHBondContact O-CB 3.44Å; I93-L97 VanDerWaalsContact O-CG 3.31Å; I93-L97 WeakPolarHBondContact O-CG 3.26Å; I93-L97 PolarHBondContact O-N 3.15Å
94	C	87.7	Confident	86.1	Confident	27 Å²	27	62.4 Å²	62.4	18%	0.182	31%	0.311	C	S	.	.	H	α-helix	trans	-56.2	-51.2	177	-173.4	0	0	0	0	111.1	R90 K91 F96 L97 M98 L108	R90-C94 VanDerWaalsContact O-CB 3.25Å; R90-C94 WeakPolarHBondContact O-CB 3.45Å; R90-C94 PolarHBondContact O-N 2.86Å; R90-C94 VanDerWaalsContact O-N 3.11Å; K91-C94 PolarHBondContact O-N 3.15Å; C94-F96 PolarHBondContact O-N 3.14Å; C94-L97 PolarHBondContact O-N 2.77Å; C94-M98 WeakPolarHBondContact O-CE 3.46Å; C94-M98 PolarHBondContact O-N 2.75Å; C94-L108 HydrophobicContact CB-CD1 4.29Å; C94-L108 HydrophobicContact CB-CD2 4.28Å
95	Q	89.1	Confident	85.3	Confident	125 Å²	125	67.8 Å²	67.8	58%	0.584	34%	0.337	S	S	*	.	H	α-helix	trans	-61.5	-42.5	177.9	-171.3	174.1	12.5	0	0	112.5	K91 I93 M98 E99	K91-Q95 WeakPolarHBondContact O-CB 3.17Å; K91-Q95 PolarHBondContact O-N 3.46Å; I93-Q95 PolarHBondContact O-N 2.79Å; Q95-M98 PolarHBondContact O-N 3.24Å; Q95-E99 WeakPolarHBondContact O-CB 3.5Å; Q95-E99 PolarHBondContact O-N 3.49Å
96	F	89	Confident	84.5	Confident	17 Å²	17	75.5 Å²	75.5	8%	0.075	37%	0.372	C	S	.	.	H	α-helix	trans	-67.8	-38.9	-178.7	-175.5	-102.4	0	0	0	113.3	L59 A62 F63 K66 F67 N92 I93 C94 M98 E99 I100	L59-F96 HydrophobicContact CD1-CE1 4.34Å; A62-F96 HydrophobicContact CB-CE1 4.41Å; A62-F96 HydrophobicContact CB-CZ 3.73Å; F63-F96 AromaticContact CD1-CD1 3.7Å; F63-F96 HydrophobicContact CD1-CD1 3.7Å; F63-F96 AromaticContact CD1-CE1 3.62Å; F63-F96 HydrophobicContact CD1-CE1 3.62Å; F63-F96 HydrophobicContact CD1-CG 4.41Å; F63-F96 HydrophobicContact CD1-CZ 4.38Å; F63-F96 AromaticContact CE1-CD1 3.16Å; F63-F96 HydrophobicContact CE1-CD1 3.16Å; F63-F96 AromaticContact CE1-CE1 3.41Å; F63-F96 HydrophobicContact CE1-CE1 3.41Å; F63-F96 VanDerWaalsContact CE1-CE1 3.41Å; F63-F96 HydrophobicContact CE1-CG 4.06Å; F63-F96 HydrophobicContact CZ-CD1 4.11Å; F63-F96 HydrophobicContact CZ-CE1 4.25Å; K66-F96 HydrophobicContact CD-CD2 3.48Å; K66-F96 VanDerWaalsContact CD-CD2 3.48Å; K66-F96 HydrophobicContact CD-CE2 3.61Å; F67-F96 HydrophobicContact CE1-CB 4.41Å; F67-F96 HydrophobicContact CZ-CB 3.79Å; F67-F96 HydrophobicContact CZ-CG 4.11Å; N92-F96 VanDerWaalsContact O-CB 3.23Å; N92-F96 WeakPolarHBondContact O-CB 3.47Å; N92-F96 PolarHBondContact O-N 3.2Å; I93-F96 PolarHBondContact O-N 3.41Å; C94-F96 PolarHBondContact O-N 3.14Å; F96-M98 VanDerWaalsContact C-N 3.32Å; F96-E99 PolarHBondContact O-N 2.69Å; F96-I100 HydrophobicContact CD1-CD1 3.47Å; F96-I100 VanDerWaalsContact CD1-CD1 3.47Å; F96-I100 HydrophobicContact CD1-CG1 4.4Å; F96-I100 HydrophobicContact CD2-CD1 4.33Å; F96-I100 HydrophobicContact CE1-CD1 3.05Å; F96-I100 HydrophobicContact CE1-CG1 4.22Å; F96-I100 HydrophobicContact CE2-CD1 3.94Å; F96-I100 HydrophobicContact CE2-CG1 4.38Å; F96-I100 HydrophobicContact CG-CD1 4.16Å; F96-I100 HydrophobicContact CZ-CD1 3.32Å; F96-I100 HydrophobicContact CZ-CG1 4.21Å; F96-I100 WeakPolarHBondContact O-CG1 3.5Å; F96-I100 PolarHBondContact O-N 3.43Å; F96-I100 VanDerWaalsContact O-N 3.1Å
97	L	85.6	Confident	84	Confident	0 Å²	0	73.9 Å²	73.9	0%	0	37%	0.365	C	S	.	.	H	α-helix	trans	-66.5	-37.1	177.5	-72	173.8	0	0	0	111.6	I31 I33 I93 C94 G101 I102 V103 L108	I31-L97 HydrophobicContact CG2-CD1 4.17Å; I33-L97 HydrophobicContact CD1-CD1 4.41Å; I93-L97 HydrophobicContact CG2-CD1 3.7Å; I93-L97 HydrophobicContact CG2-CG 4.14Å; I93-L97 WeakPolarHBondContact O-CB 3.44Å; I93-L97 VanDerWaalsContact O-CG 3.31Å; I93-L97 WeakPolarHBondContact O-CG 3.26Å; I93-L97 PolarHBondContact O-N 3.15Å; C94-L97 PolarHBondContact O-N 2.77Å; L97-G101 PolarHBondContact O-N 2.73Å; L97-I102 PolarHBondContact O-N 3.47Å; L97-V103 HydrophobicContact CB-CB 4.35Å; L97-V103 HydrophobicContact CB-CG2 3.95Å; L97-V103 HydrophobicContact CD1-CG2 4.32Å; L97-V103 HydrophobicContact CD2-CG2 4.06Å; L97-V103 HydrophobicContact CG-CG2 4.33Å; L97-L108 HydrophobicContact CB-CD1 4.3Å; L97-L108 HydrophobicContact CD1-CD1 3.99Å
98	M	84.7	Confident	83.8	Confident	81 Å²	81	73.5 Å²	73.5	40%	0.399	36%	0.357	S	S	.	.	H	α-helix	trans	-66.5	-41.7	171.7	-72.1	-172.9	-74.8	0	0	112	C94 Q95 F96 I100 G101 E105	C94-M98 WeakPolarHBondContact O-CE 3.46Å; C94-M98 PolarHBondContact O-N 2.75Å; Q95-M98 PolarHBondContact O-N 3.24Å; F96-M98 VanDerWaalsContact C-N 3.32Å; M98-I100 PolarHBondContact O-N 2.84Å; M98-G101 PolarHBondContact O-N 3Å; M98-G101 VanDerWaalsContact O-N 3.11Å; M98-E105 HydrophobicContact SD-CG 4.48Å
99	E	86.7	Confident	83.7	Confident	125 Å²	125	74.9 Å²	74.9	58%	0.584	36%	0.36	S	S	*	.	H	α-helix	trans	-65.1	-37	-178.4	-171.7	-176.7	148.5	0	0	113.1	K66 Q95 F96 G101	K66-E99 IonicContact NZ-OE1 2.62Å; K66-E99 PolarHBondContact NZ-OE1 3.07Å; K66-E99 IonicContact NZ-OE2 2.67Å; K66-E99 PolarHBondContact NZ-OE2 3.42Å; Q95-E99 WeakPolarHBondContact O-CB 3.5Å; Q95-E99 PolarHBondContact O-N 3.49Å; F96-E99 PolarHBondContact O-N 2.69Å; E99-G101 VanDerWaalsContact C-N 3.27Å
100	I	82.1	Confident	83.9	Confident	81 Å²	81	77 Å²	77	42%	0.415	37%	0.374	S	S	.	.	H	α-helix	trans	-78.3	-15.8	176.4	-53.9	163.5	0	0	0	111.4	L59 F96 M98 I102	L59-I100 HydrophobicContact CD1-CD1 4.33Å; F96-I100 HydrophobicContact CD1-CD1 3.47Å; F96-I100 VanDerWaalsContact CD1-CD1 3.47Å; F96-I100 HydrophobicContact CD1-CG1 4.4Å; F96-I100 HydrophobicContact CD2-CD1 4.33Å; F96-I100 HydrophobicContact CE1-CD1 3.05Å; F96-I100 HydrophobicContact CE1-CG1 4.22Å; F96-I100 HydrophobicContact CE2-CD1 3.94Å; F96-I100 HydrophobicContact CE2-CG1 4.38Å; F96-I100 HydrophobicContact CG-CD1 4.16Å; F96-I100 HydrophobicContact CZ-CD1 3.32Å; F96-I100 HydrophobicContact CZ-CG1 4.21Å; F96-I100 WeakPolarHBondContact O-CG1 3.5Å; F96-I100 PolarHBondContact O-N 3.43Å; F96-I100 VanDerWaalsContact O-N 3.1Å; M98-I100 PolarHBondContact O-N 2.84Å; I100-I102 HydrophobicContact CB-CD1 4.01Å; I100-I102 HydrophobicContact CB-CG1 3.94Å; I100-I102 HydrophobicContact CD1-CD1 4.09Å; I100-I102 HydrophobicContact CG2-CD1 3.66Å; I100-I102 HydrophobicContact CG2-CG1 3.61Å; I100-I102 PolarHBondContact O-N 2.79Å
101	G	77.7	Confident	83.7	Confident	61 Å²	61	76 Å²	76	63%	0.629	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.7	20.1	-176.8	0	0	0	0	0	113.7	L97 M98 E99 V103	L97-G101 PolarHBondContact O-N 2.73Å; M98-G101 PolarHBondContact O-N 3Å; M98-G101 VanDerWaalsContact O-N 3.11Å; E99-G101 VanDerWaalsContact C-N 3.27Å; G101-V103 VanDerWaalsContact C-N 3.28Å
102	I	73.1	Confident	83.3	Confident	36 Å²	36	70.5 Å²	70.5	19%	0.185	36%	0.361	C	S	.	.	S	Bend	trans	-71.6	-29.9	176.3	-63.6	174.1	0	0	0	110.3	Y54 L59 L97 I100	Y54-I102 HydrophobicContact CD2-CG2 4.37Å; Y54-I102 HydrophobicContact CE1-CG1 4.24Å; Y54-I102 HydrophobicContact CE1-CG2 4.15Å; Y54-I102 HydrophobicContact CE2-CG2 3.91Å; L59-I102 HydrophobicContact CD1-CD1 3.88Å; L97-I102 PolarHBondContact O-N 3.47Å; I100-I102 HydrophobicContact CB-CD1 4.01Å; I100-I102 HydrophobicContact CB-CG1 3.94Å; I100-I102 HydrophobicContact CD1-CD1 4.09Å; I100-I102 HydrophobicContact CG2-CD1 3.66Å; I100-I102 HydrophobicContact CG2-CG1 3.61Å; I100-I102 PolarHBondContact O-N 2.79Å
103	V	74.5	Confident	82.1	Confident	10 Å²	10	77.2 Å²	77.2	6%	0.061	39%	0.387	C	S	.	.	S	Bend	trans	-135.5	136.8	-167.9	-164.6	0	0	0	0	109.5	I31 L97 G101 Q107 L108	I31-V103 HydrophobicContact CD1-CB 4.18Å; I31-V103 HydrophobicContact CD1-CG1 3.8Å; I31-V103 HydrophobicContact CD1-CG2 3.23Å; L97-V103 HydrophobicContact CB-CB 4.35Å; L97-V103 HydrophobicContact CB-CG2 3.95Å; L97-V103 HydrophobicContact CD1-CG2 4.32Å; L97-V103 HydrophobicContact CD2-CG2 4.06Å; L97-V103 HydrophobicContact CG-CG2 4.33Å; G101-V103 VanDerWaalsContact C-N 3.28Å; V103-Q107 HydrophobicContact CG1-CB 3.78Å; V103-L108 HydrophobicContact CG1-CB 4.38Å
104	R	78.7	Confident	81.7	Confident	185 Å²	185	81.1 Å²	81.1	70%	0.698	41%	0.407	S	S	*	.			trans	-82.6	149.8	168.2	-55.1	-177.1	-153.1	172.5	7.4	109.7	E106 Q107	R104-E106 PolarHBondContact O-N 2.97Å; R104-E106 VanDerWaalsContact O-N 3.08Å; R104-Q107 WeakPolarHBondContact O-CB 3.39Å; R104-Q107 PolarHBondContact O-N 3.18Å
105	E	74.3	Confident	81.4	Confident	152 Å²	152	83.9 Å²	83.9	71%	0.71	42%	0.419	S	S	*	.	G	3₁₀ helix	trans	-54.7	-34.2	-177.9	-168.4	171.3	-170	0	0	112.7	M98 Q107 L108	M98-E105 HydrophobicContact SD-CG 4.48Å; E105-Q107 VanDerWaalsContact C-N 3.29Å; E105-Q107 PolarHBondContact O-N 2.79Å; E105-L108 PolarHBondContact O-N 2.78Å
106	E	77.6	Confident	81	Confident	161 Å²	161	81.7 Å²	81.7	75%	0.752	41%	0.409	S	S	*	.	G	3₁₀ helix	trans	-64.8	-29.3	178.8	-61.9	172.6	-174.4	0	0	114.1	R104 L108	R104-E106 PolarHBondContact O-N 2.97Å; R104-E106 VanDerWaalsContact O-N 3.08Å; E106-L108 VanDerWaalsContact C-N 3.34Å
107	Q	80.9	Confident	80.5	Confident	59 Å²	59	85.5 Å²	85.5	28%	0.276	43%	0.429	S	S	.	.	G	3₁₀ helix	trans	-82.9	-16	-179.8	-66.4	176.8	-58.3	0	0	111.9	K30 I31 V103 R104 E105	K30-Q107 CarbonylContact C-O 3.48Å; K30-Q107 VanDerWaalsContact CA-O 3.25Å; K30-Q107 WeakPolarHBondContact CA-O 3.46Å; I31-Q107 PolarHBondContact N-O 2.78Å; V103-Q107 HydrophobicContact CG1-CB 3.78Å; R104-Q107 WeakPolarHBondContact O-CB 3.39Å; R104-Q107 PolarHBondContact O-N 3.18Å; E105-Q107 VanDerWaalsContact C-N 3.29Å; E105-Q107 PolarHBondContact O-N 2.79Å
108	L	85.9	Confident	80.2	Confident	18 Å²	18	90.8 Å²	90.8	9%	0.094	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.8	122.6	-174.9	-162.1	148.5	0	0	0	110.7	I33 C94 L97 V103 E105 E106 V110	I33-L108 HydrophobicContact CD1-CD1 4.1Å; I33-L108 HydrophobicContact CD1-CD2 3.93Å; I33-L108 HydrophobicContact CD1-CG 4.14Å; C94-L108 HydrophobicContact CB-CD1 4.29Å; C94-L108 HydrophobicContact CB-CD2 4.28Å; L97-L108 HydrophobicContact CB-CD1 4.3Å; L97-L108 HydrophobicContact CD1-CD1 3.99Å; V103-L108 HydrophobicContact CG1-CB 4.38Å; E105-L108 PolarHBondContact O-N 2.78Å; E106-L108 VanDerWaalsContact C-N 3.34Å; L108-V110 HydrophobicContact CD2-CG2 3.35Å
109	K	88.4	Confident	79.9	Confident	95 Å²	95	91.5 Å²	91.5	41%	0.413	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	106.6	177.1	-67.5	-63.4	179.4	-170.5	0	109.9	K30 I31 H32 I33	K30-K109 HydrophobicContact CB-CG 4.47Å; K30-K109 HydrophobicContact CD-CG 4.35Å; I31-K109 PolarHBondContact O-N 2.88Å; H32-K109 WeakPolarHBondContact CA-O 3.5Å; H32-K109 WeakPolarHBondContact ND1-CB 3.44Å; I33-K109 PolarHBondContact N-O 2.71Å
110	V	89.3	Confident	79.4	Confident	68 Å²	68	89.1 Å²	89.1	41%	0.412	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.8	114.9	173.9	-171.4	0	0	0	0	109.2	I33 R90 L108	I33-V110 HydrophobicContact CD1-CG2 4.47Å; R90-V110 HydrophobicContact CB-CG1 3.98Å; R90-V110 HydrophobicContact CG-CG1 4.44Å; L108-V110 HydrophobicContact CD2-CG2 3.35Å
111	H	86.5	Confident	79.2	Confident	70 Å²	70	89.7 Å²	89.7	32%	0.324	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	106.6	169.6	-58.9	-81.5	0	0	0	108.1	H32 I33 R34 I35	H32-H111 AromaticContact CE1-NE2 3.76Å; H32-H111 AromaticContact CG-NE2 3.71Å; H32-H111 AromaticContact ND1-CD2 3.72Å; H32-H111 AromaticContact ND1-CE1 3.98Å; H32-H111 AromaticContact ND1-NE2 2.92Å; H32-H111 PolarHBondContact ND1-NE2 3.02Å; I33-H111 PolarHBondContact O-N 2.75Å; R34-H111 HydrophobicContact CB-CB 4.44Å; R34-H111 HydrophobicContact CG-CB 4.02Å; I35-H111 PolarHBondContact N-O 2.67Å
112	G	79.8	Confident	79.4	Confident	41 Å²	41	92.1 Å²	92.1	42%	0.423	44%	0.439	S	S	.	.			trans	-91.1	172.5	172.4	0	0	0	0	0	112
113	F	63.4	Low	79.9	Confident	210 Å²	210	97.2 Å²	97.2	92%	0.921	46%	0.462	S	S	*	.			trans	-62.2	0	157.9	-110.9	-88.9	0	0	0	110.7	I35 Q37	I35-F113 HydrophobicContact CG2-CD2 4.24Å; Q37-F113 HydrophobicContact CB-CE2 4.09Å; Q37-F113 HydrophobicContact CB-CZ 4.34Å

Retrieved 113 of 113 residues in 91.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).