A0A060X350_ONCMY Loading...

Transmembrane protein 256

AlphaFold DB , UniProt , Accession A0A060X350, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LOC110500528, Length 114 aa.

						>A0A060X350_ONCMY|A0A060X350|LOC110500528
MATSLVVQRLAGVSGALAVAAGAYGAHGFKNKDPEDYSRLLYETANKYHFYHSIALLGASRCRKPAVAGTLLVLGTGAFCGSLYHQALTEDPVLRKLAPYGGMFLIAGWLAIAI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66	Low	92.5	Very high	220 Å²	220	80.3 Å²	80.3	100%	1.084	43%	0.427	S	S	*	.				0	-55.4	0	-108.7	179.5	174.9	0	0	112.9	T3 S4 L5	M1-T3 PolarHBondContact O-N 3.19Å; M1-S4 PolarHBondContact O-N 3.24Å; M1-L5 PolarHBondContact O-N 3.42Å
2	A	85.8	Confident	93	Very high	75 Å²	75	77.5 Å²	77.5	62%	0.62	43%	0.432	S	S	*	.	H	α-helix	trans	-58.2	-46.9	-175.7	0	0	0	0	0	114.7	S4 L5 V6	A2-S4 PolarHBondContact O-N 3.29Å; A2-L5 PolarHBondContact O-N 3.35Å; A2-V6 WeakPolarHBondContact O-CG2 3.41Å; A2-V6 PolarHBondContact O-N 2.96Å; A2-V6 VanDerWaalsContact O-N 3.09Å
3	T	89.4	Confident	93.4	Very high	69 Å²	69	78.4 Å²	78.4	42%	0.423	44%	0.44	S	S	.	.	H	α-helix	trans	-61	-42.5	179.5	-47.6	0	0	0	0	113	M1 L5 V6 V7 P65 A66	M1-T3 PolarHBondContact O-N 3.19Å; T3-L5 VanDerWaalsContact C-N 3.3Å; T3-L5 PolarHBondContact O-N 3.41Å; T3-V6 PolarHBondContact O-N 3.42Å; T3-V7 WeakPolarHBondContact O-CG2 3.49Å; T3-V7 PolarHBondContact O-N 3.09Å; T3-P65 HydrophobicContact CG2-CG 4.38Å; T3-A66 HydrophobicContact CG2-CB 3.56Å
4	S	92.8	Very high	93.8	Very high	30 Å²	30	74 Å²	74	21%	0.21	42%	0.417	C	S	.	.	H	α-helix	trans	-59.5	-42.9	178.1	168.5	0	0	0	0	111	M1 A2 V6 V7 Q8 S60	M1-S4 PolarHBondContact O-N 3.24Å; A2-S4 PolarHBondContact O-N 3.29Å; S4-V6 PolarHBondContact O-N 3Å; S4-V7 PolarHBondContact O-N 3.23Å; S4-Q8 WeakPolarHBondContact O-CB 3.27Å; S4-Q8 PolarHBondContact O-N 2.91Å; S4-S60 VanDerWaalsContact CB-O 3.28Å; S4-S60 WeakPolarHBondContact CB-O 3.36Å; S4-S60 PolarHBondContact OG-O 2.72Å
5	L	96	Very high	94.1	Very high	77 Å²	77	70.3 Å²	70.3	40%	0.403	40%	0.402	S	S	.	.	H	α-helix	trans	-64.1	-40.7	176.1	-176.8	64	0	0	0	112.3	M1 A2 T3 Q8 R9	M1-L5 PolarHBondContact O-N 3.42Å; A2-L5 PolarHBondContact O-N 3.35Å; T3-L5 VanDerWaalsContact C-N 3.3Å; T3-L5 PolarHBondContact O-N 3.41Å; L5-Q8 PolarHBondContact O-N 3.34Å; L5-R9 WeakPolarHBondContact O-CG 3.34Å; L5-R9 PolarHBondContact O-N 3.18Å
6	V	97.4	Very high	94.4	Very high	80 Å²	80	69.7 Å²	69.7	49%	0.485	41%	0.408	S	S	.	.	H	α-helix	trans	-61.3	-48.5	175.6	173.1	0	0	0	0	110.5	A2 T3 S4 Q8 R9 L10	A2-V6 WeakPolarHBondContact O-CG2 3.41Å; A2-V6 PolarHBondContact O-N 2.96Å; A2-V6 VanDerWaalsContact O-N 3.09Å; T3-V6 PolarHBondContact O-N 3.42Å; S4-V6 PolarHBondContact O-N 3Å; V6-Q8 VanDerWaalsContact C-N 3.31Å; V6-Q8 PolarHBondContact O-N 3.47Å; V6-R9 PolarHBondContact O-N 3.15Å; V6-L10 HydrophobicContact CG1-CD1 4.02Å; V6-L10 HydrophobicContact CG1-CG 4.41Å; V6-L10 WeakPolarHBondContact O-CG 3.41Å; V6-L10 PolarHBondContact O-N 2.94Å
7	V	97.3	Very high	94.6	Very high	6 Å²	6	71.6 Å²	71.6	4%	0.036	42%	0.416	C	S	.	.	H	α-helix	trans	-60.9	-41.4	178.1	175.2	0	0	0	0	111.2	T3 S4 R9 L10 A11 L56 A59 P65	T3-V7 WeakPolarHBondContact O-CG2 3.49Å; T3-V7 PolarHBondContact O-N 3.09Å; S4-V7 PolarHBondContact O-N 3.23Å; V7-R9 PolarHBondContact O-N 3.4Å; V7-L10 PolarHBondContact O-N 3.49Å; V7-A11 WeakPolarHBondContact O-CB 3.28Å; V7-A11 PolarHBondContact O-N 3.37Å; V7-L56 HydrophobicContact CG1-CD1 3.81Å; V7-L56 HydrophobicContact CG1-CG 4.06Å; V7-L56 WeakPolarHBondContact CG1-O 3.45Å; V7-A59 HydrophobicContact CG1-CB 4.35Å; V7-P65 HydrophobicContact CG2-CB 4.47Å; V7-P65 WeakPolarHBondContact CG2-O 3.34Å
8	Q	97.9	Very high	94.9	Very high	74 Å²	74	67.7 Å²	67.7	35%	0.346	39%	0.393	S	S	.	.	H	α-helix	trans	-62.5	-41.9	175.8	-173.5	179.8	1	0	0	112.4	S4 L5 V6 A11 G12 L57	S4-Q8 WeakPolarHBondContact O-CB 3.27Å; S4-Q8 PolarHBondContact O-N 2.91Å; L5-Q8 PolarHBondContact O-N 3.34Å; V6-Q8 VanDerWaalsContact C-N 3.31Å; V6-Q8 PolarHBondContact O-N 3.47Å; Q8-A11 WeakPolarHBondContact O-CB 3.25Å; Q8-A11 PolarHBondContact O-N 2.9Å; Q8-G12 PolarHBondContact O-N 3.5Å; Q8-L57 HydrophobicContact CG-CD1 3.96Å
9	R	98.2	Very high	95	Very high	169 Å²	169	68.6 Å²	68.6	64%	0.638	40%	0.399	S	S	*	.	H	α-helix	trans	-65.2	-43	176	-73.4	174.7	177.1	-177	-1.3	111.6	L5 V6 V7 A11 G12 V13	L5-R9 WeakPolarHBondContact O-CG 3.34Å; L5-R9 PolarHBondContact O-N 3.18Å; V6-R9 PolarHBondContact O-N 3.15Å; V7-R9 PolarHBondContact O-N 3.4Å; R9-A11 VanDerWaalsContact C-N 3.28Å; R9-A11 PolarHBondContact O-N 3.34Å; R9-G12 PolarHBondContact O-N 2.59Å; R9-G12 VanDerWaalsContact O-N 3.16Å; R9-V13 WeakPolarHBondContact O-CG2 3.43Å; R9-V13 PolarHBondContact O-N 3.08Å
10	L	98.3	Very high	95.2	Very high	77 Å²	77	68.2 Å²	68.2	40%	0.403	40%	0.404	S	S	.	.	H	α-helix	trans	-60.7	-39	174.3	-68.8	172.7	0	0	0	111.3	V6 V7 V13 S14 L56 V73	V6-L10 HydrophobicContact CG1-CD1 4.02Å; V6-L10 HydrophobicContact CG1-CG 4.41Å; V6-L10 WeakPolarHBondContact O-CG 3.41Å; V6-L10 PolarHBondContact O-N 2.94Å; V7-L10 PolarHBondContact O-N 3.49Å; L10-V13 PolarHBondContact O-N 3.19Å; L10-S14 WeakPolarHBondContact O-CB 3.35Å; L10-S14 PolarHBondContact O-N 3.19Å; L10-L56 HydrophobicContact CB-CD2 3.9Å; L10-V73 HydrophobicContact CD1-CG2 4.27Å
11	A	98.3	Very high	95.3	Very high	6 Å²	6	65.6 Å²	65.6	5%	0.05	39%	0.391	C	S	.	.	H	α-helix	trans	-61.3	-43.3	173.4	0	0	0	0	0	112.3	V7 Q8 R9 S14 G15 L56 L57	V7-A11 WeakPolarHBondContact O-CB 3.28Å; V7-A11 PolarHBondContact O-N 3.37Å; Q8-A11 WeakPolarHBondContact O-CB 3.25Å; Q8-A11 PolarHBondContact O-N 2.9Å; R9-A11 VanDerWaalsContact C-N 3.28Å; R9-A11 PolarHBondContact O-N 3.34Å; A11-S14 PolarHBondContact O-N 2.91Å; A11-G15 PolarHBondContact O-N 3.39Å; A11-L56 HydrophobicContact CB-CB 3.86Å; A11-L56 HydrophobicContact CB-CD2 4.19Å; A11-L56 HydrophobicContact CB-CG 3.93Å; A11-L57 HydrophobicContact CB-CB 3.89Å; A11-L57 HydrophobicContact CB-CD1 4.28Å; A11-L57 VanDerWaalsContact CB-N 3.32Å
12	G	98.6	Very high	96.8	Very high	47 Å²	47	56 Å²	56	49%	0.485	35%	0.348	S	S	.	.	H	α-helix	trans	-61.4	-46.9	175.7	0	0	0	0	0	112.7	Q8 R9 G15 A16	Q8-G12 PolarHBondContact O-N 3.5Å; R9-G12 PolarHBondContact O-N 2.59Å; R9-G12 VanDerWaalsContact O-N 3.16Å; G12-G15 PolarHBondContact O-N 2.96Å; G12-A16 PolarHBondContact O-N 2.97Å
13	V	98.7	Very high	97.3	Very high	89 Å²	89	55 Å²	55	54%	0.539	34%	0.34	S	S	.	.	H	α-helix	trans	-64.4	-47.3	177.4	174	0	0	0	0	111.1	R9 L10 G15 A16 L17	R9-V13 WeakPolarHBondContact O-CG2 3.43Å; R9-V13 PolarHBondContact O-N 3.08Å; L10-V13 PolarHBondContact O-N 3.19Å; V13-G15 VanDerWaalsContact C-N 3.33Å; V13-G15 PolarHBondContact O-N 3.39Å; V13-A16 PolarHBondContact O-N 3.48Å; V13-L17 HydrophobicContact CG1-CD1 4.16Å; V13-L17 WeakPolarHBondContact O-CG 3.35Å; V13-L17 PolarHBondContact O-N 2.84Å
14	S	98.6	Very high	97.6	Very high	17 Å²	17	57.5 Å²	57.5	12%	0.119	34%	0.342	C	S	.	.	H	α-helix	trans	-58.6	-45	177.5	-172.1	0	0	0	0	111.3	L10 A11 A16 L17 A18 H49 S53	L10-S14 WeakPolarHBondContact O-CB 3.35Å; L10-S14 PolarHBondContact O-N 3.19Å; A11-S14 PolarHBondContact O-N 2.91Å; S14-A16 PolarHBondContact O-N 3.08Å; S14-L17 PolarHBondContact O-N 3.17Å; S14-A18 WeakPolarHBondContact O-CB 3.44Å; S14-A18 PolarHBondContact O-N 3.11Å; S14-H49 PolarHBondContact O-NE2 3.48Å; S14-H49 PolarHBondContact OG-NE2 2.86Å; S14-S53 VanDerWaalsContact C-OG 3.23Å; S14-S53 WeakPolarHBondContact CB-OG 3.41Å; S14-S53 PolarHBondContact O-OG 3.49Å; S14-S53 PolarHBondContact OG-OG 2.97Å
15	G	98.6	Very high	97.6	Very high	18 Å²	18	56.5 Å²	56.5	19%	0.186	34%	0.337	C	S	.	.	H	α-helix	trans	-62.2	-42.8	176.4	0	0	0	0	0	112.8	A11 G12 V13 L17 A18 V19 S53	A11-G15 PolarHBondContact O-N 3.39Å; G12-G15 PolarHBondContact O-N 2.96Å; V13-G15 VanDerWaalsContact C-N 3.33Å; V13-G15 PolarHBondContact O-N 3.39Å; G15-L17 VanDerWaalsContact C-N 3.35Å; G15-L17 PolarHBondContact O-N 3.43Å; G15-A18 PolarHBondContact O-N 3.16Å; G15-V19 VanDerWaalsContact O-CG2 3.31Å; G15-V19 WeakPolarHBondContact O-CG2 3.43Å; G15-V19 PolarHBondContact O-N 3.45Å; G15-S53 PolarHBondContact N-OG 2.95Å
16	A	98.8	Very high	97.3	Very high	61 Å²	61	56 Å²	56	50%	0.504	34%	0.344	S	S	.	.	H	α-helix	trans	-62.3	-41.6	175.5	0	0	0	0	0	112.1	G12 V13 S14 V19 A20	G12-A16 PolarHBondContact O-N 2.97Å; V13-A16 PolarHBondContact O-N 3.48Å; S14-A16 PolarHBondContact O-N 3.08Å; A16-V19 PolarHBondContact O-N 3.42Å; A16-A20 PolarHBondContact O-N 3.4Å
17	L	98.6	Very high	97	Very high	103 Å²	103	59.1 Å²	59.1	54%	0.539	35%	0.353	S	S	.	.	H	α-helix	trans	-65.7	-38.4	174.9	-68.3	174.2	0	0	0	112	V13 S14 G15 A20 A21	V13-L17 HydrophobicContact CG1-CD1 4.16Å; V13-L17 WeakPolarHBondContact O-CG 3.35Å; V13-L17 PolarHBondContact O-N 2.84Å; S14-L17 PolarHBondContact O-N 3.17Å; G15-L17 VanDerWaalsContact C-N 3.35Å; G15-L17 PolarHBondContact O-N 3.43Å; L17-A20 PolarHBondContact O-N 3.47Å; L17-A21 WeakPolarHBondContact O-CB 3.2Å; L17-A21 PolarHBondContact O-N 3.24Å
18	A	98.5	Very high	96.4	Very high	0 Å²	0	60.9 Å²	60.9	0%	0	37%	0.372	C	S	.	.	H	α-helix	trans	-64	-41.7	174.5	0	0	0	0	0	111.4	S14 G15 A21 G22 N46 H49 F50	S14-A18 WeakPolarHBondContact O-CB 3.44Å; S14-A18 PolarHBondContact O-N 3.11Å; G15-A18 PolarHBondContact O-N 3.16Å; A18-A21 PolarHBondContact O-N 3.38Å; A18-G22 PolarHBondContact O-N 3.11Å; A18-N46 PolarHBondContact O-OD1 3.28Å; A18-H49 HydrophobicContact CB-CB 4.21Å; A18-H49 PolarHBondContact N-CE1 2.79Å; A18-F50 HydrophobicContact CB-CB 4.48Å; A18-F50 HydrophobicContact CB-CD1 4.06Å; A18-F50 HydrophobicContact CB-CD2 3.65Å; A18-F50 HydrophobicContact CB-CE1 4.23Å; A18-F50 HydrophobicContact CB-CE2 3.84Å; A18-F50 HydrophobicContact CB-CG 3.8Å; A18-F50 HydrophobicContact CB-CZ 4.15Å; A18-F50 WeakPolarHBondContact O-CE2 3.43Å
19	V	98.4	Very high	95.8	Very high	85 Å²	85	57.6 Å²	57.6	52%	0.515	36%	0.356	S	S	.	.	H	α-helix	trans	-60.3	-48.1	173.2	174.3	0	0	0	0	111	G15 A16 A21 G22 A23 F50	G15-V19 VanDerWaalsContact O-CG2 3.31Å; G15-V19 WeakPolarHBondContact O-CG2 3.43Å; G15-V19 PolarHBondContact O-N 3.45Å; A16-V19 PolarHBondContact O-N 3.42Å; V19-A21 PolarHBondContact O-N 3.41Å; V19-G22 PolarHBondContact O-N 3.29Å; V19-A23 PolarHBondContact O-N 3.33Å; V19-F50 VanDerWaalsContact CA-CZ 3.5Å; V19-F50 HydrophobicContact CB-CZ 4.04Å; V19-F50 HydrophobicContact CG2-CE1 3.75Å; V19-F50 HydrophobicContact CG2-CZ 3.42Å; V19-F50 VanDerWaalsContact CG2-CZ 3.42Å
20	A	98.4	Very high	94.7	Very high	60 Å²	60	57.1 Å²	57.1	50%	0.496	36%	0.359	S	S	.	.	H	α-helix	trans	-61.2	-44	179	0	0	0	0	0	112	A16 L17 A23 Y24	A16-A20 PolarHBondContact O-N 3.4Å; L17-A20 PolarHBondContact O-N 3.47Å; A20-A23 PolarHBondContact O-N 3.36Å; A20-Y24 PolarHBondContact O-N 2.86Å
21	A	97.6	Very high	93.6	Very high	15 Å²	15	61.2 Å²	61.2	12%	0.124	38%	0.381	C	S	.	.	H	α-helix	trans	-63.6	-43.3	175.1	0	0	0	0	0	111.6	L17 A18 V19 A23 Y24 G25 Y42 Y84	L17-A21 WeakPolarHBondContact O-CB 3.2Å; L17-A21 PolarHBondContact O-N 3.24Å; A18-A21 PolarHBondContact O-N 3.38Å; V19-A21 PolarHBondContact O-N 3.41Å; A21-A23 VanDerWaalsContact C-N 3.34Å; A21-A23 PolarHBondContact O-N 3.11Å; A21-Y24 PolarHBondContact O-N 3.14Å; A21-G25 PolarHBondContact O-N 3.39Å; A21-Y42 WeakPolarHBondContact CA-OH 3.37Å; A21-Y42 VanDerWaalsContact O-CE1 3.29Å; A21-Y42 WeakPolarHBondContact O-CE1 3.36Å; A21-Y42 PolarHBondContact O-OH 3.29Å; A21-Y84 HydrophobicContact CB-CE1 4.12Å; A21-Y84 VanDerWaalsContact CB-OH 3.23Å; A21-Y84 WeakPolarHBondContact CB-OH 3.31Å
22	G	96.8	Very high	92.3	Very high	19 Å²	19	64.3 Å²	64.3	20%	0.196	39%	0.393	C	S	.	.	H	α-helix	trans	-59.5	-42.2	175	0	0	0	0	0	113.3	A18 V19 G25 A26 N46	A18-G22 PolarHBondContact O-N 3.11Å; V19-G22 PolarHBondContact O-N 3.29Å; G22-G25 PolarHBondContact O-N 2.97Å; G22-A26 PolarHBondContact O-N 3.16Å; G22-N46 VanDerWaalsContact CA-ND2 3.28Å; G22-N46 WeakPolarHBondContact CA-ND2 3.29Å; G22-N46 PolarHBondContact N-OD1 3.5Å
23	A	96.1	Very high	91.3	Very high	53 Å²	53	68.2 Å²	68.2	44%	0.438	40%	0.403	S	S	.	.	H	α-helix	trans	-62.6	-44.3	174.4	0	0	0	0	0	111.5	V19 A20 A21 A26 H27	V19-A23 PolarHBondContact O-N 3.33Å; A20-A23 PolarHBondContact O-N 3.36Å; A21-A23 VanDerWaalsContact C-N 3.34Å; A21-A23 PolarHBondContact O-N 3.11Å; A23-A26 PolarHBondContact O-N 3.03Å; A23-H27 PolarHBondContact O-CD2 2.75Å; A23-H27 VanDerWaalsContact O-CD2 3.24Å; A23-H27 PolarHBondContact O-N 2.82Å
24	Y	95.2	Very high	89.6	Confident	122 Å²	122	69.1 Å²	69.1	48%	0.478	41%	0.411	S	S	.	.	H	α-helix	trans	-61.5	-43.9	173.8	-179	-84.8	0	0	0	111.8	A20 A21 A26 H27 G28 F29 Y42 L88	A20-Y24 PolarHBondContact O-N 2.86Å; A21-Y24 PolarHBondContact O-N 3.14Å; Y24-A26 VanDerWaalsContact C-N 3.32Å; Y24-A26 PolarHBondContact O-N 3.43Å; Y24-H27 PolarHBondContact O-N 3.4Å; Y24-G28 WeakPolarHBondContact O-CA 3.28Å; Y24-G28 PolarHBondContact O-N 3.39Å; Y24-F29 HydrophobicContact CD1-CE2 4.45Å; Y24-F29 HydrophobicContact CE1-CD2 4.49Å; Y24-F29 HydrophobicContact CE1-CE2 4.02Å; Y24-Y42 HydrophobicContact CD1-CE1 4.34Å; Y24-Y42 AromaticContact CD1-CE2 3.91Å; Y24-Y42 HydrophobicContact CD1-CE2 3.91Å; Y24-Y42 AromaticContact CD1-CZ 3.6Å; Y24-Y42 VanDerWaalsContact CD1-OH 3.28Å; Y24-Y42 WeakPolarHBondContact CD1-OH 3.46Å; Y24-Y42 HydrophobicContact CE1-CE2 4.21Å; Y24-L88 HydrophobicContact CD1-CD2 4.47Å; Y24-L88 HydrophobicContact CE1-CD2 3.54Å
25	G	92.8	Very high	88.4	Confident	9 Å²	9	77.3 Å²	77.3	9%	0.093	45%	0.447	C	S	.	.	H	α-helix	trans	-57.2	-44.3	177.8	0	0	0	0	0	112.7	A21 G22 H27	A21-G25 PolarHBondContact O-N 3.39Å; G22-G25 PolarHBondContact O-N 2.97Å; G25-H27 PolarHBondContact O-N 2.88Å
26	A	90.8	Very high	87.8	Confident	66 Å²	66	78.1 Å²	78.1	55%	0.545	45%	0.448	S	S	.	.	H	α-helix	trans	-67.6	-32.6	-179	0	0	0	0	0	113.8	G22 A23 Y24	G22-A26 PolarHBondContact O-N 3.16Å; A23-A26 PolarHBondContact O-N 3.03Å; Y24-A26 VanDerWaalsContact C-N 3.32Å; Y24-A26 PolarHBondContact O-N 3.43Å
27	H	90.2	Very high	87.4	Confident	146 Å²	146	81 Å²	81	68%	0.676	45%	0.446	S	S	*	.	H	α-helix	trans	-103.8	-39.1	-174.9	-67.9	-67.3	0	0	0	113.8	A23 Y24 G25 K30	A23-H27 PolarHBondContact O-CD2 2.75Å; A23-H27 VanDerWaalsContact O-CD2 3.24Å; A23-H27 PolarHBondContact O-N 2.82Å; Y24-H27 PolarHBondContact O-N 3.4Å; G25-H27 PolarHBondContact O-N 2.88Å; H27-K30 WeakPolarHBondContact O-CB 3.36Å; H27-K30 PolarHBondContact O-N 3.31Å
28	G	86.3	Confident	87.1	Confident	42 Å²	42	76.6 Å²	76.6	43%	0.433	42%	0.424	S	S	.	.	H	α-helix	trans	-72.9	-27.8	-176.6	0	0	0	0	0	114.1	Y24	Y24-G28 WeakPolarHBondContact O-CA 3.28Å; Y24-G28 PolarHBondContact O-N 3.39Å
29	F	83.4	Confident	86.8	Confident	6 Å²	6	79.8 Å²	79.8	3%	0.026	44%	0.436	C	S	.	.	T	Hydrogen-bonded Turn	trans	-95.9	8.4	176.7	-72.7	-95.3	0	0	0	113.6	Y24 N31 K32 R39 Y42 L88	Y24-F29 HydrophobicContact CD1-CE2 4.45Å; Y24-F29 HydrophobicContact CE1-CD2 4.49Å; Y24-F29 HydrophobicContact CE1-CE2 4.02Å; F29-N31 PolarHBondContact O-N 3.34Å; F29-N31 VanDerWaalsContact O-N 3.11Å; F29-K32 HydrophobicContact CD1-CB 4.43Å; F29-K32 HydrophobicContact CD1-CD 3.82Å; F29-K32 HydrophobicContact CD1-CG 4.24Å; F29-K32 HydrophobicContact CE1-CD 4.15Å; F29-K32 PolarHBondContact O-N 2.86Å; F29-R39 HydrophobicContact CB-CG 4.12Å; F29-R39 HydrophobicContact CD1-CB 3.73Å; F29-R39 HydrophobicContact CD1-CG 4.06Å; F29-R39 HydrophobicContact CE1-CB 4.22Å; F29-R39 HydrophobicContact CG-CB 4.38Å; F29-R39 HydrophobicContact CG-CG 4.21Å; F29-Y42 HydrophobicContact CD2-CD1 4.47Å; F29-Y42 HydrophobicContact CD2-CG 4.32Å; F29-Y42 HydrophobicContact CE2-CD1 4.01Å; F29-Y42 AromaticContact CE2-CD2 3.52Å; F29-Y42 HydrophobicContact CE2-CD2 3.52Å; F29-Y42 HydrophobicContact CE2-CE2 4.06Å; F29-Y42 AromaticContact CE2-CG 3.5Å; F29-Y42 HydrophobicContact CE2-CG 3.5Å; F29-Y42 VanDerWaalsContact CE2-CG 3.5Å; F29-Y42 AromaticContact CZ-CD2 3.84Å; F29-Y42 HydrophobicContact CZ-CD2 3.84Å; F29-Y42 AromaticContact CZ-CG 3.92Å; F29-Y42 HydrophobicContact CZ-CG 3.92Å; F29-L88 HydrophobicContact CZ-CD2 4.5Å
30	K	75.2	Confident	86.6	Confident	159 Å²	159	80.6 Å²	80.6	69%	0.691	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.7	-30.8	-172.8	-173.6	179.5	177.7	-174.4	0	114.2	H27	H27-K30 WeakPolarHBondContact O-CB 3.36Å; H27-K30 PolarHBondContact O-N 3.31Å
31	N	75.6	Confident	86.5	Confident	162 Å²	162	78.5 Å²	78.5	87%	0.866	42%	0.417	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.5	5.7	-178.5	-62.9	-16.2	0	0	0	113.4	F29	F29-N31 PolarHBondContact O-N 3.34Å; F29-N31 VanDerWaalsContact O-N 3.11Å
32	K	72.2	Confident	86.4	Confident	71 Å²	71	78.3 Å²	78.3	31%	0.309	41%	0.413	S	S	.	.	S	Bend	trans	-93.8	148.2	175.2	-64.5	-147.2	-176.4	-171.1	0	110.1	F29 D36 E90	F29-K32 HydrophobicContact CD1-CB 4.43Å; F29-K32 HydrophobicContact CD1-CD 3.82Å; F29-K32 HydrophobicContact CD1-CG 4.24Å; F29-K32 HydrophobicContact CE1-CD 4.15Å; F29-K32 PolarHBondContact O-N 2.86Å; K32-D36 HydrophobicContact CB-CB 4.41Å; K32-D36 WeakPolarHBondContact CD-OD2 3.43Å; K32-D36 IonicContact NZ-OD2 3.89Å; K32-D36 PolarHBondContact NZ-OD2 3.34Å; K32-E90 IonicContact NZ-OE1 3.55Å; K32-E90 PolarHBondContact NZ-OE1 2.9Å
33	D	76	Confident	86.4	Confident	129 Å²	129	81.9 Å²	81.9	69%	0.69	43%	0.425	S	S	*	.			trans	-56.8	143.4	178.1	-86.4	-41.6	0	0	0	111.4	E35 D36	D33-E35 PolarHBondContact O-N 3.39Å; D33-E35 VanDerWaalsContact O-N 3.12Å; D33-D36 VanDerWaalsContact O-CB 3.27Å; D33-D36 WeakPolarHBondContact O-CB 3.46Å; D33-D36 PolarHBondContact O-N 3.16Å
34	P	63.8	Low	86.4	Confident	109 Å²	109	81.2 Å²	81.2	71%	0.708	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.7	-25.5	176.7	-22.3	32.5	0	0	0	113.3
35	E	72.3	Confident	86.5	Confident	188 Å²	188	75.4 Å²	75.4	88%	0.879	39%	0.393	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.1	3.7	179.3	-62.2	-179.7	-176.3	0	0	113.2	D33 Y37	D33-E35 PolarHBondContact O-N 3.39Å; D33-E35 VanDerWaalsContact O-N 3.12Å; E35-Y37 PolarHBondContact O-N 3.33Å; E35-Y37 VanDerWaalsContact O-N 3.13Å
36	D	86.6	Confident	86.8	Confident	36 Å²	36	76.2 Å²	76.2	19%	0.193	40%	0.395	C	S	.	.			trans	-62.9	117.4	177.6	179.5	12.1	0	0	0	110.8	K32 D33 S38 R39 L40	K32-D36 HydrophobicContact CB-CB 4.41Å; K32-D36 WeakPolarHBondContact CD-OD2 3.43Å; K32-D36 IonicContact NZ-OD2 3.89Å; K32-D36 PolarHBondContact NZ-OD2 3.34Å; D33-D36 VanDerWaalsContact O-CB 3.27Å; D33-D36 WeakPolarHBondContact O-CB 3.46Å; D33-D36 PolarHBondContact O-N 3.16Å; D36-S38 PolarHBondContact O-N 3.04Å; D36-S38 WeakPolarHBondContact OD1-CB 3.07Å; D36-S38 PolarHBondContact OD1-N 3.18Å; D36-R39 HydrophobicContact CB-CB 4.15Å; D36-R39 WeakPolarHBondContact O-CB 3.44Å; D36-R39 PolarHBondContact O-N 2.63Å; D36-L40 PolarHBondContact O-N 3.11Å
37	Y	90.6	Very high	87.2	Confident	122 Å²	122	77.9 Å²	77.9	48%	0.478	39%	0.39	S	S	.	.	H	α-helix	trans	-53.5	-37.1	176.1	-178.9	-112	0	0	0	112.4	E35 R39 L40 L41	E35-Y37 PolarHBondContact O-N 3.33Å; E35-Y37 VanDerWaalsContact O-N 3.13Å; Y37-R39 VanDerWaalsContact C-N 3.33Å; Y37-R39 PolarHBondContact O-N 3.12Å; Y37-L40 WeakPolarHBondContact O-CB 3.24Å; Y37-L40 PolarHBondContact O-N 2.96Å; Y37-L41 HydrophobicContact CD1-CD1 4.02Å; Y37-L41 HydrophobicContact CD1-CG 4.27Å; Y37-L41 HydrophobicContact CE1-CD1 3.5Å; Y37-L41 HydrophobicContact CE1-CD2 4.31Å; Y37-L41 HydrophobicContact CE1-CG 3.92Å; Y37-L41 HydrophobicContact CE2-CD2 4.13Å; Y37-L41 HydrophobicContact CE2-CG 4.29Å; Y37-L41 WeakPolarHBondContact O-CG 3.48Å; Y37-L41 PolarHBondContact O-N 2.77Å
38	S	92.1	Very high	87.6	Confident	10 Å²	10	75.2 Å²	75.2	7%	0.07	37%	0.374	C	S	.	.	H	α-helix	trans	-65.2	-38.6	178.3	-61.6	0	0	0	0	111.8	D36 L41 Y42 A87	D36-S38 PolarHBondContact O-N 3.04Å; D36-S38 WeakPolarHBondContact OD1-CB 3.07Å; D36-S38 PolarHBondContact OD1-N 3.18Å; S38-L41 PolarHBondContact O-N 3.22Å; S38-Y42 WeakPolarHBondContact O-CB 3.4Å; S38-Y42 PolarHBondContact O-N 3.41Å; S38-A87 WeakPolarHBondContact O-CB 3.28Å
39	R	92.6	Very high	88.2	Confident	66 Å²	66	74.2 Å²	74.2	25%	0.249	36%	0.358	C	S	.	.	H	α-helix	trans	-64.4	-45.2	173.5	-175.8	-180	176.3	159.3	-0.9	111.1	F29 D36 Y37 L41 Y42 E43	F29-R39 HydrophobicContact CB-CG 4.12Å; F29-R39 HydrophobicContact CD1-CB 3.73Å; F29-R39 HydrophobicContact CD1-CG 4.06Å; F29-R39 HydrophobicContact CE1-CB 4.22Å; F29-R39 HydrophobicContact CG-CB 4.38Å; F29-R39 HydrophobicContact CG-CG 4.21Å; D36-R39 HydrophobicContact CB-CB 4.15Å; D36-R39 WeakPolarHBondContact O-CB 3.44Å; D36-R39 PolarHBondContact O-N 2.63Å; Y37-R39 VanDerWaalsContact C-N 3.33Å; Y37-R39 PolarHBondContact O-N 3.12Å; R39-L41 VanDerWaalsContact C-N 3.31Å; R39-L41 PolarHBondContact O-N 3.49Å; R39-Y42 WeakPolarHBondContact O-CB 3.16Å; R39-Y42 PolarHBondContact O-N 2.95Å; R39-Y42 VanDerWaalsContact O-N 3.17Å; R39-E43 HydrophobicContact CG-CG 4.4Å; R39-E43 IonicContact CZ-OE1 3.23Å; R39-E43 IonicContact NE-OE1 2.9Å; R39-E43 PolarHBondContact NE-OE1 2.85Å; R39-E43 IonicContact NH2-OE1 3.34Å; R39-E43 WeakPolarHBondContact O-CG 3.27Å; R39-E43 PolarHBondContact O-N 2.65Å
40	L	93.9	Very high	88.9	Confident	103 Å²	103	77.1 Å²	77.1	54%	0.539	37%	0.371	S	S	.	.	H	α-helix	trans	-58.6	-43.1	176.5	178.5	66.5	0	0	0	111.9	D36 Y37 T44	D36-L40 PolarHBondContact O-N 3.11Å; Y37-L40 WeakPolarHBondContact O-CB 3.24Å; Y37-L40 PolarHBondContact O-N 2.96Å; L40-T44 VanDerWaalsContact O-CB 3.3Å; L40-T44 WeakPolarHBondContact O-CB 3.42Å; L40-T44 PolarHBondContact O-N 2.87Å; L40-T44 PolarHBondContact O-OG1 3.35Å
41	L	95.7	Very high	90	Very high	15 Å²	15	76 Å²	76	8%	0.079	36%	0.364	C	S	.	.	H	α-helix	trans	-62.3	-45.2	175.2	-71.3	-172.3	0	0	0	111.6	Y37 S38 R39 T44 A45 L83 Q86 A87	Y37-L41 HydrophobicContact CD1-CD1 4.02Å; Y37-L41 HydrophobicContact CD1-CG 4.27Å; Y37-L41 HydrophobicContact CE1-CD1 3.5Å; Y37-L41 HydrophobicContact CE1-CD2 4.31Å; Y37-L41 HydrophobicContact CE1-CG 3.92Å; Y37-L41 HydrophobicContact CE2-CD2 4.13Å; Y37-L41 HydrophobicContact CE2-CG 4.29Å; Y37-L41 WeakPolarHBondContact O-CG 3.48Å; Y37-L41 PolarHBondContact O-N 2.77Å; S38-L41 PolarHBondContact O-N 3.22Å; R39-L41 VanDerWaalsContact C-N 3.31Å; R39-L41 PolarHBondContact O-N 3.49Å; L41-T44 PolarHBondContact O-N 3.45Å; L41-A45 WeakPolarHBondContact O-CB 3.48Å; L41-A45 PolarHBondContact O-N 3.41Å; L41-L83 HydrophobicContact CD2-CD2 4.17Å; L41-Q86 HydrophobicContact CD1-CB 4.03Å; L41-Q86 HydrophobicContact CD1-CG 3.68Å; L41-A87 HydrophobicContact CB-CB 4.02Å
42	Y	96.6	Very high	91.1	Very high	11 Å²	11	68.8 Å²	68.8	4%	0.043	33%	0.325	C	S	.	.	H	α-helix	trans	-61.4	-48.7	178.9	-163.2	-83.7	0	0	0	112	A21 Y24 F29 S38 R39 T44 A45 N46 Y84 A87 L88	A21-Y42 WeakPolarHBondContact CA-OH 3.37Å; A21-Y42 VanDerWaalsContact O-CE1 3.29Å; A21-Y42 WeakPolarHBondContact O-CE1 3.36Å; A21-Y42 PolarHBondContact O-OH 3.29Å; Y24-Y42 HydrophobicContact CD1-CE1 4.34Å; Y24-Y42 AromaticContact CD1-CE2 3.91Å; Y24-Y42 HydrophobicContact CD1-CE2 3.91Å; Y24-Y42 AromaticContact CD1-CZ 3.6Å; Y24-Y42 VanDerWaalsContact CD1-OH 3.28Å; Y24-Y42 WeakPolarHBondContact CD1-OH 3.46Å; Y24-Y42 HydrophobicContact CE1-CE2 4.21Å; F29-Y42 HydrophobicContact CD2-CD1 4.47Å; F29-Y42 HydrophobicContact CD2-CG 4.32Å; F29-Y42 HydrophobicContact CE2-CD1 4.01Å; F29-Y42 AromaticContact CE2-CD2 3.52Å; F29-Y42 HydrophobicContact CE2-CD2 3.52Å; F29-Y42 HydrophobicContact CE2-CE2 4.06Å; F29-Y42 AromaticContact CE2-CG 3.5Å; F29-Y42 HydrophobicContact CE2-CG 3.5Å; F29-Y42 VanDerWaalsContact CE2-CG 3.5Å; F29-Y42 AromaticContact CZ-CD2 3.84Å; F29-Y42 HydrophobicContact CZ-CD2 3.84Å; F29-Y42 AromaticContact CZ-CG 3.92Å; F29-Y42 HydrophobicContact CZ-CG 3.92Å; S38-Y42 WeakPolarHBondContact O-CB 3.4Å; S38-Y42 PolarHBondContact O-N 3.41Å; R39-Y42 WeakPolarHBondContact O-CB 3.16Å; R39-Y42 PolarHBondContact O-N 2.95Å; R39-Y42 VanDerWaalsContact O-N 3.17Å; Y42-T44 VanDerWaalsContact C-N 3.31Å; Y42-T44 PolarHBondContact O-N 3.4Å; Y42-A45 WeakPolarHBondContact O-CB 3.41Å; Y42-A45 PolarHBondContact O-N 2.83Å; Y42-N46 WeakPolarHBondContact O-CB 3.15Å; Y42-N46 PolarHBondContact O-N 2.85Å; Y42-Y84 HydrophobicContact CD1-CE1 4.18Å; Y42-Y84 AromaticContact CD2-CD1 3.65Å; Y42-Y84 HydrophobicContact CD2-CD1 3.65Å; Y42-Y84 HydrophobicContact CD2-CE1 4.09Å; Y42-Y84 HydrophobicContact CE1-CD1 4.38Å; Y42-Y84 AromaticContact CE1-CE1 3.86Å; Y42-Y84 HydrophobicContact CE1-CE1 3.86Å; Y42-Y84 AromaticContact CE2-CD1 3.48Å; Y42-Y84 HydrophobicContact CE2-CD1 3.48Å; Y42-Y84 VanDerWaalsContact CE2-CD1 3.48Å; Y42-Y84 AromaticContact CE2-CE1 3.79Å; Y42-Y84 HydrophobicContact CE2-CE1 3.79Å; Y42-Y84 HydrophobicContact CG-CD1 4.18Å; Y42-Y84 HydrophobicContact CG-CE1 4.26Å; Y42-Y84 AromaticContact CZ-CD1 3.87Å; Y42-Y84 AromaticContact CZ-CE1 3.65Å; Y42-A87 HydrophobicContact CD2-CB 3.98Å; Y42-A87 HydrophobicContact CG-CB 4.39Å; Y42-L88 HydrophobicContact CD2-CD2 4.18Å; Y42-L88 HydrophobicContact CD2-CG 4.33Å; Y42-L88 HydrophobicContact CE2-CD1 4.36Å; Y42-L88 HydrophobicContact CE2-CD2 3.9Å; Y42-L88 HydrophobicContact CE2-CG 4.14Å
43	E	95.8	Very high	92.3	Very high	94 Å²	94	65.7 Å²	65.7	44%	0.439	31%	0.312	S	S	.	.	H	α-helix	trans	-63.5	-38.9	179.3	-71.7	-179.4	-175	0	0	111.2	R39 N46 K47	R39-E43 HydrophobicContact CG-CG 4.4Å; R39-E43 IonicContact CZ-OE1 3.23Å; R39-E43 IonicContact NE-OE1 2.9Å; R39-E43 PolarHBondContact NE-OE1 2.85Å; R39-E43 IonicContact NH2-OE1 3.34Å; R39-E43 WeakPolarHBondContact O-CG 3.27Å; R39-E43 PolarHBondContact O-N 2.65Å; E43-N46 PolarHBondContact O-N 3.09Å; E43-K47 VanDerWaalsContact O-CB 3.32Å; E43-K47 WeakPolarHBondContact O-CB 3.44Å; E43-K47 PolarHBondContact O-N 3.24Å
44	T	97.1	Very high	93.4	Very high	39 Å²	39	64.9 Å²	64.9	24%	0.239	31%	0.306	C	S	.	.	H	α-helix	trans	-63.1	-47.8	173.8	-61.1	0	0	0	0	111.3	L40 L41 Y42 N46 K47 Y48 L83	L40-T44 VanDerWaalsContact O-CB 3.3Å; L40-T44 WeakPolarHBondContact O-CB 3.42Å; L40-T44 PolarHBondContact O-N 2.87Å; L40-T44 PolarHBondContact O-OG1 3.35Å; L41-T44 PolarHBondContact O-N 3.45Å; Y42-T44 VanDerWaalsContact C-N 3.31Å; Y42-T44 PolarHBondContact O-N 3.4Å; T44-N46 VanDerWaalsContact C-N 3.32Å; T44-N46 PolarHBondContact O-N 2.87Å; T44-K47 PolarHBondContact O-N 2.97Å; T44-Y48 HydrophobicContact CG2-CD2 4.14Å; T44-Y48 HydrophobicContact CG2-CE2 4.23Å; T44-Y48 WeakPolarHBondContact O-CD2 3.16Å; T44-Y48 PolarHBondContact O-N 3.39Å; T44-Y48 VanDerWaalsContact O-N 3.08Å; T44-L83 HydrophobicContact CG2-CD1 3.99Å
45	A	98.1	Very high	95	Very high	0 Å²	0	60 Å²	60	0%	0	28%	0.275	C	S	.	.	H	α-helix	trans	-57.2	-46.5	176.8	0	0	0	0	0	111.3	L41 Y42 Y48 H49 C80 L83 Y84	L41-A45 WeakPolarHBondContact O-CB 3.48Å; L41-A45 PolarHBondContact O-N 3.41Å; Y42-A45 WeakPolarHBondContact O-CB 3.41Å; Y42-A45 PolarHBondContact O-N 2.83Å; A45-Y48 PolarHBondContact O-N 2.92Å; A45-H49 VanDerWaalsContact O-CB 3.27Å; A45-H49 WeakPolarHBondContact O-CB 3.2Å; A45-H49 PolarHBondContact O-N 3.26Å; A45-C80 HydrophobicContact CB-CB 4.45Å; A45-C80 PolarHBondContact O-SG 2.84Å; A45-L83 HydrophobicContact CB-CB 3.62Å; A45-L83 HydrophobicContact CB-CD1 4.42Å; A45-Y84 HydrophobicContact CB-CD1 3.61Å; A45-Y84 HydrophobicContact CB-CD2 4.06Å; A45-Y84 HydrophobicContact CB-CE1 3.61Å; A45-Y84 HydrophobicContact CB-CE2 4.04Å; A45-Y84 HydrophobicContact CB-CG 3.86Å
46	N	98.5	Very high	96.3	Very high	27 Å²	27	51.2 Å²	51.2	14%	0.144	23%	0.234	C	C	.	.	H	α-helix	trans	-67.4	-41.2	-179.4	-173.1	56.9	0	0	0	113.8	A18 G22 Y42 E43 T44 Y48 H49 F50 Y84	A18-N46 PolarHBondContact O-OD1 3.28Å; G22-N46 VanDerWaalsContact CA-ND2 3.28Å; G22-N46 WeakPolarHBondContact CA-ND2 3.29Å; G22-N46 PolarHBondContact N-OD1 3.5Å; Y42-N46 WeakPolarHBondContact O-CB 3.15Å; Y42-N46 PolarHBondContact O-N 2.85Å; E43-N46 PolarHBondContact O-N 3.09Å; T44-N46 VanDerWaalsContact C-N 3.32Å; T44-N46 PolarHBondContact O-N 2.87Å; N46-Y48 PolarHBondContact O-N 3.12Å; N46-H49 PolarHBondContact O-N 3.34Å; N46-F50 PolarHBondContact O-N 3.29Å; N46-Y84 WeakPolarHBondContact CA-OH 3.44Å; N46-Y84 HydrophobicContact CB-CE1 4.16Å; N46-Y84 VanDerWaalsContact CB-OH 3.28Å; N46-Y84 WeakPolarHBondContact CB-OH 3.47Å; N46-Y84 PolarHBondContact N-OH 3.47Å; N46-Y84 PolarHBondContact OD1-OH 3.41Å
47	K	98.4	Very high	96.8	Very high	100 Å²	100	53.7 Å²	53.7	44%	0.435	25%	0.247	S	C	.	.	H	α-helix	trans	-58.3	-48.9	174.9	-176.2	176.3	68	-177.9	0	111.3	E43 T44 F50 Y51	E43-K47 VanDerWaalsContact O-CB 3.32Å; E43-K47 WeakPolarHBondContact O-CB 3.44Å; E43-K47 PolarHBondContact O-N 3.24Å; T44-K47 PolarHBondContact O-N 2.97Å; K47-F50 PolarHBondContact O-N 2.93Å; K47-Y51 HydrophobicContact CD-CE2 3.87Å; K47-Y51 HydrophobicContact CG-CD2 4.05Å; K47-Y51 HydrophobicContact CG-CE1 4.42Å; K47-Y51 HydrophobicContact CG-CE2 3.42Å; K47-Y51 VanDerWaalsContact CG-CE2 3.42Å; K47-Y51 WeakPolarHBondContact O-CD2 3.14Å; K47-Y51 VanDerWaalsContact O-CG 3.31Å; K47-Y51 PolarHBondContact O-N 3.27Å
48	Y	98.6	Very high	97.1	Very high	90 Å²	90	50 Å²	50	35%	0.353	25%	0.246	S	C	.	.	H	α-helix	trans	-67.2	-39.1	177.7	-84.7	-106.3	0	0	0	112	T44 A45 N46 F50 Y51 H52 F79	T44-Y48 HydrophobicContact CG2-CD2 4.14Å; T44-Y48 HydrophobicContact CG2-CE2 4.23Å; T44-Y48 WeakPolarHBondContact O-CD2 3.16Å; T44-Y48 PolarHBondContact O-N 3.39Å; T44-Y48 VanDerWaalsContact O-N 3.08Å; A45-Y48 PolarHBondContact O-N 2.92Å; N46-Y48 PolarHBondContact O-N 3.12Å; Y48-F50 VanDerWaalsContact C-N 3.32Å; Y48-F50 PolarHBondContact O-N 3.24Å; Y48-Y51 PolarHBondContact O-N 2.96Å; Y48-H52 AromaticContact CD1-NE2 3.64Å; Y48-H52 PolarHBondContact O-CD2 3.39Å; Y48-H52 PolarHBondContact O-N 2.85Å; Y48-F79 HydrophobicContact CD1-CD1 4.12Å; Y48-F79 AromaticContact CD1-CE1 3.64Å; Y48-F79 HydrophobicContact CD1-CE1 3.64Å; Y48-F79 HydrophobicContact CD1-CZ 4.27Å; Y48-F79 AromaticContact CD2-CE1 3.96Å; Y48-F79 HydrophobicContact CD2-CE1 3.96Å; Y48-F79 HydrophobicContact CE1-CE1 4.16Å; Y48-F79 HydrophobicContact CE1-CZ 4.34Å; Y48-F79 HydrophobicContact CE2-CE1 4.44Å; Y48-F79 HydrophobicContact CG-CD1 4.14Å; Y48-F79 AromaticContact CG-CE1 3.53Å; Y48-F79 HydrophobicContact CG-CE1 3.53Å; Y48-F79 HydrophobicContact CG-CZ 4.38Å
49	H	98.8	Very high	97.4	Very high	21 Å²	21	49.5 Å²	49.5	10%	0.097	24%	0.242	C	C	.	.	H	α-helix	trans	-57.6	-44.8	176.3	-168.8	-173.9	0	0	0	111.4	S14 A18 A45 N46 S53 C80 Y84	S14-H49 PolarHBondContact O-NE2 3.48Å; S14-H49 PolarHBondContact OG-NE2 2.86Å; A18-H49 HydrophobicContact CB-CB 4.21Å; A18-H49 PolarHBondContact N-CE1 2.79Å; A45-H49 VanDerWaalsContact O-CB 3.27Å; A45-H49 WeakPolarHBondContact O-CB 3.2Å; A45-H49 PolarHBondContact O-N 3.26Å; N46-H49 PolarHBondContact O-N 3.34Å; H49-S53 WeakPolarHBondContact O-CB 3.2Å; H49-S53 PolarHBondContact O-N 3.08Å; H49-S53 PolarHBondContact O-OG 3.32Å; H49-C80 HydrophobicContact CB-CB 4.25Å; H49-C80 PolarHBondContact N-SG 3.11Å; H49-C80 VanDerWaalsContact N-SG 3.43Å; H49-Y84 HydrophobicContact CB-CE2 4.41Å; H49-Y84 AromaticContact ND1-CE2 3.8Å
50	F	98.3	Very high	97.6	Very high	68 Å²	68	46.5 Å²	46.5	30%	0.298	23%	0.232	S	C	.	.	H	α-helix	trans	-64.6	-50	175	-100.6	-72.8	0	0	0	112.9	A18 V19 N46 K47 Y48 H52 S53 I54	A18-F50 HydrophobicContact CB-CB 4.48Å; A18-F50 HydrophobicContact CB-CD1 4.06Å; A18-F50 HydrophobicContact CB-CD2 3.65Å; A18-F50 HydrophobicContact CB-CE1 4.23Å; A18-F50 HydrophobicContact CB-CE2 3.84Å; A18-F50 HydrophobicContact CB-CG 3.8Å; A18-F50 HydrophobicContact CB-CZ 4.15Å; A18-F50 WeakPolarHBondContact O-CE2 3.43Å; V19-F50 VanDerWaalsContact CA-CZ 3.5Å; V19-F50 HydrophobicContact CB-CZ 4.04Å; V19-F50 HydrophobicContact CG2-CE1 3.75Å; V19-F50 HydrophobicContact CG2-CZ 3.42Å; V19-F50 VanDerWaalsContact CG2-CZ 3.42Å; N46-F50 PolarHBondContact O-N 3.29Å; K47-F50 PolarHBondContact O-N 2.93Å; Y48-F50 VanDerWaalsContact C-N 3.32Å; Y48-F50 PolarHBondContact O-N 3.24Å; F50-H52 VanDerWaalsContact C-N 3.27Å; F50-H52 PolarHBondContact O-N 3.38Å; F50-S53 WeakPolarHBondContact O-CB 3.48Å; F50-S53 PolarHBondContact O-N 3.01Å; F50-S53 VanDerWaalsContact O-N 3.17Å; F50-I54 WeakPolarHBondContact O-CG1 3.36Å; F50-I54 PolarHBondContact O-N 3.03Å
51	Y	98.6	Very high	97.7	Very high	135 Å²	135	50.8 Å²	50.8	53%	0.529	24%	0.241	S	C	.	.	H	α-helix	trans	-57.5	-42.8	-179.6	-68.3	-20.5	0	0	0	111.9	K47 Y48 I54 A55	K47-Y51 HydrophobicContact CD-CE2 3.87Å; K47-Y51 HydrophobicContact CG-CD2 4.05Å; K47-Y51 HydrophobicContact CG-CE1 4.42Å; K47-Y51 HydrophobicContact CG-CE2 3.42Å; K47-Y51 VanDerWaalsContact CG-CE2 3.42Å; K47-Y51 WeakPolarHBondContact O-CD2 3.14Å; K47-Y51 VanDerWaalsContact O-CG 3.31Å; K47-Y51 PolarHBondContact O-N 3.27Å; Y48-Y51 PolarHBondContact O-N 2.96Å; Y51-I54 PolarHBondContact O-N 2.96Å; Y51-A55 WeakPolarHBondContact O-CB 3.36Å; Y51-A55 PolarHBondContact O-N 3.05Å
52	H	98.5	Very high	97.7	Very high	10 Å²	10	51.2 Å²	51.2	5%	0.046	25%	0.245	C	C	.	.	H	α-helix	trans	-80.1	-21.8	-179.7	-66	-66.5	0	0	0	113.7	Y48 F50 A55 L56 T76 L105 W109	Y48-H52 AromaticContact CD1-NE2 3.64Å; Y48-H52 PolarHBondContact O-CD2 3.39Å; Y48-H52 PolarHBondContact O-N 2.85Å; F50-H52 VanDerWaalsContact C-N 3.27Å; F50-H52 PolarHBondContact O-N 3.38Å; H52-A55 PolarHBondContact O-N 3.23Å; H52-L56 VanDerWaalsContact O-CB 3.27Å; H52-L56 WeakPolarHBondContact O-CB 3.32Å; H52-L56 PolarHBondContact O-N 2.87Å; H52-T76 WeakPolarHBondContact CB-OG1 3.35Å; H52-L105 HydrophobicContact CB-CD2 4.19Å; H52-L105 WeakPolarHBondContact NE2-CD1 3.28Å; H52-W109 AromaticContact CE1-CD1 3.75Å; H52-W109 AromaticContact CE1-NE1 3.14Å; H52-W109 PolarHBondContact CE1-NE1 2.79Å; H52-W109 AromaticContact ND1-NE1 3.37Å; H52-W109 PolarHBondContact ND1-NE1 2.96Å
53	S	98.6	Very high	97.6	Very high	6 Å²	6	60.7 Å²	60.7	4%	0.042	28%	0.28	C	S	.	.	H	α-helix	trans	-65.5	-42.5	167.3	-60	0	0	0	0	111.5	S14 G15 H49 F50 L56 L57	S14-S53 VanDerWaalsContact C-OG 3.23Å; S14-S53 WeakPolarHBondContact CB-OG 3.41Å; S14-S53 PolarHBondContact O-OG 3.49Å; S14-S53 PolarHBondContact OG-OG 2.97Å; G15-S53 PolarHBondContact N-OG 2.95Å; H49-S53 WeakPolarHBondContact O-CB 3.2Å; H49-S53 PolarHBondContact O-N 3.08Å; H49-S53 PolarHBondContact O-OG 3.32Å; F50-S53 WeakPolarHBondContact O-CB 3.48Å; F50-S53 PolarHBondContact O-N 3.01Å; F50-S53 VanDerWaalsContact O-N 3.17Å; S53-L56 PolarHBondContact O-N 3.37Å; S53-L57 PolarHBondContact O-N 2.85Å; S53-L57 VanDerWaalsContact O-N 3.11Å
54	I	98.4	Very high	97.6	Very high	112 Å²	112	61.2 Å²	61.2	57%	0.574	28%	0.281	S	S	*	.	H	α-helix	trans	-67.5	-43	174.6	-62.6	168.6	0	0	0	110.3	F50 Y51 L56 L57 G58	F50-I54 WeakPolarHBondContact O-CG1 3.36Å; F50-I54 PolarHBondContact O-N 3.03Å; Y51-I54 PolarHBondContact O-N 2.96Å; I54-L56 VanDerWaalsContact C-N 3.25Å; I54-L56 PolarHBondContact O-N 3.26Å; I54-L57 WeakPolarHBondContact O-CB 3.17Å; I54-L57 PolarHBondContact O-N 3.46Å; I54-L57 VanDerWaalsContact O-N 3.12Å; I54-G58 PolarHBondContact O-N 2.95Å
55	A	98.3	Very high	97.6	Very high	7 Å²	7	60.5 Å²	60.5	6%	0.058	28%	0.278	C	S	.	.	H	α-helix	trans	-58.8	-38.9	174.7	0	0	0	0	0	111.6	Y51 H52 L57 G58 A59 L72 W109	Y51-A55 WeakPolarHBondContact O-CB 3.36Å; Y51-A55 PolarHBondContact O-N 3.05Å; H52-A55 PolarHBondContact O-N 3.23Å; A55-L57 VanDerWaalsContact C-N 3.33Å; A55-L57 PolarHBondContact O-N 3.48Å; A55-G58 CarbonylContact O-C 3.59Å; A55-G58 PolarHBondContact O-N 3.35Å; A55-A59 WeakPolarHBondContact O-CB 3.34Å; A55-A59 PolarHBondContact O-N 2.97Å; A55-L72 HydrophobicContact CB-CD1 3.95Å; A55-L72 HydrophobicContact CB-CD2 4.46Å; A55-W109 HydrophobicContact CB-CH2 3.9Å; A55-W109 HydrophobicContact CB-CZ2 3.53Å
56	L	98.4	Very high	97.5	Very high	3 Å²	3	62.7 Å²	62.7	2%	0.016	30%	0.295	C	S	.	.	H	α-helix	trans	-65.7	-36.8	177.1	-164.4	64.5	0	0	0	111.8	V7 L10 A11 H52 S53 I54 A59 S60 L72 V73	V7-L56 HydrophobicContact CG1-CD1 3.81Å; V7-L56 HydrophobicContact CG1-CG 4.06Å; V7-L56 WeakPolarHBondContact CG1-O 3.45Å; L10-L56 HydrophobicContact CB-CD2 3.9Å; A11-L56 HydrophobicContact CB-CB 3.86Å; A11-L56 HydrophobicContact CB-CD2 4.19Å; A11-L56 HydrophobicContact CB-CG 3.93Å; H52-L56 VanDerWaalsContact O-CB 3.27Å; H52-L56 WeakPolarHBondContact O-CB 3.32Å; H52-L56 PolarHBondContact O-N 2.87Å; S53-L56 PolarHBondContact O-N 3.37Å; I54-L56 VanDerWaalsContact C-N 3.25Å; I54-L56 PolarHBondContact O-N 3.26Å; L56-A59 PolarHBondContact O-N 3.48Å; L56-S60 PolarHBondContact O-N 3.43Å; L56-S60 VanDerWaalsContact O-N 3.16Å; L56-L72 HydrophobicContact CD1-CB 3.92Å; L56-L72 HydrophobicContact CD1-CD1 4.28Å; L56-V73 HydrophobicContact CD1-CG2 3.96Å; L56-V73 HydrophobicContact CD2-CG2 3.58Å; L56-V73 HydrophobicContact CG-CG2 4.48Å
57	L	97.8	Very high	97.5	Very high	89 Å²	89	64.9 Å²	64.9	47%	0.466	31%	0.31	S	S	.	.	H	α-helix	trans	-62.5	-44.6	173	-173.3	62.2	0	0	0	110.8	Q8 A11 S53 I54 A55 S60	Q8-L57 HydrophobicContact CG-CD1 3.96Å; A11-L57 HydrophobicContact CB-CB 3.89Å; A11-L57 HydrophobicContact CB-CD1 4.28Å; A11-L57 VanDerWaalsContact CB-N 3.32Å; S53-L57 PolarHBondContact O-N 2.85Å; S53-L57 VanDerWaalsContact O-N 3.11Å; I54-L57 WeakPolarHBondContact O-CB 3.17Å; I54-L57 PolarHBondContact O-N 3.46Å; I54-L57 VanDerWaalsContact O-N 3.12Å; A55-L57 VanDerWaalsContact C-N 3.33Å; A55-L57 PolarHBondContact O-N 3.48Å; L57-S60 WeakPolarHBondContact O-CB 3.14Å; L57-S60 PolarHBondContact O-N 3.39Å; L57-S60 PolarHBondContact O-OG 3.27Å
58	G	96.8	Very high	97.5	Very high	43 Å²	43	60.1 Å²	60.1	44%	0.443	29%	0.289	S	S	.	.	H	α-helix	trans	-63.1	-42.3	173.2	0	0	0	0	0	113.2	I54 A55 S60 R61	I54-G58 PolarHBondContact O-N 2.95Å; A55-G58 CarbonylContact O-C 3.59Å; A55-G58 PolarHBondContact O-N 3.35Å; G58-S60 PolarHBondContact O-N 3.46Å; G58-R61 PolarHBondContact O-N 2.85Å
59	A	97.6	Very high	97.5	Very high	0 Å²	0	56 Å²	56	0%	0	27%	0.274	C	S	.	.	H	α-helix	trans	-60	-27.9	178.8	0	0	0	0	0	112.8	V7 A55 L56 R61 C62 P65 A68 L72 I112	V7-A59 HydrophobicContact CG1-CB 4.35Å; A55-A59 WeakPolarHBondContact O-CB 3.34Å; A55-A59 PolarHBondContact O-N 2.97Å; L56-A59 PolarHBondContact O-N 3.48Å; A59-R61 PolarHBondContact O-N 3.23Å; A59-R61 VanDerWaalsContact O-N 3.08Å; A59-C62 PolarHBondContact O-N 2.99Å; A59-C62 PolarHBondContact O-SG 2.91Å; A59-P65 WeakPolarHBondContact O-CB 3.27Å; A59-A68 HydrophobicContact CB-CB 3.93Å; A59-L72 HydrophobicContact CB-CD1 4.04Å; A59-I112 HydrophobicContact CB-CD1 3.94Å; A59-I112 HydrophobicContact CB-CG1 3.98Å
60	S	96.5	Very high	97.4	Very high	3 Å²	3	58.9 Å²	58.9	2%	0.021	29%	0.293	C	S	.	.	T	Hydrogen-bonded Turn	trans	-58.3	-22.2	174.1	76.3	0	0	0	0	113.1	S4 L56 L57 G58	S4-S60 VanDerWaalsContact CB-O 3.28Å; S4-S60 WeakPolarHBondContact CB-O 3.36Å; S4-S60 PolarHBondContact OG-O 2.72Å; L56-S60 PolarHBondContact O-N 3.43Å; L56-S60 VanDerWaalsContact O-N 3.16Å; L57-S60 WeakPolarHBondContact O-CB 3.14Å; L57-S60 PolarHBondContact O-N 3.39Å; L57-S60 PolarHBondContact O-OG 3.27Å; G58-S60 PolarHBondContact O-N 3.46Å
61	R	95.9	Very high	97.5	Very high	193 Å²	193	57.3 Å²	57.3	73%	0.728	29%	0.287	S	S	*	.	T	Hydrogen-bonded Turn	trans	-106.6	-0.7	-178	-56.3	-56.4	-174.9	92.4	-1	114.1	G58 A59	G58-R61 PolarHBondContact O-N 2.85Å; A59-R61 PolarHBondContact O-N 3.23Å; A59-R61 VanDerWaalsContact O-N 3.08Å
62	C	95.6	Very high	97.5	Very high	25 Å²	25	51 Å²	51	17%	0.169	26%	0.263	C	S	.	.	S	Bend	trans	-76	173.8	178	79.7	0	0	0	0	111.9	A59 K64 P65 I112	A59-C62 PolarHBondContact O-N 2.99Å; A59-C62 PolarHBondContact O-SG 2.91Å; C62-K64 VanDerWaalsContact C-N 3.31Å; C62-K64 PolarHBondContact O-N 3.36Å; C62-P65 WeakPolarHBondContact O-CD 3.46Å; C62-I112 HydrophobicContact CB-CG2 4.29Å
63	R	95.6	Very high	97.5	Very high	209 Å²	209	53.2 Å²	53.2	79%	0.789	28%	0.277	S	S	*	.	S	Bend	trans	-64.9	-34.1	-180	-171.9	179.2	-176.4	171	2.2	112.7	P65 I114	R63-P65 VanDerWaalsContact C-CD 3.48Å; R63-P65 WeakPolarHBondContact O-CD 3.38Å; R63-I114 WeakPolarHBondContact CD-O 3.42Å
64	K	95.9	Very high	97.5	Very high	105 Å²	105	57.4 Å²	57.4	46%	0.457	30%	0.298	S	S	.	.			trans	-123.5	66.3	-177.2	-64.7	-174.6	179.9	178.8	0	112.2	C62 A66 V67 A68	C62-K64 VanDerWaalsContact C-N 3.31Å; C62-K64 PolarHBondContact O-N 3.36Å; K64-A66 VanDerWaalsContact C-N 3.3Å; K64-A66 PolarHBondContact O-N 3.33Å; K64-V67 HydrophobicContact CB-CB 4.34Å; K64-V67 HydrophobicContact CB-CG2 4.39Å; K64-V67 PolarHBondContact O-N 2.96Å; K64-V67 VanDerWaalsContact O-N 3.15Å; K64-A68 PolarHBondContact O-N 3.42Å
65	P	96.4	Very high	97.5	Very high	25 Å²	25	52 Å²	52	16%	0.162	27%	0.271	C	S	.	.	H	α-helix	trans	-63.5	-32.8	-172	25.6	-34	0	0	0	112.9	T3 V7 A59 C62 R63 V67 G69	T3-P65 HydrophobicContact CG2-CG 4.38Å; V7-P65 HydrophobicContact CG2-CB 4.47Å; V7-P65 WeakPolarHBondContact CG2-O 3.34Å; A59-P65 WeakPolarHBondContact O-CB 3.27Å; C62-P65 WeakPolarHBondContact O-CD 3.46Å; R63-P65 VanDerWaalsContact C-CD 3.48Å; R63-P65 WeakPolarHBondContact O-CD 3.38Å; P65-V67 PolarHBondContact O-N 3.04Å; P65-G69 WeakPolarHBondContact O-CA 3.45Å; P65-G69 PolarHBondContact O-N 3.17Å
66	A	96.9	Very high	97.5	Very high	45 Å²	45	52.1 Å²	52.1	37%	0.372	27%	0.271	S	S	.	.	H	α-helix	trans	-59.6	-45.9	176.2	0	0	0	0	0	112.3	T3 K64 T70	T3-A66 HydrophobicContact CG2-CB 3.56Å; K64-A66 VanDerWaalsContact C-N 3.3Å; K64-A66 PolarHBondContact O-N 3.33Å; A66-T70 VanDerWaalsContact O-CB 3.27Å; A66-T70 WeakPolarHBondContact O-CB 3.47Å; A66-T70 PolarHBondContact O-N 2.67Å; A66-T70 PolarHBondContact O-OG1 3.07Å
67	V	97.9	Very high	97.5	Very high	74 Å²	74	54.2 Å²	54.2	45%	0.448	29%	0.293	S	S	.	.	H	α-helix	trans	-72.7	-53.8	-173.7	179.6	0	0	0	0	109.2	K64 P65 G69 T70 L71 A111	K64-V67 HydrophobicContact CB-CB 4.34Å; K64-V67 HydrophobicContact CB-CG2 4.39Å; K64-V67 PolarHBondContact O-N 2.96Å; K64-V67 VanDerWaalsContact O-N 3.15Å; P65-V67 PolarHBondContact O-N 3.04Å; V67-G69 VanDerWaalsContact C-N 3.32Å; V67-G69 PolarHBondContact O-N 3.48Å; V67-T70 PolarHBondContact O-N 3.25Å; V67-L71 HydrophobicContact CG1-CD1 3.89Å; V67-L71 WeakPolarHBondContact O-CB 3.31Å; V67-L71 VanDerWaalsContact O-CG 3.29Å; V67-L71 WeakPolarHBondContact O-CG 3.49Å; V67-L71 PolarHBondContact O-N 3.38Å; V67-L71 VanDerWaalsContact O-N 3.08Å; V67-A111 HydrophobicContact CG1-CB 3.97Å
68	A	98.2	Very high	97.5	Very high	0 Å²	0	50.7 Å²	50.7	0%	0	28%	0.277	C	S	.	.	H	α-helix	trans	-58.7	-45.2	177.4	0	0	0	0	0	111.6	A59 K64 L71 L72 A111 I112	A59-A68 HydrophobicContact CB-CB 3.93Å; K64-A68 PolarHBondContact O-N 3.42Å; A68-L71 PolarHBondContact O-N 2.65Å; A68-L72 WeakPolarHBondContact O-CB 3.33Å; A68-L72 VanDerWaalsContact O-CG 3.31Å; A68-L72 WeakPolarHBondContact O-CG 3.42Å; A68-L72 PolarHBondContact O-N 3.07Å; A68-A111 HydrophobicContact CB-CB 4Å; A68-I112 HydrophobicContact CB-CG1 3.76Å
69	G	97.9	Very high	97.6	Very high	3 Å²	3	50.3 Å²	50.3	3%	0.031	26%	0.263	C	S	.	.	H	α-helix	trans	-62.7	-47.4	-179.7	0	0	0	0	0	113.2	P65 V67 L72 V73	P65-G69 WeakPolarHBondContact O-CA 3.45Å; P65-G69 PolarHBondContact O-N 3.17Å; V67-G69 VanDerWaalsContact C-N 3.32Å; V67-G69 PolarHBondContact O-N 3.48Å; G69-L72 PolarHBondContact O-N 3.43Å; G69-V73 WeakPolarHBondContact O-CB 3.48Å; G69-V73 VanDerWaalsContact O-CG2 3.25Å; G69-V73 WeakPolarHBondContact O-CG2 3.34Å; G69-V73 PolarHBondContact O-N 3.31Å
70	T	98.4	Very high	97.6	Very high	81 Å²	81	50.4 Å²	50.4	50%	0.497	26%	0.263	S	S	.	.	H	α-helix	trans	-61.7	-46.8	178.5	-58.8	0	0	0	0	111.5	A66 V67 V73 L74	A66-T70 VanDerWaalsContact O-CB 3.27Å; A66-T70 WeakPolarHBondContact O-CB 3.47Å; A66-T70 PolarHBondContact O-N 2.67Å; A66-T70 PolarHBondContact O-OG1 3.07Å; V67-T70 PolarHBondContact O-N 3.25Å; T70-V73 PolarHBondContact O-N 3.22Å; T70-L74 HydrophobicContact CG2-CD1 3.87Å; T70-L74 HydrophobicContact CG2-CG 4.36Å; T70-L74 WeakPolarHBondContact O-CB 3.44Å; T70-L74 WeakPolarHBondContact O-CG 3.33Å; T70-L74 PolarHBondContact O-N 2.91Å
71	L	98.6	Very high	97.7	Very high	36 Å²	36	51.8 Å²	51.8	19%	0.188	28%	0.278	C	S	.	.	H	α-helix	trans	-63	-43.8	-179.9	-71	171.1	0	0	0	111.9	V67 A68 G75 F104 A107 A111	V67-L71 HydrophobicContact CG1-CD1 3.89Å; V67-L71 WeakPolarHBondContact O-CB 3.31Å; V67-L71 VanDerWaalsContact O-CG 3.29Å; V67-L71 WeakPolarHBondContact O-CG 3.49Å; V67-L71 PolarHBondContact O-N 3.38Å; V67-L71 VanDerWaalsContact O-N 3.08Å; A68-L71 PolarHBondContact O-N 2.65Å; L71-G75 PolarHBondContact O-N 3.47Å; L71-F104 HydrophobicContact CD2-CD1 3.74Å; L71-F104 HydrophobicContact CD2-CE1 4.43Å; L71-A107 HydrophobicContact CD1-CB 3.95Å; L71-A107 HydrophobicContact CD2-CB 4.29Å; L71-A111 HydrophobicContact CD1-CB 4.13Å
72	L	98.6	Very high	97.8	Very high	1 Å²	1	42.6 Å²	42.6	1%	0.005	24%	0.244	C	C	.	.	H	α-helix	trans	-66.7	-40.6	177.5	-74.8	176.6	0	0	0	112.6	A55 L56 A59 A68 G69 T76 L105 I112	A55-L72 HydrophobicContact CB-CD1 3.95Å; A55-L72 HydrophobicContact CB-CD2 4.46Å; L56-L72 HydrophobicContact CD1-CB 3.92Å; L56-L72 HydrophobicContact CD1-CD1 4.28Å; A59-L72 HydrophobicContact CB-CD1 4.04Å; A68-L72 WeakPolarHBondContact O-CB 3.33Å; A68-L72 VanDerWaalsContact O-CG 3.31Å; A68-L72 WeakPolarHBondContact O-CG 3.42Å; A68-L72 PolarHBondContact O-N 3.07Å; G69-L72 PolarHBondContact O-N 3.43Å; L72-T76 WeakPolarHBondContact O-CB 3.45Å; L72-T76 PolarHBondContact O-N 3.48Å; L72-T76 PolarHBondContact O-OG1 3.46Å; L72-L105 HydrophobicContact CD2-CD2 4.13Å; L72-I112 HydrophobicContact CD1-CD1 3.95Å
73	V	98.6	Very high	97.9	Very high	57 Å²	57	42.1 Å²	42.1	35%	0.345	24%	0.239	S	C	.	.	H	α-helix	trans	-65.5	-49.9	177.8	168.8	0	0	0	0	111	L10 L56 G69 T70 G75 T76 G77	L10-V73 HydrophobicContact CD1-CG2 4.27Å; L56-V73 HydrophobicContact CD1-CG2 3.96Å; L56-V73 HydrophobicContact CD2-CG2 3.58Å; L56-V73 HydrophobicContact CG-CG2 4.48Å; G69-V73 WeakPolarHBondContact O-CB 3.48Å; G69-V73 VanDerWaalsContact O-CG2 3.25Å; G69-V73 WeakPolarHBondContact O-CG2 3.34Å; G69-V73 PolarHBondContact O-N 3.31Å; T70-V73 PolarHBondContact O-N 3.22Å; V73-G75 PolarHBondContact O-N 2.85Å; V73-T76 PolarHBondContact O-N 3.36Å; V73-G77 PolarHBondContact O-N 3.5Å
74	L	98.5	Very high	98	Very high	94 Å²	94	33.6 Å²	33.6	49%	0.492	21%	0.207	S	C	.	.	H	α-helix	trans	-62.9	-43.8	178.3	-69.5	178	0	0	0	111.3	T70 G77 A78 F104	T70-L74 HydrophobicContact CG2-CD1 3.87Å; T70-L74 HydrophobicContact CG2-CG 4.36Å; T70-L74 WeakPolarHBondContact O-CB 3.44Å; T70-L74 WeakPolarHBondContact O-CG 3.33Å; T70-L74 PolarHBondContact O-N 2.91Å; L74-G77 PolarHBondContact O-N 2.99Å; L74-A78 WeakPolarHBondContact O-CB 3.39Å; L74-A78 PolarHBondContact O-N 3.34Å; L74-F104 HydrophobicContact CB-CD2 4.45Å
75	G	98.5	Very high	98	Very high	0 Å²	0	31.3 Å²	31.3	0%	0	20%	0.198	C	C	.	.	H	α-helix	trans	-62.9	-43.5	177.8	0	0	0	0	0	112.8	L71 V73 F79 G101	L71-G75 PolarHBondContact O-N 3.47Å; V73-G75 PolarHBondContact O-N 2.85Å; G75-F79 WeakPolarHBondContact O-CB 3.31Å; G75-F79 PolarHBondContact O-N 2.87Å; G75-G101 WeakPolarHBondContact CA-O 3.32Å
76	T	98.7	Very high	98	Very high	9 Å²	9	31 Å²	31	6%	0.055	19%	0.194	C	C	.	.	H	α-helix	trans	-64.7	-46.9	178.2	-58.7	0	0	0	0	110.8	H52 L72 V73 C80	H52-T76 WeakPolarHBondContact CB-OG1 3.35Å; L72-T76 WeakPolarHBondContact O-CB 3.45Å; L72-T76 PolarHBondContact O-N 3.48Å; L72-T76 PolarHBondContact O-OG1 3.46Å; V73-T76 PolarHBondContact O-N 3.36Å; T76-C80 HydrophobicContact CG2-CB 4.48Å; T76-C80 WeakPolarHBondContact O-CA 3.11Å; T76-C80 WeakPolarHBondContact O-CB 3.48Å; T76-C80 PolarHBondContact O-N 3.27Å; T76-C80 PolarHBondContact O-SG 3.29Å; T76-C80 VanDerWaalsContact O-SG 3.4Å
77	G	98.4	Very high	98	Very high	47 Å²	47	28.9 Å²	28.9	49%	0.485	18%	0.177	S	C	.	.	H	α-helix	trans	-62	-47.9	177.9	0	0	0	0	0	112.5	V73 L74 G81	V73-G77 PolarHBondContact O-N 3.5Å; L74-G77 PolarHBondContact O-N 2.99Å; G77-G81 WeakPolarHBondContact O-CA 3.49Å; G77-G81 PolarHBondContact O-N 3.5Å
78	A	98.4	Very high	97.8	Very high	15 Å²	15	29.6 Å²	29.6	12%	0.124	18%	0.178	C	C	.	.	H	α-helix	trans	-66.1	-47.9	179.8	0	0	0	0	0	112.5	L74 S82 L97	L74-A78 WeakPolarHBondContact O-CB 3.39Å; L74-A78 PolarHBondContact O-N 3.34Å; A78-S82 VanDerWaalsContact O-CB 3.27Å; A78-S82 WeakPolarHBondContact O-CB 3.38Å; A78-S82 PolarHBondContact O-N 3.29Å; A78-S82 PolarHBondContact O-OG 2.91Å; A78-L97 HydrophobicContact CB-CD1 4.17Å; A78-L97 HydrophobicContact CB-CD2 4.19Å; A78-L97 HydrophobicContact CB-CG 3.83Å
79	F	98.4	Very high	97.6	Very high	34 Å²	34	33.2 Å²	33.2	15%	0.149	20%	0.2	C	C	.	.	H	α-helix	trans	-71.2	-64.2	-179.7	-175	-96.1	0	0	0	111.2	Y48 G75 G81 S82 L83 A98 L105	Y48-F79 HydrophobicContact CD1-CD1 4.12Å; Y48-F79 AromaticContact CD1-CE1 3.64Å; Y48-F79 HydrophobicContact CD1-CE1 3.64Å; Y48-F79 HydrophobicContact CD1-CZ 4.27Å; Y48-F79 AromaticContact CD2-CE1 3.96Å; Y48-F79 HydrophobicContact CD2-CE1 3.96Å; Y48-F79 HydrophobicContact CE1-CE1 4.16Å; Y48-F79 HydrophobicContact CE1-CZ 4.34Å; Y48-F79 HydrophobicContact CE2-CE1 4.44Å; Y48-F79 HydrophobicContact CG-CD1 4.14Å; Y48-F79 AromaticContact CG-CE1 3.53Å; Y48-F79 HydrophobicContact CG-CE1 3.53Å; Y48-F79 HydrophobicContact CG-CZ 4.38Å; G75-F79 WeakPolarHBondContact O-CB 3.31Å; G75-F79 PolarHBondContact O-N 2.87Å; F79-G81 PolarHBondContact O-N 2.85Å; F79-S82 PolarHBondContact O-N 2.93Å; F79-S82 PolarHBondContact O-OG 3.43Å; F79-L83 HydrophobicContact CD1-CD1 4.37Å; F79-L83 HydrophobicContact CE1-CD1 3.81Å; F79-L83 HydrophobicContact CZ-CD1 3.91Å; F79-L83 WeakPolarHBondContact O-CG 3.27Å; F79-L83 PolarHBondContact O-N 3.14Å; F79-A98 HydrophobicContact CD2-CB 4.03Å; F79-A98 WeakPolarHBondContact CD2-O 3.12Å; F79-A98 HydrophobicContact CE2-CB 4.37Å; F79-L105 HydrophobicContact CB-CD1 3.84Å; F79-L105 HydrophobicContact CD1-CD1 4.27Å; F79-L105 HydrophobicContact CG-CD1 4.06Å
80	C	98.4	Very high	97.3	Very high	2 Å²	2	39 Å²	39	1%	0.014	23%	0.227	C	C	.	.	H	α-helix	trans	-67.9	-39.7	-173.8	-50.1	0	0	0	0	111.4	A45 H49 T76 S82 L83 Y84	A45-C80 HydrophobicContact CB-CB 4.45Å; A45-C80 PolarHBondContact O-SG 2.84Å; H49-C80 HydrophobicContact CB-CB 4.25Å; H49-C80 PolarHBondContact N-SG 3.11Å; H49-C80 VanDerWaalsContact N-SG 3.43Å; T76-C80 HydrophobicContact CG2-CB 4.48Å; T76-C80 WeakPolarHBondContact O-CA 3.11Å; T76-C80 WeakPolarHBondContact O-CB 3.48Å; T76-C80 PolarHBondContact O-N 3.27Å; T76-C80 PolarHBondContact O-SG 3.29Å; T76-C80 VanDerWaalsContact O-SG 3.4Å; C80-S82 PolarHBondContact O-N 3.37Å; C80-L83 PolarHBondContact O-N 3.26Å; C80-Y84 HydrophobicContact CB-CD2 4.24Å; C80-Y84 HydrophobicContact CB-CE2 4.03Å; C80-Y84 WeakPolarHBondContact O-CB 3.19Å; C80-Y84 WeakPolarHBondContact O-CD2 3.47Å; C80-Y84 PolarHBondContact O-N 3.41Å
81	G	97.7	Very high	97.1	Very high	32 Å²	32	38.3 Å²	38.3	33%	0.33	22%	0.22	S	C	.	.	H	α-helix	trans	-61.2	-42.5	178.8	0	0	0	0	0	112.7	G77 F79 L83 Y84 H85	G77-G81 WeakPolarHBondContact O-CA 3.49Å; G77-G81 PolarHBondContact O-N 3.5Å; F79-G81 PolarHBondContact O-N 2.85Å; G81-L83 PolarHBondContact O-N 2.82Å; G81-Y84 PolarHBondContact O-N 2.79Å; G81-H85 WeakPolarHBondContact O-CB 3.46Å; G81-H85 PolarHBondContact O-N 3.38Å
82	S	97.9	Very high	96.8	Very high	1 Å²	1	39.8 Å²	39.8	1%	0.007	23%	0.232	C	C	.	.	H	α-helix	trans	-64.5	-38.8	176.7	68.1	0	0	0	0	112.8	A78 F79 C80 Q86 L94 A98	A78-S82 VanDerWaalsContact O-CB 3.27Å; A78-S82 WeakPolarHBondContact O-CB 3.38Å; A78-S82 PolarHBondContact O-N 3.29Å; A78-S82 PolarHBondContact O-OG 2.91Å; F79-S82 PolarHBondContact O-N 2.93Å; F79-S82 PolarHBondContact O-OG 3.43Å; C80-S82 PolarHBondContact O-N 3.37Å; S82-Q86 PolarHBondContact O-N 3.39Å; S82-L94 WeakPolarHBondContact CB-O 3.48Å; S82-A98 WeakPolarHBondContact OG-CB 3.43Å
83	L	97.7	Very high	96.7	Very high	15 Å²	15	44.8 Å²	44.8	8%	0.079	26%	0.262	C	S	.	.	H	α-helix	trans	-71.7	-41.6	177.6	-64.3	-168.4	0	0	0	112.2	L41 T44 A45 F79 C80 G81 H85 Q86 A87 A98	L41-L83 HydrophobicContact CD2-CD2 4.17Å; T44-L83 HydrophobicContact CG2-CD1 3.99Å; A45-L83 HydrophobicContact CB-CB 3.62Å; A45-L83 HydrophobicContact CB-CD1 4.42Å; F79-L83 HydrophobicContact CD1-CD1 4.37Å; F79-L83 HydrophobicContact CE1-CD1 3.81Å; F79-L83 HydrophobicContact CZ-CD1 3.91Å; F79-L83 WeakPolarHBondContact O-CG 3.27Å; F79-L83 PolarHBondContact O-N 3.14Å; C80-L83 PolarHBondContact O-N 3.26Å; G81-L83 PolarHBondContact O-N 2.82Å; L83-H85 VanDerWaalsContact C-N 3.33Å; L83-H85 PolarHBondContact O-N 2.98Å; L83-Q86 PolarHBondContact O-N 2.97Å; L83-A87 WeakPolarHBondContact O-CB 3.35Å; L83-A87 PolarHBondContact O-N 3.23Å; L83-A98 HydrophobicContact CD2-CB 4.39Å
84	Y	97.7	Very high	96.5	Very high	29 Å²	29	45.2 Å²	45.2	11%	0.114	26%	0.262	C	S	.	.	H	α-helix	trans	-60.5	-43.3	172.4	-75.3	-50.3	0	0	0	111.9	A21 Y42 A45 N46 H49 C80 G81 A87 L88	A21-Y84 HydrophobicContact CB-CE1 4.12Å; A21-Y84 VanDerWaalsContact CB-OH 3.23Å; A21-Y84 WeakPolarHBondContact CB-OH 3.31Å; Y42-Y84 HydrophobicContact CD1-CE1 4.18Å; Y42-Y84 AromaticContact CD2-CD1 3.65Å; Y42-Y84 HydrophobicContact CD2-CD1 3.65Å; Y42-Y84 HydrophobicContact CD2-CE1 4.09Å; Y42-Y84 HydrophobicContact CE1-CD1 4.38Å; Y42-Y84 AromaticContact CE1-CE1 3.86Å; Y42-Y84 HydrophobicContact CE1-CE1 3.86Å; Y42-Y84 AromaticContact CE2-CD1 3.48Å; Y42-Y84 HydrophobicContact CE2-CD1 3.48Å; Y42-Y84 VanDerWaalsContact CE2-CD1 3.48Å; Y42-Y84 AromaticContact CE2-CE1 3.79Å; Y42-Y84 HydrophobicContact CE2-CE1 3.79Å; Y42-Y84 HydrophobicContact CG-CD1 4.18Å; Y42-Y84 HydrophobicContact CG-CE1 4.26Å; Y42-Y84 AromaticContact CZ-CD1 3.87Å; Y42-Y84 AromaticContact CZ-CE1 3.65Å; A45-Y84 HydrophobicContact CB-CD1 3.61Å; A45-Y84 HydrophobicContact CB-CD2 4.06Å; A45-Y84 HydrophobicContact CB-CE1 3.61Å; A45-Y84 HydrophobicContact CB-CE2 4.04Å; A45-Y84 HydrophobicContact CB-CG 3.86Å; N46-Y84 WeakPolarHBondContact CA-OH 3.44Å; N46-Y84 HydrophobicContact CB-CE1 4.16Å; N46-Y84 VanDerWaalsContact CB-OH 3.28Å; N46-Y84 WeakPolarHBondContact CB-OH 3.47Å; N46-Y84 PolarHBondContact N-OH 3.47Å; N46-Y84 PolarHBondContact OD1-OH 3.41Å; H49-Y84 HydrophobicContact CB-CE2 4.41Å; H49-Y84 AromaticContact ND1-CE2 3.8Å; C80-Y84 HydrophobicContact CB-CD2 4.24Å; C80-Y84 HydrophobicContact CB-CE2 4.03Å; C80-Y84 WeakPolarHBondContact O-CB 3.19Å; C80-Y84 WeakPolarHBondContact O-CD2 3.47Å; C80-Y84 PolarHBondContact O-N 3.41Å; G81-Y84 PolarHBondContact O-N 2.79Å; Y84-A87 PolarHBondContact O-N 3.19Å; Y84-L88 WeakPolarHBondContact O-CB 3.29Å; Y84-L88 VanDerWaalsContact O-CG 3.26Å; Y84-L88 WeakPolarHBondContact O-CG 3.23Å; Y84-L88 PolarHBondContact O-N 2.97Å
85	H	97.3	Very high	96.1	Very high	58 Å²	58	47.8 Å²	47.8	27%	0.269	27%	0.265	S	S	.	.	H	α-helix	trans	-56.6	-55.5	176.2	177.1	-83.3	0	0	0	110.8	G81 L83 A87 L88 T89 D91 L94	G81-H85 WeakPolarHBondContact O-CB 3.46Å; G81-H85 PolarHBondContact O-N 3.38Å; L83-H85 VanDerWaalsContact C-N 3.33Å; L83-H85 PolarHBondContact O-N 2.98Å; H85-A87 VanDerWaalsContact C-N 3.29Å; H85-A87 PolarHBondContact O-N 2.91Å; H85-L88 PolarHBondContact O-N 2.93Å; H85-T89 PolarHBondContact CE1-OG1 3.18Å; H85-T89 PolarHBondContact ND1-OG1 3.29Å; H85-T89 WeakPolarHBondContact O-CB 3.44Å; H85-T89 PolarHBondContact O-N 3.39Å; H85-T89 PolarHBondContact O-OG1 3.47Å; H85-D91 IonicContact CE1-OD2 3.69Å; H85-D91 PolarHBondContact ND1-O 2.92Å; H85-L94 HydrophobicContact CB-CD1 3.98Å
86	Q	96.3	Very high	95.8	Very high	17 Å²	17	56.3 Å²	56.3	8%	0.079	30%	0.302	C	S	.	.	H	α-helix	trans	-62.9	-36.6	-179	-172.7	177	-6.4	0	0	111.8	L41 S82 L83 L88 E90	L41-Q86 HydrophobicContact CD1-CB 4.03Å; L41-Q86 HydrophobicContact CD1-CG 3.68Å; S82-Q86 PolarHBondContact O-N 3.39Å; L83-Q86 PolarHBondContact O-N 2.97Å; Q86-L88 PolarHBondContact O-N 3.44Å; Q86-E90 WeakPolarHBondContact O-CA 3.15Å; Q86-E90 PolarHBondContact O-N 3.31Å
87	A	94.9	Very high	95.7	Very high	1 Å²	1	59.5 Å²	59.5	1%	0.008	32%	0.318	C	S	.	.	H	α-helix	trans	-67.6	-31.8	177.8	0	0	0	0	0	114.2	S38 L41 Y42 L83 Y84 H85	S38-A87 WeakPolarHBondContact O-CB 3.28Å; L41-A87 HydrophobicContact CB-CB 4.02Å; Y42-A87 HydrophobicContact CD2-CB 3.98Å; Y42-A87 HydrophobicContact CG-CB 4.39Å; L83-A87 WeakPolarHBondContact O-CB 3.35Å; L83-A87 PolarHBondContact O-N 3.23Å; Y84-A87 PolarHBondContact O-N 3.19Å; H85-A87 VanDerWaalsContact C-N 3.29Å; H85-A87 PolarHBondContact O-N 2.91Å
88	L	94.1	Very high	95.6	Very high	90 Å²	90	57.7 Å²	57.7	47%	0.471	30%	0.299	S	S	.	.	H	α-helix	trans	-92.2	-32.9	-176.9	-68.5	173.6	0	0	0	113.1	Y24 F29 Y42 Y84 H85 Q86	Y24-L88 HydrophobicContact CD1-CD2 4.47Å; Y24-L88 HydrophobicContact CE1-CD2 3.54Å; F29-L88 HydrophobicContact CZ-CD2 4.5Å; Y42-L88 HydrophobicContact CD2-CD2 4.18Å; Y42-L88 HydrophobicContact CD2-CG 4.33Å; Y42-L88 HydrophobicContact CE2-CD1 4.36Å; Y42-L88 HydrophobicContact CE2-CD2 3.9Å; Y42-L88 HydrophobicContact CE2-CG 4.14Å; Y84-L88 WeakPolarHBondContact O-CB 3.29Å; Y84-L88 VanDerWaalsContact O-CG 3.26Å; Y84-L88 WeakPolarHBondContact O-CG 3.23Å; Y84-L88 PolarHBondContact O-N 2.97Å; H85-L88 PolarHBondContact O-N 2.93Å; Q86-L88 PolarHBondContact O-N 3.44Å
89	T	94.4	Very high	95.6	Very high	76 Å²	76	61 Å²	61	47%	0.466	32%	0.319	S	S	.	.	H	α-helix	trans	-106.3	-13.5	-174.4	63.6	0	0	0	0	113.2	H85 D91	H85-T89 PolarHBondContact CE1-OG1 3.18Å; H85-T89 PolarHBondContact ND1-OG1 3.29Å; H85-T89 WeakPolarHBondContact O-CB 3.44Å; H85-T89 PolarHBondContact O-N 3.39Å; H85-T89 PolarHBondContact O-OG1 3.47Å; T89-D91 PolarHBondContact O-N 3.48Å; T89-D91 VanDerWaalsContact O-N 3.07Å; T89-D91 PolarHBondContact OG1-N 3.44Å
90	E	92.1	Very high	95.5	Very high	124 Å²	124	66 Å²	66	58%	0.579	34%	0.338	S	S	*	.			trans	61.3	7.7	-171.3	-57.6	178.6	-175.6	0	0	113.5	K32 Q86 P92	K32-E90 IonicContact NZ-OE1 3.55Å; K32-E90 PolarHBondContact NZ-OE1 2.9Å; Q86-E90 WeakPolarHBondContact O-CA 3.15Å; Q86-E90 PolarHBondContact O-N 3.31Å; E90-P92 WeakPolarHBondContact O-CD 3.4Å
91	D	94.1	Very high	95.5	Very high	67 Å²	67	66 Å²	66	36%	0.358	34%	0.338	S	S	.	.			trans	-90.8	117.6	178.3	178.6	5.1	0	0	0	111.8	H85 T89 V93	H85-D91 IonicContact CE1-OD2 3.69Å; H85-D91 PolarHBondContact ND1-O 2.92Å; T89-D91 PolarHBondContact O-N 3.48Å; T89-D91 VanDerWaalsContact O-N 3.07Å; T89-D91 PolarHBondContact OG1-N 3.44Å; D91-V93 VanDerWaalsContact C-N 3.3Å; D91-V93 PolarHBondContact O-N 2.9Å; D91-V93 WeakPolarHBondContact OD1-CB 3.28Å; D91-V93 WeakPolarHBondContact OD1-CG2 3.02Å; D91-V93 PolarHBondContact OD1-N 3.26Å
92	P	93.1	Very high	95.6	Very high	67 Å²	67	65.3 Å²	65.3	44%	0.435	33%	0.331	S	S	.	.	G	3₁₀ helix	trans	-83.1	8.3	-179.5	36.4	-37.6	0	0	0	114.6	E90 L94 R95	E90-P92 WeakPolarHBondContact O-CD 3.4Å; P92-L94 PolarHBondContact O-N 3.17Å; P92-L94 VanDerWaalsContact O-N 3.12Å; P92-R95 HydrophobicContact CB-CB 4.44Å; P92-R95 WeakPolarHBondContact O-CB 3.26Å; P92-R95 PolarHBondContact O-N 2.87Å
93	V	95.4	Very high	95.6	Very high	105 Å²	105	70.4 Å²	70.4	64%	0.636	36%	0.356	S	S	*	.	G	3₁₀ helix	trans	-48.6	-41.7	-178.8	143.6	0	0	0	0	113	D91	D91-V93 VanDerWaalsContact C-N 3.3Å; D91-V93 PolarHBondContact O-N 2.9Å; D91-V93 WeakPolarHBondContact OD1-CB 3.28Å; D91-V93 WeakPolarHBondContact OD1-CG2 3.02Å; D91-V93 PolarHBondContact OD1-N 3.26Å
94	L	93.9	Very high	95.6	Very high	66 Å²	66	73.9 Å²	73.9	35%	0.346	37%	0.371	S	S	.	.	G	3₁₀ helix	trans	-86.8	-0.3	-177.9	-60.1	-175.5	0	0	0	114	S82 H85 P92 K96 L97	S82-L94 WeakPolarHBondContact CB-O 3.48Å; H85-L94 HydrophobicContact CB-CD1 3.98Å; P92-L94 PolarHBondContact O-N 3.17Å; P92-L94 VanDerWaalsContact O-N 3.12Å; L94-K96 PolarHBondContact O-N 2.97Å; L94-K96 VanDerWaalsContact O-N 3.09Å; L94-L97 WeakPolarHBondContact O-CB 3.46Å; L94-L97 PolarHBondContact O-N 3.37Å
95	R	90.1	Very high	95.7	Very high	149 Å²	149	72.8 Å²	72.8	56%	0.562	37%	0.367	S	S	*	.	G	3₁₀ helix	trans	-57.4	-32.6	-174	-169.5	-180	78.6	164.5	2.5	113.2	P92 L97 A98 P99	P92-R95 HydrophobicContact CB-CB 4.44Å; P92-R95 WeakPolarHBondContact O-CB 3.26Å; P92-R95 PolarHBondContact O-N 2.87Å; R95-L97 PolarHBondContact O-N 3.39Å; R95-A98 PolarHBondContact O-N 3.43Å; R95-P99 WeakPolarHBondContact O-CD 3.45Å
96	K	93.8	Very high	95.7	Very high	178 Å²	178	75.3 Å²	75.3	77%	0.774	38%	0.381	S	S	*	.	G	3₁₀ helix	trans	-67.1	-17.6	177.4	-69.8	-177	-179.4	177.4	0	113.2	L94 P99 Y100	L94-K96 PolarHBondContact O-N 2.97Å; L94-K96 VanDerWaalsContact O-N 3.09Å; K96-P99 WeakPolarHBondContact O-CD 3.49Å; K96-Y100 WeakPolarHBondContact O-CD2 3.37Å; K96-Y100 VanDerWaalsContact O-CE2 3.24Å; K96-Y100 WeakPolarHBondContact O-CE2 3.35Å
97	L	96.3	Very high	95.9	Very high	76 Å²	76	76.2 Å²	76.2	40%	0.398	39%	0.391	S	S	.	.	H	α-helix	trans	-75.9	-29.2	178.5	-168.9	61.6	0	0	0	112.3	A78 L94 R95 Y100 G101	A78-L97 HydrophobicContact CB-CD1 4.17Å; A78-L97 HydrophobicContact CB-CD2 4.19Å; A78-L97 HydrophobicContact CB-CG 3.83Å; L94-L97 WeakPolarHBondContact O-CB 3.46Å; L94-L97 PolarHBondContact O-N 3.37Å; R95-L97 PolarHBondContact O-N 3.39Å; L97-Y100 PolarHBondContact O-N 2.92Å; L97-G101 PolarHBondContact O-N 3.42Å
98	A	95.9	Very high	96	Very high	10 Å²	10	76.2 Å²	76.2	8%	0.083	39%	0.391	C	S	.	.	H	α-helix	trans	-56.4	-50.2	-178.2	0	0	0	0	0	113.5	F79 S82 L83 R95 Y100 G101 G102	F79-A98 HydrophobicContact CD2-CB 4.03Å; F79-A98 WeakPolarHBondContact CD2-O 3.12Å; F79-A98 HydrophobicContact CE2-CB 4.37Å; S82-A98 WeakPolarHBondContact OG-CB 3.43Å; L83-A98 HydrophobicContact CD2-CB 4.39Å; R95-A98 PolarHBondContact O-N 3.43Å; A98-Y100 VanDerWaalsContact C-N 3.31Å; A98-Y100 PolarHBondContact O-N 3.43Å; A98-G101 WeakPolarHBondContact O-CA 3.5Å; A98-G101 PolarHBondContact O-N 3.41Å; A98-G101 VanDerWaalsContact O-N 3.08Å; A98-G102 PolarHBondContact O-N 3.3Å
99	P	97.3	Very high	96.2	Very high	84 Å²	84	78.2 Å²	78.2	55%	0.545	39%	0.392	S	S	.	.	H	α-helix	trans	-55.9	-41.6	177.5	-27.2	34.5	0	0	0	113.8	R95 K96 G102 M103	R95-P99 WeakPolarHBondContact O-CD 3.45Å; K96-P99 WeakPolarHBondContact O-CD 3.49Å; P99-G102 PolarHBondContact O-N 3.29Å; P99-M103 WeakPolarHBondContact O-CG 3.19Å; P99-M103 PolarHBondContact O-N 3.08Å
100	Y	98.1	Very high	96.4	Very high	140 Å²	140	79.7 Å²	79.7	55%	0.549	40%	0.397	S	S	.	.	H	α-helix	trans	-66.2	-40.4	176.2	-58.9	-76.6	0	0	0	111.9	K96 L97 A98 G102 M103 F104	K96-Y100 WeakPolarHBondContact O-CD2 3.37Å; K96-Y100 VanDerWaalsContact O-CE2 3.24Å; K96-Y100 WeakPolarHBondContact O-CE2 3.35Å; L97-Y100 PolarHBondContact O-N 2.92Å; A98-Y100 VanDerWaalsContact C-N 3.31Å; A98-Y100 PolarHBondContact O-N 3.43Å; Y100-G102 VanDerWaalsContact C-N 3.33Å; Y100-G102 PolarHBondContact O-N 3.06Å; Y100-M103 HydrophobicContact CD1-CE 3.26Å; Y100-M103 HydrophobicContact CE1-CE 3.88Å; Y100-M103 HydrophobicContact CG-CE 4.03Å; Y100-M103 PolarHBondContact O-N 2.7Å; Y100-F104 VanDerWaalsContact O-CD2 3.28Å; Y100-F104 WeakPolarHBondContact O-CD2 3.49Å; Y100-F104 PolarHBondContact O-N 3.37Å; Y100-F104 VanDerWaalsContact O-N 3.11Å
101	G	98.3	Very high	96.7	Very high	0 Å²	0	74.4 Å²	74.4	0%	0	37%	0.374	C	S	.	.	H	α-helix	trans	-57.2	-46.4	171.2	0	0	0	0	0	112	G75 L97 A98 M103 F104 L105	G75-G101 WeakPolarHBondContact CA-O 3.32Å; L97-G101 PolarHBondContact O-N 3.42Å; A98-G101 WeakPolarHBondContact O-CA 3.5Å; A98-G101 PolarHBondContact O-N 3.41Å; A98-G101 VanDerWaalsContact O-N 3.08Å; G101-M103 VanDerWaalsContact C-N 3.33Å; G101-M103 PolarHBondContact O-N 3.04Å; G101-F104 PolarHBondContact O-N 3.23Å; G101-F104 VanDerWaalsContact O-N 3.16Å; G101-L105 VanDerWaalsContact O-CG 3.31Å; G101-L105 WeakPolarHBondContact O-CG 3.34Å; G101-L105 PolarHBondContact O-N 3.46Å
102	G	98.3	Very high	96.8	Very high	18 Å²	18	73.4 Å²	73.4	19%	0.186	37%	0.368	C	S	.	.	H	α-helix	trans	-57.4	-41.8	175.5	0	0	0	0	0	113.3	A98 P99 Y100 L105 I106	A98-G102 PolarHBondContact O-N 3.3Å; P99-G102 PolarHBondContact O-N 3.29Å; Y100-G102 VanDerWaalsContact C-N 3.33Å; Y100-G102 PolarHBondContact O-N 3.06Å; G102-L105 WeakPolarHBondContact O-CB 3.3Å; G102-L105 PolarHBondContact O-N 3.01Å; G102-I106 WeakPolarHBondContact O-CG1 3.37Å; G102-I106 PolarHBondContact O-N 3.42Å
103	M	98.6	Very high	97	Very high	109 Å²	109	74.3 Å²	74.3	54%	0.537	38%	0.382	S	S	.	.	H	α-helix	trans	-62.7	-42.5	175.5	-68.9	-171.3	-69.8	0	0	112.3	P99 Y100 G101 L105 I106 A107	P99-M103 WeakPolarHBondContact O-CG 3.19Å; P99-M103 PolarHBondContact O-N 3.08Å; Y100-M103 HydrophobicContact CD1-CE 3.26Å; Y100-M103 HydrophobicContact CE1-CE 3.88Å; Y100-M103 HydrophobicContact CG-CE 4.03Å; Y100-M103 PolarHBondContact O-N 2.7Å; G101-M103 VanDerWaalsContact C-N 3.33Å; G101-M103 PolarHBondContact O-N 3.04Å; M103-L105 VanDerWaalsContact C-N 3.34Å; M103-I106 PolarHBondContact O-N 2.92Å; M103-A107 WeakPolarHBondContact O-CB 3.33Å; M103-A107 PolarHBondContact O-N 3.24Å
104	F	98.6	Very high	96.8	Very high	88 Å²	88	74.9 Å²	74.9	39%	0.386	38%	0.38	S	S	.	.	H	α-helix	trans	-64.7	-38	174.3	-70.4	-51.5	0	0	0	112.5	L71 L74 Y100 G101 A107 G108	L71-F104 HydrophobicContact CD2-CD1 3.74Å; L71-F104 HydrophobicContact CD2-CE1 4.43Å; L74-F104 HydrophobicContact CB-CD2 4.45Å; Y100-F104 VanDerWaalsContact O-CD2 3.28Å; Y100-F104 WeakPolarHBondContact O-CD2 3.49Å; Y100-F104 PolarHBondContact O-N 3.37Å; Y100-F104 VanDerWaalsContact O-N 3.11Å; G101-F104 PolarHBondContact O-N 3.23Å; G101-F104 VanDerWaalsContact O-N 3.16Å; F104-A107 PolarHBondContact O-N 3.34Å; F104-G108 PolarHBondContact O-N 3.06Å
105	L	98.6	Very high	96.9	Very high	6 Å²	6	75.4 Å²	75.4	3%	0.031	38%	0.382	C	S	.	.	H	α-helix	trans	-62.4	-45.4	175.6	-68.6	173	0	0	0	111.4	H52 L72 F79 G101 G102 M103 G108 W109	H52-L105 HydrophobicContact CB-CD2 4.19Å; H52-L105 WeakPolarHBondContact NE2-CD1 3.28Å; L72-L105 HydrophobicContact CD2-CD2 4.13Å; F79-L105 HydrophobicContact CB-CD1 3.84Å; F79-L105 HydrophobicContact CD1-CD1 4.27Å; F79-L105 HydrophobicContact CG-CD1 4.06Å; G101-L105 VanDerWaalsContact O-CG 3.31Å; G101-L105 WeakPolarHBondContact O-CG 3.34Å; G101-L105 PolarHBondContact O-N 3.46Å; G102-L105 WeakPolarHBondContact O-CB 3.3Å; G102-L105 PolarHBondContact O-N 3.01Å; M103-L105 VanDerWaalsContact C-N 3.34Å; L105-G108 PolarHBondContact O-N 3.4Å; L105-W109 VanDerWaalsContact O-CD1 3.25Å; L105-W109 PolarHBondContact O-N 3.19Å
106	I	98.7	Very high	97.3	Very high	111 Å²	111	71.5 Å²	71.5	57%	0.569	37%	0.372	S	S	*	.	H	α-helix	trans	-59.3	-50.8	174.7	-67.5	164.7	0	0	0	110.3	G102 M103 G108 W109 L110	G102-I106 WeakPolarHBondContact O-CG1 3.37Å; G102-I106 PolarHBondContact O-N 3.42Å; M103-I106 PolarHBondContact O-N 2.92Å; I106-G108 VanDerWaalsContact C-N 3.26Å; I106-G108 PolarHBondContact O-N 2.97Å; I106-W109 PolarHBondContact O-N 2.92Å; I106-L110 HydrophobicContact CG2-CD1 4.18Å; I106-L110 WeakPolarHBondContact O-CG 2.86Å; I106-L110 PolarHBondContact O-N 3.24Å
107	A	98.6	Very high	97.5	Very high	36 Å²	36	65.6 Å²	65.6	30%	0.298	35%	0.35	S	S	.	.	H	α-helix	trans	-61.1	-36	178.8	0	0	0	0	0	112.3	L71 M103 F104 L110 A111	L71-A107 HydrophobicContact CD1-CB 3.95Å; L71-A107 HydrophobicContact CD2-CB 4.29Å; M103-A107 WeakPolarHBondContact O-CB 3.33Å; M103-A107 PolarHBondContact O-N 3.24Å; F104-A107 PolarHBondContact O-N 3.34Å; A107-L110 PolarHBondContact O-N 2.89Å; A107-A111 WeakPolarHBondContact O-CB 3.45Å; A107-A111 PolarHBondContact O-N 3.25Å
108	G	98.3	Very high	97.5	Very high	0 Å²	0	64.9 Å²	64.9	0%	0	35%	0.347	C	S	.	.	H	α-helix	trans	-63.4	-44	176.2	0	0	0	0	0	112.5	F104 L105 I106 A111 I112	F104-G108 PolarHBondContact O-N 3.06Å; L105-G108 PolarHBondContact O-N 3.4Å; I106-G108 VanDerWaalsContact C-N 3.26Å; I106-G108 PolarHBondContact O-N 2.97Å; G108-A111 PolarHBondContact O-N 3.46Å; G108-I112 WeakPolarHBondContact O-CG1 3.27Å; G108-I112 PolarHBondContact O-N 3.11Å; G108-I112 VanDerWaalsContact O-N 3.14Å
109	W	98.5	Very high	97.6	Very high	132 Å²	132	68.4 Å²	68.4	50%	0.5	36%	0.364	S	S	.	.	H	α-helix	trans	-63	-43.7	172.9	-82.8	105.3	0	0	0	112.4	H52 A55 L105 I106 A111 I112 A113	H52-W109 AromaticContact CE1-CD1 3.75Å; H52-W109 AromaticContact CE1-NE1 3.14Å; H52-W109 PolarHBondContact CE1-NE1 2.79Å; H52-W109 AromaticContact ND1-NE1 3.37Å; H52-W109 PolarHBondContact ND1-NE1 2.96Å; A55-W109 HydrophobicContact CB-CH2 3.9Å; A55-W109 HydrophobicContact CB-CZ2 3.53Å; L105-W109 VanDerWaalsContact O-CD1 3.25Å; L105-W109 PolarHBondContact O-N 3.19Å; I106-W109 PolarHBondContact O-N 2.92Å; W109-A111 VanDerWaalsContact C-N 3.27Å; W109-A111 PolarHBondContact O-N 3.03Å; W109-I112 HydrophobicContact CE3-CD1 4.3Å; W109-I112 WeakPolarHBondContact O-CB 3.33Å; W109-I112 PolarHBondContact O-N 2.98Å; W109-I112 VanDerWaalsContact O-N 3.11Å; W109-A113 PolarHBondContact O-N 3.13Å
110	L	98.4	Very high	97.7	Very high	108 Å²	108	67.3 Å²	67.3	57%	0.565	35%	0.352	S	S	*	.	H	α-helix	trans	-61.9	-37	175.2	-67.2	174.7	0	0	0	111.8	I106 A107 I112 A113 I114	I106-L110 HydrophobicContact CG2-CD1 4.18Å; I106-L110 WeakPolarHBondContact O-CG 2.86Å; I106-L110 PolarHBondContact O-N 3.24Å; A107-L110 PolarHBondContact O-N 2.89Å; L110-I112 VanDerWaalsContact C-N 3.28Å; L110-I112 PolarHBondContact O-N 3.12Å; L110-A113 WeakPolarHBondContact O-CB 3.43Å; L110-A113 PolarHBondContact O-N 3.45Å; L110-A113 VanDerWaalsContact O-N 3.11Å; L110-I114 WeakPolarHBondContact O-CG1 3.47Å
111	A	97.4	Very high	97.6	Very high	12 Å²	12	62.1 Å²	62.1	10%	0.099	34%	0.338	C	S	.	.	H	α-helix	trans	-68.5	-23.9	175.9	0	0	0	0	0	113.5	V67 A68 L71 A107 G108 W109 A113	V67-A111 HydrophobicContact CG1-CB 3.97Å; A68-A111 HydrophobicContact CB-CB 4Å; L71-A111 HydrophobicContact CD1-CB 4.13Å; A107-A111 WeakPolarHBondContact O-CB 3.45Å; A107-A111 PolarHBondContact O-N 3.25Å; G108-A111 PolarHBondContact O-N 3.46Å; W109-A111 VanDerWaalsContact C-N 3.27Å; W109-A111 PolarHBondContact O-N 3.03Å; A111-A113 VanDerWaalsContact C-N 3.35Å
112	I	97.4	Very high	97.6	Very high	46 Å²	46	66.9 Å²	66.9	24%	0.236	36%	0.364	C	S	.	.	H	α-helix	trans	-70.2	-35.4	170	-66.4	171.7	0	0	0	110.6	A59 C62 A68 L72 G108 W109 L110 I114	A59-I112 HydrophobicContact CB-CD1 3.94Å; A59-I112 HydrophobicContact CB-CG1 3.98Å; C62-I112 HydrophobicContact CB-CG2 4.29Å; A68-I112 HydrophobicContact CB-CG1 3.76Å; L72-I112 HydrophobicContact CD1-CD1 3.95Å; G108-I112 WeakPolarHBondContact O-CG1 3.27Å; G108-I112 PolarHBondContact O-N 3.11Å; G108-I112 VanDerWaalsContact O-N 3.14Å; W109-I112 HydrophobicContact CE3-CD1 4.3Å; W109-I112 WeakPolarHBondContact O-CB 3.33Å; W109-I112 PolarHBondContact O-N 2.98Å; W109-I112 VanDerWaalsContact O-N 3.11Å; L110-I112 VanDerWaalsContact C-N 3.28Å; L110-I112 PolarHBondContact O-N 3.12Å; I112-I114 PolarHBondContact O-N 2.9Å
113	A	96.8	Very high	97.5	Very high	87 Å²	87	71 Å²	71	72%	0.719	38%	0.378	S	S	*	.			trans	-72.3	-10	-175.9	0	0	0	0	0	114.5	W109 L110 A111	W109-A113 PolarHBondContact O-N 3.13Å; L110-A113 WeakPolarHBondContact O-CB 3.43Å; L110-A113 PolarHBondContact O-N 3.45Å; L110-A113 VanDerWaalsContact O-N 3.11Å; A111-A113 VanDerWaalsContact C-N 3.35Å
114	I	90.5	Very high	97.4	Very high	117 Å²	117	67.5 Å²	67.5	60%	0.6	36%	0.364	S	S	*	.			trans	-113.5	0	-174.2	-56.7	166.2	0	0	0	111	R63 L110 I112	R63-I114 WeakPolarHBondContact CD-O 3.42Å; L110-I114 WeakPolarHBondContact O-CG1 3.47Å; I112-I114 PolarHBondContact O-N 2.9Å

Retrieved 114 of 114 residues in 94.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).